--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 12:44:07 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/10res/mrp/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/10res/mrp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mrp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/10res/mrp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1566.25 -1569.30 2 -1566.19 -1569.09 -------------------------------------- TOTAL -1566.22 -1569.20 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/10res/mrp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mrp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/10res/mrp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.900307 0.087839 0.363219 1.473991 0.866011 1327.54 1414.27 1.000 r(A<->C){all} 0.169114 0.020487 0.000042 0.461396 0.133110 289.27 311.37 1.000 r(A<->G){all} 0.154573 0.019045 0.000025 0.442095 0.114744 158.45 172.76 1.003 r(A<->T){all} 0.167619 0.019669 0.000020 0.454241 0.132339 119.59 213.79 1.000 r(C<->G){all} 0.168892 0.019477 0.000088 0.451022 0.133195 180.86 256.78 1.001 r(C<->T){all} 0.177704 0.021047 0.000154 0.471349 0.140038 244.96 266.19 1.006 r(G<->T){all} 0.162098 0.018314 0.000028 0.433324 0.128393 235.08 245.38 1.009 pi(A){all} 0.217504 0.000139 0.194432 0.240238 0.216989 1388.36 1423.07 1.000 pi(C){all} 0.305620 0.000181 0.278205 0.332543 0.305604 1319.69 1410.34 1.000 pi(G){all} 0.300018 0.000184 0.271820 0.325345 0.299835 1359.21 1383.98 1.001 pi(T){all} 0.176859 0.000120 0.156352 0.198802 0.176722 1157.04 1244.95 1.001 alpha{1,2} 0.429165 0.227054 0.000137 1.388082 0.257902 1070.89 1260.01 1.000 alpha{3} 0.451059 0.230438 0.000112 1.434250 0.295083 1286.25 1371.68 1.000 pinvar{all} 0.998701 0.000002 0.995693 0.999999 0.999204 895.12 1016.56 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1507.378889 Model 2: PositiveSelection -1507.378625 Model 0: one-ratio -1507.379155 Model 7: beta -1507.378625 Model 8: beta&w>1 -1507.378625 Model 0 vs 1 5.320000000210712E-4 Model 2 vs 1 5.280000000311702E-4 Model 8 vs 7 0.0
>C1 MSRTDRNAADLKSAVSTALAKVIDPELQRPITELGMVKNIDIEPGGNVQV GIYLTIASCPKKSEISKRVTKAIADVPGTAAVEVSLDVMSDEQRTKLRKK LRGDAREPMIPFAQPNSLTRVYTVASGKGGVGKSTVTVNLATAIAARGLA VGVLDADIHGHSIPRMMGSNQRPIQLESMILPPIVHEVKVISIGQFTEGN TPVIWRGPMLHRALQQFLSDVYWGDLDVLMLDLPPGTGDIAISVAQLIPN AEILVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLMMPDGSRLQ VFGEGGGQQVAERLSRAVGTDVPLLGQIPLDPALVAAGDSGIPIVLNASD SPVGKELLRIADGLSSRQRRLAGVSLGLDPSRR >C2 MSRTDRNAADLKSAVSTALAKVIDPELQRPITELGMVKNIDIEPGGNVQV GIYLTIASCPKKSEISKRVTKAIADVPGTAAVEVSLDVMSDEQRTKLRKK LRGDAREPMIPFAQPNSLTRVYTVASGKGGVGKSTVTVNLATAIAARGLA VGVLDADIHGHSIPRMMGSNQRPIQLESMILPPIVHEVKVISIGQFTEGN TPVIWRGPMLHRALQQFLSDVYWGDLDVLMLDLPPGTGDIAISVAQLIPN AEILVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLMMPDGSRLQ VFGEGGGQQVAERLSRAVGTDVPLLGQIPLDPALVAAGDSGIPIVLNASD SPVGKELLRIADGLSSRQRRLAGVSLGLDPSRR >C3 MSRTDRNAADLKSAVSTALAKVIDPELQRPITELGMVKNIDIEPGGNVQV GIYLTIASCPKKSEISKRVTKAIADVPGTAAVEVSLDVMSDEQRTKLRKK LRGDAREPMIPFAQPNSLTRVYTVASGKGGVGKSTVTVNLATAIAARGLA VGVLDADIHGHSIPRMMGSNQRPIQLESMILPPIVHEVKVISIGQFTEGN TPVIWRGPMLHRALQQFLSDVYWGDLDVLMLDLPPGTGDIAISVAQLIPN AEILVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLMMPDGSRLQ VFGEGGGQQVAERLSRAVGTDVPLLGQIPLDPALVAAGDSGIPIVLNASD SPVGKELLRIADGLSSRQRRLAGVSLGLDPSRR >C4 MSRTDRNAADLKSAVSTALAKVIDPELQRPITELGMVKNIDIEPGGNVQV GIYLTIASCPKKSEISKRVTKAIADVPGTAAVEVSLDVMSDEQRTKLRKK LRGDAREPMIPFAQPNSLTRVYTVASGKGGVGKSTVTVNLATAIAARGLA VGVLDADIHGHSIPRMMGSNQRPIQLESMILPPIVHEVKVISIGQFTEGN TPVIWRGPMLHRALQQFLSDVYWGDLDVLMLDLPPGTGDIAISVAQLIPN AEILVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLMMPDGSRLQ VFGEGGGQQVAERLSRAVGTDVPLLGQIPLDPALVAAGDSGIPIVLNASD SPVGKELLRIADGLSSRQRRLAGVSLGLDPSRR >C5 MSRTDRNAADLKSAVSTALAKVIDPELQRPITELGMVKNIDIEPGGNVQV GIYLTIASCPKKSEISKRVTKAIADVPGTAAVEVSLDVMSDEQRTKLRKK LRGDAREPMIPFAQPNSLTRVYTVASGKGGVGKSTVTVNLATAIAARGLA VGVLDADIHGHSIPRMMGSNQRPIQLESMILPPIVHEVKVISIGQFTEGN TPVIWRGPMLHRALQQFLSDVYWGDLDVLMLDLPPGTGDIAISVAQLIPN AEILVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLMMPDGSRLQ VFGEGGGQQVAERLSRAVGTDVPLLGQIPLDPALVAAGDSGIPIVLNASD SPVGKELLRIADGLSSRQRRLAGVSLGLDPSRR >C6 MSRTDRNAADLKSAVSTALAKVIDPELQRPITELGMVKNIDIEPGGNVQV GIYLTIASCPKKSEISKRVTKAIADVPGTAAVEVSLDVMSDEQRTKLRKK LRGDAREPMIPFAQPNSLTRVYTVASGKGGVGKSTVTVNLATAIAARGLA VGVLDADIHGHSIPRMMGSNQRPIQLESMILPPIVHEVKVISIGQFTEGN TPVIWRGPMLHRALQQFLSDVYWGDLDVLMLDLPPGTGDIAISVAQLIPN AEILVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLMMPDGSRLQ VFGEGGGQQVAERLSRAVGTDVPLLGQIPLDPALVAAGDSGIPIVLNASD SPVGKELLRIADGLSSRQRRLAGVSLGLDPSRR CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=383 C1 MSRTDRNAADLKSAVSTALAKVIDPELQRPITELGMVKNIDIEPGGNVQV C2 MSRTDRNAADLKSAVSTALAKVIDPELQRPITELGMVKNIDIEPGGNVQV C3 MSRTDRNAADLKSAVSTALAKVIDPELQRPITELGMVKNIDIEPGGNVQV C4 MSRTDRNAADLKSAVSTALAKVIDPELQRPITELGMVKNIDIEPGGNVQV C5 MSRTDRNAADLKSAVSTALAKVIDPELQRPITELGMVKNIDIEPGGNVQV C6 MSRTDRNAADLKSAVSTALAKVIDPELQRPITELGMVKNIDIEPGGNVQV ************************************************** C1 GIYLTIASCPKKSEISKRVTKAIADVPGTAAVEVSLDVMSDEQRTKLRKK C2 GIYLTIASCPKKSEISKRVTKAIADVPGTAAVEVSLDVMSDEQRTKLRKK C3 GIYLTIASCPKKSEISKRVTKAIADVPGTAAVEVSLDVMSDEQRTKLRKK C4 GIYLTIASCPKKSEISKRVTKAIADVPGTAAVEVSLDVMSDEQRTKLRKK C5 GIYLTIASCPKKSEISKRVTKAIADVPGTAAVEVSLDVMSDEQRTKLRKK C6 GIYLTIASCPKKSEISKRVTKAIADVPGTAAVEVSLDVMSDEQRTKLRKK ************************************************** C1 LRGDAREPMIPFAQPNSLTRVYTVASGKGGVGKSTVTVNLATAIAARGLA C2 LRGDAREPMIPFAQPNSLTRVYTVASGKGGVGKSTVTVNLATAIAARGLA C3 LRGDAREPMIPFAQPNSLTRVYTVASGKGGVGKSTVTVNLATAIAARGLA C4 LRGDAREPMIPFAQPNSLTRVYTVASGKGGVGKSTVTVNLATAIAARGLA C5 LRGDAREPMIPFAQPNSLTRVYTVASGKGGVGKSTVTVNLATAIAARGLA C6 LRGDAREPMIPFAQPNSLTRVYTVASGKGGVGKSTVTVNLATAIAARGLA ************************************************** C1 VGVLDADIHGHSIPRMMGSNQRPIQLESMILPPIVHEVKVISIGQFTEGN C2 VGVLDADIHGHSIPRMMGSNQRPIQLESMILPPIVHEVKVISIGQFTEGN C3 VGVLDADIHGHSIPRMMGSNQRPIQLESMILPPIVHEVKVISIGQFTEGN C4 VGVLDADIHGHSIPRMMGSNQRPIQLESMILPPIVHEVKVISIGQFTEGN C5 VGVLDADIHGHSIPRMMGSNQRPIQLESMILPPIVHEVKVISIGQFTEGN C6 VGVLDADIHGHSIPRMMGSNQRPIQLESMILPPIVHEVKVISIGQFTEGN ************************************************** C1 TPVIWRGPMLHRALQQFLSDVYWGDLDVLMLDLPPGTGDIAISVAQLIPN C2 TPVIWRGPMLHRALQQFLSDVYWGDLDVLMLDLPPGTGDIAISVAQLIPN C3 TPVIWRGPMLHRALQQFLSDVYWGDLDVLMLDLPPGTGDIAISVAQLIPN C4 TPVIWRGPMLHRALQQFLSDVYWGDLDVLMLDLPPGTGDIAISVAQLIPN C5 TPVIWRGPMLHRALQQFLSDVYWGDLDVLMLDLPPGTGDIAISVAQLIPN C6 TPVIWRGPMLHRALQQFLSDVYWGDLDVLMLDLPPGTGDIAISVAQLIPN ************************************************** C1 AEILVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLMMPDGSRLQ C2 AEILVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLMMPDGSRLQ C3 AEILVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLMMPDGSRLQ C4 AEILVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLMMPDGSRLQ C5 AEILVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLMMPDGSRLQ C6 AEILVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLMMPDGSRLQ ************************************************** C1 VFGEGGGQQVAERLSRAVGTDVPLLGQIPLDPALVAAGDSGIPIVLNASD C2 VFGEGGGQQVAERLSRAVGTDVPLLGQIPLDPALVAAGDSGIPIVLNASD C3 VFGEGGGQQVAERLSRAVGTDVPLLGQIPLDPALVAAGDSGIPIVLNASD C4 VFGEGGGQQVAERLSRAVGTDVPLLGQIPLDPALVAAGDSGIPIVLNASD C5 VFGEGGGQQVAERLSRAVGTDVPLLGQIPLDPALVAAGDSGIPIVLNASD C6 VFGEGGGQQVAERLSRAVGTDVPLLGQIPLDPALVAAGDSGIPIVLNASD ************************************************** C1 SPVGKELLRIADGLSSRQRRLAGVSLGLDPSRR C2 SPVGKELLRIADGLSSRQRRLAGVSLGLDPSRR C3 SPVGKELLRIADGLSSRQRRLAGVSLGLDPSRR C4 SPVGKELLRIADGLSSRQRRLAGVSLGLDPSRR C5 SPVGKELLRIADGLSSRQRRLAGVSLGLDPSRR C6 SPVGKELLRIADGLSSRQRRLAGVSLGLDPSRR ********************************* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 383 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 383 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11490] Library Relaxation: Multi_proc [96] Relaxation Summary: [11490]--->[11490] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.529 Mb, Max= 30.960 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MSRTDRNAADLKSAVSTALAKVIDPELQRPITELGMVKNIDIEPGGNVQV C2 MSRTDRNAADLKSAVSTALAKVIDPELQRPITELGMVKNIDIEPGGNVQV C3 MSRTDRNAADLKSAVSTALAKVIDPELQRPITELGMVKNIDIEPGGNVQV C4 MSRTDRNAADLKSAVSTALAKVIDPELQRPITELGMVKNIDIEPGGNVQV C5 MSRTDRNAADLKSAVSTALAKVIDPELQRPITELGMVKNIDIEPGGNVQV C6 MSRTDRNAADLKSAVSTALAKVIDPELQRPITELGMVKNIDIEPGGNVQV ************************************************** C1 GIYLTIASCPKKSEISKRVTKAIADVPGTAAVEVSLDVMSDEQRTKLRKK C2 GIYLTIASCPKKSEISKRVTKAIADVPGTAAVEVSLDVMSDEQRTKLRKK C3 GIYLTIASCPKKSEISKRVTKAIADVPGTAAVEVSLDVMSDEQRTKLRKK C4 GIYLTIASCPKKSEISKRVTKAIADVPGTAAVEVSLDVMSDEQRTKLRKK C5 GIYLTIASCPKKSEISKRVTKAIADVPGTAAVEVSLDVMSDEQRTKLRKK C6 GIYLTIASCPKKSEISKRVTKAIADVPGTAAVEVSLDVMSDEQRTKLRKK ************************************************** C1 LRGDAREPMIPFAQPNSLTRVYTVASGKGGVGKSTVTVNLATAIAARGLA C2 LRGDAREPMIPFAQPNSLTRVYTVASGKGGVGKSTVTVNLATAIAARGLA C3 LRGDAREPMIPFAQPNSLTRVYTVASGKGGVGKSTVTVNLATAIAARGLA C4 LRGDAREPMIPFAQPNSLTRVYTVASGKGGVGKSTVTVNLATAIAARGLA C5 LRGDAREPMIPFAQPNSLTRVYTVASGKGGVGKSTVTVNLATAIAARGLA C6 LRGDAREPMIPFAQPNSLTRVYTVASGKGGVGKSTVTVNLATAIAARGLA ************************************************** C1 VGVLDADIHGHSIPRMMGSNQRPIQLESMILPPIVHEVKVISIGQFTEGN C2 VGVLDADIHGHSIPRMMGSNQRPIQLESMILPPIVHEVKVISIGQFTEGN C3 VGVLDADIHGHSIPRMMGSNQRPIQLESMILPPIVHEVKVISIGQFTEGN C4 VGVLDADIHGHSIPRMMGSNQRPIQLESMILPPIVHEVKVISIGQFTEGN C5 VGVLDADIHGHSIPRMMGSNQRPIQLESMILPPIVHEVKVISIGQFTEGN C6 VGVLDADIHGHSIPRMMGSNQRPIQLESMILPPIVHEVKVISIGQFTEGN ************************************************** C1 TPVIWRGPMLHRALQQFLSDVYWGDLDVLMLDLPPGTGDIAISVAQLIPN C2 TPVIWRGPMLHRALQQFLSDVYWGDLDVLMLDLPPGTGDIAISVAQLIPN C3 TPVIWRGPMLHRALQQFLSDVYWGDLDVLMLDLPPGTGDIAISVAQLIPN C4 TPVIWRGPMLHRALQQFLSDVYWGDLDVLMLDLPPGTGDIAISVAQLIPN C5 TPVIWRGPMLHRALQQFLSDVYWGDLDVLMLDLPPGTGDIAISVAQLIPN C6 TPVIWRGPMLHRALQQFLSDVYWGDLDVLMLDLPPGTGDIAISVAQLIPN ************************************************** C1 AEILVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLMMPDGSRLQ C2 AEILVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLMMPDGSRLQ C3 AEILVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLMMPDGSRLQ C4 AEILVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLMMPDGSRLQ C5 AEILVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLMMPDGSRLQ C6 AEILVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLMMPDGSRLQ ************************************************** C1 VFGEGGGQQVAERLSRAVGTDVPLLGQIPLDPALVAAGDSGIPIVLNASD C2 VFGEGGGQQVAERLSRAVGTDVPLLGQIPLDPALVAAGDSGIPIVLNASD C3 VFGEGGGQQVAERLSRAVGTDVPLLGQIPLDPALVAAGDSGIPIVLNASD C4 VFGEGGGQQVAERLSRAVGTDVPLLGQIPLDPALVAAGDSGIPIVLNASD C5 VFGEGGGQQVAERLSRAVGTDVPLLGQIPLDPALVAAGDSGIPIVLNASD C6 VFGEGGGQQVAERLSRAVGTDVPLLGQIPLDPALVAAGDSGIPIVLNASD ************************************************** C1 SPVGKELLRIADGLSSRQRRLAGVSLGLDPSRR C2 SPVGKELLRIADGLSSRQRRLAGVSLGLDPSRR C3 SPVGKELLRIADGLSSRQRRLAGVSLGLDPSRR C4 SPVGKELLRIADGLSSRQRRLAGVSLGLDPSRR C5 SPVGKELLRIADGLSSRQRRLAGVSLGLDPSRR C6 SPVGKELLRIADGLSSRQRRLAGVSLGLDPSRR ********************************* FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGTCTAGAACTGATCGTAACGCTGCCGACCTGAAATCGGCGGTCAGCAC C2 ATGTCTAGAACTGATCGTAACGCTGCCGACCTGAAATCGGCGGTCAGCAC C3 ATGTCTAGAACTGATCGTAACGCTGCCGACCTGAAATCGGCGGTCAGCAC C4 ATGTCTAGAACTGATCGTAACGCTGCCGACCTGAAATCGGCGGTCAGCAC C5 ATGTCTAGAACTGATCGTAACGCTGCCGACCTGAAATCGGCGGTCAGCAC C6 ATGTCTAGAACTGATCGTAACGCTGCCGACCTGAAATCGGCGGTCAGCAC ************************************************** C1 AGCGCTGGCAAAAGTGATCGACCCCGAACTACAGCGCCCCATCACTGAAC C2 AGCGCTGGCAAAAGTGATCGACCCCGAACTACAGCGCCCCATCACTGAAC C3 AGCGCTGGCAAAAGTGATCGACCCCGAACTACAGCGCCCCATCACTGAAC C4 AGCGCTGGCAAAAGTGATCGACCCCGAACTACAGCGCCCCATCACTGAAC C5 AGCGCTGGCAAAAGTGATCGACCCCGAACTACAGCGCCCCATCACTGAAC C6 AGCGCTGGCAAAAGTGATCGACCCCGAACTACAGCGCCCCATCACTGAAC ************************************************** C1 TCGGGATGGTCAAAAACATCGACATCGAGCCGGGTGGCAACGTACAGGTA C2 TCGGGATGGTCAAAAACATCGACATCGAGCCGGGTGGCAACGTACAGGTA C3 TCGGGATGGTCAAAAACATCGACATCGAGCCGGGTGGCAACGTACAGGTA C4 TCGGGATGGTCAAAAACATCGACATCGAGCCGGGTGGCAACGTACAGGTA C5 TCGGGATGGTCAAAAACATCGACATCGAGCCGGGTGGCAACGTACAGGTA C6 TCGGGATGGTCAAAAACATCGACATCGAGCCGGGTGGCAACGTACAGGTA ************************************************** C1 GGGATTTACCTGACCATCGCTAGCTGCCCGAAAAAATCCGAAATCAGTAA C2 GGGATTTACCTGACCATCGCTAGCTGCCCGAAAAAATCCGAAATCAGTAA C3 GGGATTTACCTGACCATCGCTAGCTGCCCGAAAAAATCCGAAATCAGTAA C4 GGGATTTACCTGACCATCGCTAGCTGCCCGAAAAAATCCGAAATCAGTAA C5 GGGATTTACCTGACCATCGCTAGCTGCCCGAAAAAATCCGAAATCAGTAA C6 GGGATTTACCTGACCATCGCTAGCTGCCCGAAAAAATCCGAAATCAGTAA ************************************************** C1 ACGCGTCACCAAGGCTATTGCTGACGTTCCCGGCACCGCGGCAGTGGAGG C2 ACGCGTCACCAAGGCTATTGCTGACGTTCCCGGCACCGCGGCAGTGGAGG C3 ACGCGTCACCAAGGCTATTGCTGACGTTCCCGGCACCGCGGCAGTGGAGG C4 ACGCGTCACCAAGGCTATTGCTGACGTTCCCGGCACCGCGGCAGTGGAGG C5 ACGCGTCACCAAGGCTATTGCTGACGTTCCCGGCACCGCGGCAGTGGAGG C6 ACGCGTCACCAAGGCTATTGCTGACGTTCCCGGCACCGCGGCAGTGGAGG ************************************************** C1 TCAGTCTGGACGTGATGAGCGACGAGCAGCGCACCAAGTTGCGCAAAAAG C2 TCAGTCTGGACGTGATGAGCGACGAGCAGCGCACCAAGTTGCGCAAAAAG C3 TCAGTCTGGACGTGATGAGCGACGAGCAGCGCACCAAGTTGCGCAAAAAG C4 TCAGTCTGGACGTGATGAGCGACGAGCAGCGCACCAAGTTGCGCAAAAAG C5 TCAGTCTGGACGTGATGAGCGACGAGCAGCGCACCAAGTTGCGCAAAAAG C6 TCAGTCTGGACGTGATGAGCGACGAGCAGCGCACCAAGTTGCGCAAAAAG ************************************************** C1 TTACGCGGTGATGCCCGTGAACCGATGATCCCGTTCGCTCAACCCAACTC C2 TTACGCGGTGATGCCCGTGAACCGATGATCCCGTTCGCTCAACCCAACTC C3 TTACGCGGTGATGCCCGTGAACCGATGATCCCGTTCGCTCAACCCAACTC C4 TTACGCGGTGATGCCCGTGAACCGATGATCCCGTTCGCTCAACCCAACTC C5 TTACGCGGTGATGCCCGTGAACCGATGATCCCGTTCGCTCAACCCAACTC C6 TTACGCGGTGATGCCCGTGAACCGATGATCCCGTTCGCTCAACCCAACTC ************************************************** C1 GCTGACCCGAGTGTATACAGTGGCATCCGGCAAGGGAGGAGTCGGAAAGT C2 GCTGACCCGAGTGTATACAGTGGCATCCGGCAAGGGAGGAGTCGGAAAGT C3 GCTGACCCGAGTGTATACAGTGGCATCCGGCAAGGGAGGAGTCGGAAAGT C4 GCTGACCCGAGTGTATACAGTGGCATCCGGCAAGGGAGGAGTCGGAAAGT C5 GCTGACCCGAGTGTATACAGTGGCATCCGGCAAGGGAGGAGTCGGAAAGT C6 GCTGACCCGAGTGTATACAGTGGCATCCGGCAAGGGAGGAGTCGGAAAGT ************************************************** C1 CCACCGTCACCGTCAACCTAGCCACGGCGATTGCTGCCCGCGGCCTGGCG C2 CCACCGTCACCGTCAACCTAGCCACGGCGATTGCTGCCCGCGGCCTGGCG C3 CCACCGTCACCGTCAACCTAGCCACGGCGATTGCTGCCCGCGGCCTGGCG C4 CCACCGTCACCGTCAACCTAGCCACGGCGATTGCTGCCCGCGGCCTGGCG C5 CCACCGTCACCGTCAACCTAGCCACGGCGATTGCTGCCCGCGGCCTGGCG C6 CCACCGTCACCGTCAACCTAGCCACGGCGATTGCTGCCCGCGGCCTGGCG ************************************************** C1 GTCGGGGTTCTCGACGCCGACATCCACGGCCACTCCATCCCCCGGATGAT C2 GTCGGGGTTCTCGACGCCGACATCCACGGCCACTCCATCCCCCGGATGAT C3 GTCGGGGTTCTCGACGCCGACATCCACGGCCACTCCATCCCCCGGATGAT C4 GTCGGGGTTCTCGACGCCGACATCCACGGCCACTCCATCCCCCGGATGAT C5 GTCGGGGTTCTCGACGCCGACATCCACGGCCACTCCATCCCCCGGATGAT C6 GTCGGGGTTCTCGACGCCGACATCCACGGCCACTCCATCCCCCGGATGAT ************************************************** C1 GGGTAGCAACCAGCGACCTATACAGCTTGAGTCAATGATTTTACCGCCTA C2 GGGTAGCAACCAGCGACCTATACAGCTTGAGTCAATGATTTTACCGCCTA C3 GGGTAGCAACCAGCGACCTATACAGCTTGAGTCAATGATTTTACCGCCTA C4 GGGTAGCAACCAGCGACCTATACAGCTTGAGTCAATGATTTTACCGCCTA C5 GGGTAGCAACCAGCGACCTATACAGCTTGAGTCAATGATTTTACCGCCTA C6 GGGTAGCAACCAGCGACCTATACAGCTTGAGTCAATGATTTTACCGCCTA ************************************************** C1 TCGTCCACGAGGTAAAAGTCATCTCGATAGGCCAGTTCACCGAGGGCAAC C2 TCGTCCACGAGGTAAAAGTCATCTCGATAGGCCAGTTCACCGAGGGCAAC C3 TCGTCCACGAGGTAAAAGTCATCTCGATAGGCCAGTTCACCGAGGGCAAC C4 TCGTCCACGAGGTAAAAGTCATCTCGATAGGCCAGTTCACCGAGGGCAAC C5 TCGTCCACGAGGTAAAAGTCATCTCGATAGGCCAGTTCACCGAGGGCAAC C6 TCGTCCACGAGGTAAAAGTCATCTCGATAGGCCAGTTCACCGAGGGCAAC ************************************************** C1 ACGCCGGTAATATGGCGCGGGCCAATGCTGCACCGGGCATTGCAGCAGTT C2 ACGCCGGTAATATGGCGCGGGCCAATGCTGCACCGGGCATTGCAGCAGTT C3 ACGCCGGTAATATGGCGCGGGCCAATGCTGCACCGGGCATTGCAGCAGTT C4 ACGCCGGTAATATGGCGCGGGCCAATGCTGCACCGGGCATTGCAGCAGTT C5 ACGCCGGTAATATGGCGCGGGCCAATGCTGCACCGGGCATTGCAGCAGTT C6 ACGCCGGTAATATGGCGCGGGCCAATGCTGCACCGGGCATTGCAGCAGTT ************************************************** C1 TCTATCCGACGTGTATTGGGGCGATCTGGACGTGCTGATGCTCGATCTGC C2 TCTATCCGACGTGTATTGGGGCGATCTGGACGTGCTGATGCTCGATCTGC C3 TCTATCCGACGTGTATTGGGGCGATCTGGACGTGCTGATGCTCGATCTGC C4 TCTATCCGACGTGTATTGGGGCGATCTGGACGTGCTGATGCTCGATCTGC C5 TCTATCCGACGTGTATTGGGGCGATCTGGACGTGCTGATGCTCGATCTGC C6 TCTATCCGACGTGTATTGGGGCGATCTGGACGTGCTGATGCTCGATCTGC ************************************************** C1 CGCCGGGCACCGGCGACATCGCCATCTCGGTAGCTCAGTTAATCCCGAAC C2 CGCCGGGCACCGGCGACATCGCCATCTCGGTAGCTCAGTTAATCCCGAAC C3 CGCCGGGCACCGGCGACATCGCCATCTCGGTAGCTCAGTTAATCCCGAAC C4 CGCCGGGCACCGGCGACATCGCCATCTCGGTAGCTCAGTTAATCCCGAAC C5 CGCCGGGCACCGGCGACATCGCCATCTCGGTAGCTCAGTTAATCCCGAAC C6 CGCCGGGCACCGGCGACATCGCCATCTCGGTAGCTCAGTTAATCCCGAAC ************************************************** C1 GCCGAGATTCTCGTGGTGACCACGCCACAGCTGGCCGCAGCCGAGGTAGC C2 GCCGAGATTCTCGTGGTGACCACGCCACAGCTGGCCGCAGCCGAGGTAGC C3 GCCGAGATTCTCGTGGTGACCACGCCACAGCTGGCCGCAGCCGAGGTAGC C4 GCCGAGATTCTCGTGGTGACCACGCCACAGCTGGCCGCAGCCGAGGTAGC C5 GCCGAGATTCTCGTGGTGACCACGCCACAGCTGGCCGCAGCCGAGGTAGC C6 GCCGAGATTCTCGTGGTGACCACGCCACAGCTGGCCGCAGCCGAGGTAGC ************************************************** C1 CGAACGAGCCGGCAGCATCGCCCTACAGACCCGCCAACGTATTGTCGGTG C2 CGAACGAGCCGGCAGCATCGCCCTACAGACCCGCCAACGTATTGTCGGTG C3 CGAACGAGCCGGCAGCATCGCCCTACAGACCCGCCAACGTATTGTCGGTG C4 CGAACGAGCCGGCAGCATCGCCCTACAGACCCGCCAACGTATTGTCGGTG C5 CGAACGAGCCGGCAGCATCGCCCTACAGACCCGCCAACGTATTGTCGGTG C6 CGAACGAGCCGGCAGCATCGCCCTACAGACCCGCCAACGTATTGTCGGTG ************************************************** C1 TCGTGGAGAACATGTCGGGACTTATGATGCCGGACGGCTCAAGACTACAA C2 TCGTGGAGAACATGTCGGGACTTATGATGCCGGACGGCTCAAGACTACAA C3 TCGTGGAGAACATGTCGGGACTTATGATGCCGGACGGCTCAAGACTACAA C4 TCGTGGAGAACATGTCGGGACTTATGATGCCGGACGGCTCAAGACTACAA C5 TCGTGGAGAACATGTCGGGACTTATGATGCCGGACGGCTCAAGACTACAA C6 TCGTGGAGAACATGTCGGGACTTATGATGCCGGACGGCTCAAGACTACAA ************************************************** C1 GTATTTGGCGAAGGCGGAGGCCAACAAGTCGCCGAGCGGCTCTCACGTGC C2 GTATTTGGCGAAGGCGGAGGCCAACAAGTCGCCGAGCGGCTCTCACGTGC C3 GTATTTGGCGAAGGCGGAGGCCAACAAGTCGCCGAGCGGCTCTCACGTGC C4 GTATTTGGCGAAGGCGGAGGCCAACAAGTCGCCGAGCGGCTCTCACGTGC C5 GTATTTGGCGAAGGCGGAGGCCAACAAGTCGCCGAGCGGCTCTCACGTGC C6 GTATTTGGCGAAGGCGGAGGCCAACAAGTCGCCGAGCGGCTCTCACGTGC ************************************************** C1 AGTCGGCACCGACGTGCCGCTGCTGGGTCAGATCCCGCTGGACCCCGCGC C2 AGTCGGCACCGACGTGCCGCTGCTGGGTCAGATCCCGCTGGACCCCGCGC C3 AGTCGGCACCGACGTGCCGCTGCTGGGTCAGATCCCGCTGGACCCCGCGC C4 AGTCGGCACCGACGTGCCGCTGCTGGGTCAGATCCCGCTGGACCCCGCGC C5 AGTCGGCACCGACGTGCCGCTGCTGGGTCAGATCCCGCTGGACCCCGCGC C6 AGTCGGCACCGACGTGCCGCTGCTGGGTCAGATCCCGCTGGACCCCGCGC ************************************************** C1 TGGTGGCCGCCGGTGATTCGGGTATACCAATCGTGTTGAACGCGTCCGAC C2 TGGTGGCCGCCGGTGATTCGGGTATACCAATCGTGTTGAACGCGTCCGAC C3 TGGTGGCCGCCGGTGATTCGGGTATACCAATCGTGTTGAACGCGTCCGAC C4 TGGTGGCCGCCGGTGATTCGGGTATACCAATCGTGTTGAACGCGTCCGAC C5 TGGTGGCCGCCGGTGATTCGGGTATACCAATCGTGTTGAACGCGTCCGAC C6 TGGTGGCCGCCGGTGATTCGGGTATACCAATCGTGTTGAACGCGTCCGAC ************************************************** C1 TCGCCGGTAGGCAAGGAACTGCTCCGCATCGCCGACGGATTGTCATCGCG C2 TCGCCGGTAGGCAAGGAACTGCTCCGCATCGCCGACGGATTGTCATCGCG C3 TCGCCGGTAGGCAAGGAACTGCTCCGCATCGCCGACGGATTGTCATCGCG C4 TCGCCGGTAGGCAAGGAACTGCTCCGCATCGCCGACGGATTGTCATCGCG C5 TCGCCGGTAGGCAAGGAACTGCTCCGCATCGCCGACGGATTGTCATCGCG C6 TCGCCGGTAGGCAAGGAACTGCTCCGCATCGCCGACGGATTGTCATCGCG ************************************************** C1 GCAGCGCAGACTGGCAGGGGTGTCACTGGGGCTCGACCCGTCGCGGCGC C2 GCAGCGCAGACTGGCAGGGGTGTCACTGGGGCTCGACCCGTCGCGGCGC C3 GCAGCGCAGACTGGCAGGGGTGTCACTGGGGCTCGACCCGTCGCGGCGC C4 GCAGCGCAGACTGGCAGGGGTGTCACTGGGGCTCGACCCGTCGCGGCGC C5 GCAGCGCAGACTGGCAGGGGTGTCACTGGGGCTCGACCCGTCGCGGCGC C6 GCAGCGCAGACTGGCAGGGGTGTCACTGGGGCTCGACCCGTCGCGGCGC ************************************************* >C1 ATGTCTAGAACTGATCGTAACGCTGCCGACCTGAAATCGGCGGTCAGCAC AGCGCTGGCAAAAGTGATCGACCCCGAACTACAGCGCCCCATCACTGAAC TCGGGATGGTCAAAAACATCGACATCGAGCCGGGTGGCAACGTACAGGTA GGGATTTACCTGACCATCGCTAGCTGCCCGAAAAAATCCGAAATCAGTAA ACGCGTCACCAAGGCTATTGCTGACGTTCCCGGCACCGCGGCAGTGGAGG TCAGTCTGGACGTGATGAGCGACGAGCAGCGCACCAAGTTGCGCAAAAAG TTACGCGGTGATGCCCGTGAACCGATGATCCCGTTCGCTCAACCCAACTC GCTGACCCGAGTGTATACAGTGGCATCCGGCAAGGGAGGAGTCGGAAAGT CCACCGTCACCGTCAACCTAGCCACGGCGATTGCTGCCCGCGGCCTGGCG GTCGGGGTTCTCGACGCCGACATCCACGGCCACTCCATCCCCCGGATGAT GGGTAGCAACCAGCGACCTATACAGCTTGAGTCAATGATTTTACCGCCTA TCGTCCACGAGGTAAAAGTCATCTCGATAGGCCAGTTCACCGAGGGCAAC ACGCCGGTAATATGGCGCGGGCCAATGCTGCACCGGGCATTGCAGCAGTT TCTATCCGACGTGTATTGGGGCGATCTGGACGTGCTGATGCTCGATCTGC CGCCGGGCACCGGCGACATCGCCATCTCGGTAGCTCAGTTAATCCCGAAC GCCGAGATTCTCGTGGTGACCACGCCACAGCTGGCCGCAGCCGAGGTAGC CGAACGAGCCGGCAGCATCGCCCTACAGACCCGCCAACGTATTGTCGGTG TCGTGGAGAACATGTCGGGACTTATGATGCCGGACGGCTCAAGACTACAA GTATTTGGCGAAGGCGGAGGCCAACAAGTCGCCGAGCGGCTCTCACGTGC AGTCGGCACCGACGTGCCGCTGCTGGGTCAGATCCCGCTGGACCCCGCGC TGGTGGCCGCCGGTGATTCGGGTATACCAATCGTGTTGAACGCGTCCGAC TCGCCGGTAGGCAAGGAACTGCTCCGCATCGCCGACGGATTGTCATCGCG GCAGCGCAGACTGGCAGGGGTGTCACTGGGGCTCGACCCGTCGCGGCGC >C2 ATGTCTAGAACTGATCGTAACGCTGCCGACCTGAAATCGGCGGTCAGCAC AGCGCTGGCAAAAGTGATCGACCCCGAACTACAGCGCCCCATCACTGAAC TCGGGATGGTCAAAAACATCGACATCGAGCCGGGTGGCAACGTACAGGTA GGGATTTACCTGACCATCGCTAGCTGCCCGAAAAAATCCGAAATCAGTAA ACGCGTCACCAAGGCTATTGCTGACGTTCCCGGCACCGCGGCAGTGGAGG TCAGTCTGGACGTGATGAGCGACGAGCAGCGCACCAAGTTGCGCAAAAAG TTACGCGGTGATGCCCGTGAACCGATGATCCCGTTCGCTCAACCCAACTC GCTGACCCGAGTGTATACAGTGGCATCCGGCAAGGGAGGAGTCGGAAAGT CCACCGTCACCGTCAACCTAGCCACGGCGATTGCTGCCCGCGGCCTGGCG GTCGGGGTTCTCGACGCCGACATCCACGGCCACTCCATCCCCCGGATGAT GGGTAGCAACCAGCGACCTATACAGCTTGAGTCAATGATTTTACCGCCTA TCGTCCACGAGGTAAAAGTCATCTCGATAGGCCAGTTCACCGAGGGCAAC ACGCCGGTAATATGGCGCGGGCCAATGCTGCACCGGGCATTGCAGCAGTT TCTATCCGACGTGTATTGGGGCGATCTGGACGTGCTGATGCTCGATCTGC CGCCGGGCACCGGCGACATCGCCATCTCGGTAGCTCAGTTAATCCCGAAC GCCGAGATTCTCGTGGTGACCACGCCACAGCTGGCCGCAGCCGAGGTAGC CGAACGAGCCGGCAGCATCGCCCTACAGACCCGCCAACGTATTGTCGGTG TCGTGGAGAACATGTCGGGACTTATGATGCCGGACGGCTCAAGACTACAA GTATTTGGCGAAGGCGGAGGCCAACAAGTCGCCGAGCGGCTCTCACGTGC AGTCGGCACCGACGTGCCGCTGCTGGGTCAGATCCCGCTGGACCCCGCGC TGGTGGCCGCCGGTGATTCGGGTATACCAATCGTGTTGAACGCGTCCGAC TCGCCGGTAGGCAAGGAACTGCTCCGCATCGCCGACGGATTGTCATCGCG GCAGCGCAGACTGGCAGGGGTGTCACTGGGGCTCGACCCGTCGCGGCGC >C3 ATGTCTAGAACTGATCGTAACGCTGCCGACCTGAAATCGGCGGTCAGCAC AGCGCTGGCAAAAGTGATCGACCCCGAACTACAGCGCCCCATCACTGAAC TCGGGATGGTCAAAAACATCGACATCGAGCCGGGTGGCAACGTACAGGTA GGGATTTACCTGACCATCGCTAGCTGCCCGAAAAAATCCGAAATCAGTAA ACGCGTCACCAAGGCTATTGCTGACGTTCCCGGCACCGCGGCAGTGGAGG TCAGTCTGGACGTGATGAGCGACGAGCAGCGCACCAAGTTGCGCAAAAAG TTACGCGGTGATGCCCGTGAACCGATGATCCCGTTCGCTCAACCCAACTC GCTGACCCGAGTGTATACAGTGGCATCCGGCAAGGGAGGAGTCGGAAAGT CCACCGTCACCGTCAACCTAGCCACGGCGATTGCTGCCCGCGGCCTGGCG GTCGGGGTTCTCGACGCCGACATCCACGGCCACTCCATCCCCCGGATGAT GGGTAGCAACCAGCGACCTATACAGCTTGAGTCAATGATTTTACCGCCTA TCGTCCACGAGGTAAAAGTCATCTCGATAGGCCAGTTCACCGAGGGCAAC ACGCCGGTAATATGGCGCGGGCCAATGCTGCACCGGGCATTGCAGCAGTT TCTATCCGACGTGTATTGGGGCGATCTGGACGTGCTGATGCTCGATCTGC CGCCGGGCACCGGCGACATCGCCATCTCGGTAGCTCAGTTAATCCCGAAC GCCGAGATTCTCGTGGTGACCACGCCACAGCTGGCCGCAGCCGAGGTAGC CGAACGAGCCGGCAGCATCGCCCTACAGACCCGCCAACGTATTGTCGGTG TCGTGGAGAACATGTCGGGACTTATGATGCCGGACGGCTCAAGACTACAA GTATTTGGCGAAGGCGGAGGCCAACAAGTCGCCGAGCGGCTCTCACGTGC AGTCGGCACCGACGTGCCGCTGCTGGGTCAGATCCCGCTGGACCCCGCGC TGGTGGCCGCCGGTGATTCGGGTATACCAATCGTGTTGAACGCGTCCGAC TCGCCGGTAGGCAAGGAACTGCTCCGCATCGCCGACGGATTGTCATCGCG GCAGCGCAGACTGGCAGGGGTGTCACTGGGGCTCGACCCGTCGCGGCGC >C4 ATGTCTAGAACTGATCGTAACGCTGCCGACCTGAAATCGGCGGTCAGCAC AGCGCTGGCAAAAGTGATCGACCCCGAACTACAGCGCCCCATCACTGAAC TCGGGATGGTCAAAAACATCGACATCGAGCCGGGTGGCAACGTACAGGTA GGGATTTACCTGACCATCGCTAGCTGCCCGAAAAAATCCGAAATCAGTAA ACGCGTCACCAAGGCTATTGCTGACGTTCCCGGCACCGCGGCAGTGGAGG TCAGTCTGGACGTGATGAGCGACGAGCAGCGCACCAAGTTGCGCAAAAAG TTACGCGGTGATGCCCGTGAACCGATGATCCCGTTCGCTCAACCCAACTC GCTGACCCGAGTGTATACAGTGGCATCCGGCAAGGGAGGAGTCGGAAAGT CCACCGTCACCGTCAACCTAGCCACGGCGATTGCTGCCCGCGGCCTGGCG GTCGGGGTTCTCGACGCCGACATCCACGGCCACTCCATCCCCCGGATGAT GGGTAGCAACCAGCGACCTATACAGCTTGAGTCAATGATTTTACCGCCTA TCGTCCACGAGGTAAAAGTCATCTCGATAGGCCAGTTCACCGAGGGCAAC ACGCCGGTAATATGGCGCGGGCCAATGCTGCACCGGGCATTGCAGCAGTT TCTATCCGACGTGTATTGGGGCGATCTGGACGTGCTGATGCTCGATCTGC CGCCGGGCACCGGCGACATCGCCATCTCGGTAGCTCAGTTAATCCCGAAC GCCGAGATTCTCGTGGTGACCACGCCACAGCTGGCCGCAGCCGAGGTAGC CGAACGAGCCGGCAGCATCGCCCTACAGACCCGCCAACGTATTGTCGGTG TCGTGGAGAACATGTCGGGACTTATGATGCCGGACGGCTCAAGACTACAA GTATTTGGCGAAGGCGGAGGCCAACAAGTCGCCGAGCGGCTCTCACGTGC AGTCGGCACCGACGTGCCGCTGCTGGGTCAGATCCCGCTGGACCCCGCGC TGGTGGCCGCCGGTGATTCGGGTATACCAATCGTGTTGAACGCGTCCGAC TCGCCGGTAGGCAAGGAACTGCTCCGCATCGCCGACGGATTGTCATCGCG GCAGCGCAGACTGGCAGGGGTGTCACTGGGGCTCGACCCGTCGCGGCGC >C5 ATGTCTAGAACTGATCGTAACGCTGCCGACCTGAAATCGGCGGTCAGCAC AGCGCTGGCAAAAGTGATCGACCCCGAACTACAGCGCCCCATCACTGAAC TCGGGATGGTCAAAAACATCGACATCGAGCCGGGTGGCAACGTACAGGTA GGGATTTACCTGACCATCGCTAGCTGCCCGAAAAAATCCGAAATCAGTAA ACGCGTCACCAAGGCTATTGCTGACGTTCCCGGCACCGCGGCAGTGGAGG TCAGTCTGGACGTGATGAGCGACGAGCAGCGCACCAAGTTGCGCAAAAAG TTACGCGGTGATGCCCGTGAACCGATGATCCCGTTCGCTCAACCCAACTC GCTGACCCGAGTGTATACAGTGGCATCCGGCAAGGGAGGAGTCGGAAAGT CCACCGTCACCGTCAACCTAGCCACGGCGATTGCTGCCCGCGGCCTGGCG GTCGGGGTTCTCGACGCCGACATCCACGGCCACTCCATCCCCCGGATGAT GGGTAGCAACCAGCGACCTATACAGCTTGAGTCAATGATTTTACCGCCTA TCGTCCACGAGGTAAAAGTCATCTCGATAGGCCAGTTCACCGAGGGCAAC ACGCCGGTAATATGGCGCGGGCCAATGCTGCACCGGGCATTGCAGCAGTT TCTATCCGACGTGTATTGGGGCGATCTGGACGTGCTGATGCTCGATCTGC CGCCGGGCACCGGCGACATCGCCATCTCGGTAGCTCAGTTAATCCCGAAC GCCGAGATTCTCGTGGTGACCACGCCACAGCTGGCCGCAGCCGAGGTAGC CGAACGAGCCGGCAGCATCGCCCTACAGACCCGCCAACGTATTGTCGGTG TCGTGGAGAACATGTCGGGACTTATGATGCCGGACGGCTCAAGACTACAA GTATTTGGCGAAGGCGGAGGCCAACAAGTCGCCGAGCGGCTCTCACGTGC AGTCGGCACCGACGTGCCGCTGCTGGGTCAGATCCCGCTGGACCCCGCGC TGGTGGCCGCCGGTGATTCGGGTATACCAATCGTGTTGAACGCGTCCGAC TCGCCGGTAGGCAAGGAACTGCTCCGCATCGCCGACGGATTGTCATCGCG GCAGCGCAGACTGGCAGGGGTGTCACTGGGGCTCGACCCGTCGCGGCGC >C6 ATGTCTAGAACTGATCGTAACGCTGCCGACCTGAAATCGGCGGTCAGCAC AGCGCTGGCAAAAGTGATCGACCCCGAACTACAGCGCCCCATCACTGAAC TCGGGATGGTCAAAAACATCGACATCGAGCCGGGTGGCAACGTACAGGTA GGGATTTACCTGACCATCGCTAGCTGCCCGAAAAAATCCGAAATCAGTAA ACGCGTCACCAAGGCTATTGCTGACGTTCCCGGCACCGCGGCAGTGGAGG TCAGTCTGGACGTGATGAGCGACGAGCAGCGCACCAAGTTGCGCAAAAAG TTACGCGGTGATGCCCGTGAACCGATGATCCCGTTCGCTCAACCCAACTC GCTGACCCGAGTGTATACAGTGGCATCCGGCAAGGGAGGAGTCGGAAAGT CCACCGTCACCGTCAACCTAGCCACGGCGATTGCTGCCCGCGGCCTGGCG GTCGGGGTTCTCGACGCCGACATCCACGGCCACTCCATCCCCCGGATGAT GGGTAGCAACCAGCGACCTATACAGCTTGAGTCAATGATTTTACCGCCTA TCGTCCACGAGGTAAAAGTCATCTCGATAGGCCAGTTCACCGAGGGCAAC ACGCCGGTAATATGGCGCGGGCCAATGCTGCACCGGGCATTGCAGCAGTT TCTATCCGACGTGTATTGGGGCGATCTGGACGTGCTGATGCTCGATCTGC CGCCGGGCACCGGCGACATCGCCATCTCGGTAGCTCAGTTAATCCCGAAC GCCGAGATTCTCGTGGTGACCACGCCACAGCTGGCCGCAGCCGAGGTAGC CGAACGAGCCGGCAGCATCGCCCTACAGACCCGCCAACGTATTGTCGGTG TCGTGGAGAACATGTCGGGACTTATGATGCCGGACGGCTCAAGACTACAA GTATTTGGCGAAGGCGGAGGCCAACAAGTCGCCGAGCGGCTCTCACGTGC AGTCGGCACCGACGTGCCGCTGCTGGGTCAGATCCCGCTGGACCCCGCGC TGGTGGCCGCCGGTGATTCGGGTATACCAATCGTGTTGAACGCGTCCGAC TCGCCGGTAGGCAAGGAACTGCTCCGCATCGCCGACGGATTGTCATCGCG GCAGCGCAGACTGGCAGGGGTGTCACTGGGGCTCGACCCGTCGCGGCGC >C1 MSRTDRNAADLKSAVSTALAKVIDPELQRPITELGMVKNIDIEPGGNVQV GIYLTIASCPKKSEISKRVTKAIADVPGTAAVEVSLDVMSDEQRTKLRKK LRGDAREPMIPFAQPNSLTRVYTVASGKGGVGKSTVTVNLATAIAARGLA VGVLDADIHGHSIPRMMGSNQRPIQLESMILPPIVHEVKVISIGQFTEGN TPVIWRGPMLHRALQQFLSDVYWGDLDVLMLDLPPGTGDIAISVAQLIPN AEILVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLMMPDGSRLQ VFGEGGGQQVAERLSRAVGTDVPLLGQIPLDPALVAAGDSGIPIVLNASD SPVGKELLRIADGLSSRQRRLAGVSLGLDPSRR >C2 MSRTDRNAADLKSAVSTALAKVIDPELQRPITELGMVKNIDIEPGGNVQV GIYLTIASCPKKSEISKRVTKAIADVPGTAAVEVSLDVMSDEQRTKLRKK LRGDAREPMIPFAQPNSLTRVYTVASGKGGVGKSTVTVNLATAIAARGLA VGVLDADIHGHSIPRMMGSNQRPIQLESMILPPIVHEVKVISIGQFTEGN TPVIWRGPMLHRALQQFLSDVYWGDLDVLMLDLPPGTGDIAISVAQLIPN AEILVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLMMPDGSRLQ VFGEGGGQQVAERLSRAVGTDVPLLGQIPLDPALVAAGDSGIPIVLNASD SPVGKELLRIADGLSSRQRRLAGVSLGLDPSRR >C3 MSRTDRNAADLKSAVSTALAKVIDPELQRPITELGMVKNIDIEPGGNVQV GIYLTIASCPKKSEISKRVTKAIADVPGTAAVEVSLDVMSDEQRTKLRKK LRGDAREPMIPFAQPNSLTRVYTVASGKGGVGKSTVTVNLATAIAARGLA VGVLDADIHGHSIPRMMGSNQRPIQLESMILPPIVHEVKVISIGQFTEGN TPVIWRGPMLHRALQQFLSDVYWGDLDVLMLDLPPGTGDIAISVAQLIPN AEILVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLMMPDGSRLQ VFGEGGGQQVAERLSRAVGTDVPLLGQIPLDPALVAAGDSGIPIVLNASD SPVGKELLRIADGLSSRQRRLAGVSLGLDPSRR >C4 MSRTDRNAADLKSAVSTALAKVIDPELQRPITELGMVKNIDIEPGGNVQV GIYLTIASCPKKSEISKRVTKAIADVPGTAAVEVSLDVMSDEQRTKLRKK LRGDAREPMIPFAQPNSLTRVYTVASGKGGVGKSTVTVNLATAIAARGLA VGVLDADIHGHSIPRMMGSNQRPIQLESMILPPIVHEVKVISIGQFTEGN TPVIWRGPMLHRALQQFLSDVYWGDLDVLMLDLPPGTGDIAISVAQLIPN AEILVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLMMPDGSRLQ VFGEGGGQQVAERLSRAVGTDVPLLGQIPLDPALVAAGDSGIPIVLNASD SPVGKELLRIADGLSSRQRRLAGVSLGLDPSRR >C5 MSRTDRNAADLKSAVSTALAKVIDPELQRPITELGMVKNIDIEPGGNVQV GIYLTIASCPKKSEISKRVTKAIADVPGTAAVEVSLDVMSDEQRTKLRKK LRGDAREPMIPFAQPNSLTRVYTVASGKGGVGKSTVTVNLATAIAARGLA VGVLDADIHGHSIPRMMGSNQRPIQLESMILPPIVHEVKVISIGQFTEGN TPVIWRGPMLHRALQQFLSDVYWGDLDVLMLDLPPGTGDIAISVAQLIPN AEILVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLMMPDGSRLQ VFGEGGGQQVAERLSRAVGTDVPLLGQIPLDPALVAAGDSGIPIVLNASD SPVGKELLRIADGLSSRQRRLAGVSLGLDPSRR >C6 MSRTDRNAADLKSAVSTALAKVIDPELQRPITELGMVKNIDIEPGGNVQV GIYLTIASCPKKSEISKRVTKAIADVPGTAAVEVSLDVMSDEQRTKLRKK LRGDAREPMIPFAQPNSLTRVYTVASGKGGVGKSTVTVNLATAIAARGLA VGVLDADIHGHSIPRMMGSNQRPIQLESMILPPIVHEVKVISIGQFTEGN TPVIWRGPMLHRALQQFLSDVYWGDLDVLMLDLPPGTGDIAISVAQLIPN AEILVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLMMPDGSRLQ VFGEGGGQQVAERLSRAVGTDVPLLGQIPLDPALVAAGDSGIPIVLNASD SPVGKELLRIADGLSSRQRRLAGVSLGLDPSRR MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/10res/mrp/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1149 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579783366 Setting output file names to "/data/10res/mrp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1053040703 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 9722631453 Seed = 1298528544 Swapseed = 1579783366 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2571.517089 -- -24.965149 Chain 2 -- -2571.517089 -- -24.965149 Chain 3 -- -2571.516942 -- -24.965149 Chain 4 -- -2571.516697 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2571.517089 -- -24.965149 Chain 2 -- -2571.517089 -- -24.965149 Chain 3 -- -2571.516942 -- -24.965149 Chain 4 -- -2571.517089 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2571.517] (-2571.517) (-2571.517) (-2571.517) * [-2571.517] (-2571.517) (-2571.517) (-2571.517) 500 -- (-1579.933) [-1588.965] (-1577.502) (-1579.853) * (-1601.905) [-1586.037] (-1583.880) (-1576.665) -- 0:00:00 1000 -- (-1572.841) [-1578.422] (-1579.546) (-1572.811) * [-1581.626] (-1583.028) (-1571.464) (-1576.396) -- 0:00:00 1500 -- (-1567.564) (-1577.403) [-1574.566] (-1574.102) * [-1577.249] (-1577.615) (-1574.041) (-1575.899) -- 0:00:00 2000 -- (-1571.525) (-1582.453) (-1575.223) [-1576.318] * (-1580.659) [-1573.081] (-1577.799) (-1585.845) -- 0:08:19 2500 -- (-1580.044) (-1579.920) (-1578.477) [-1575.879] * (-1574.554) (-1576.618) (-1574.398) [-1570.658] -- 0:06:39 3000 -- (-1573.805) (-1578.584) [-1577.198] (-1574.501) * (-1576.768) (-1574.627) [-1578.078] (-1577.368) -- 0:05:32 3500 -- (-1578.735) (-1575.134) [-1580.660] (-1580.114) * (-1572.169) (-1572.953) [-1573.982] (-1573.143) -- 0:04:44 4000 -- (-1576.586) [-1573.330] (-1582.233) (-1586.137) * (-1579.878) (-1572.480) [-1572.307] (-1576.565) -- 0:04:09 4500 -- (-1569.925) (-1583.357) [-1573.639] (-1574.120) * (-1573.067) (-1572.640) (-1575.008) [-1578.012] -- 0:03:41 5000 -- (-1574.680) (-1578.494) (-1575.924) [-1576.205] * (-1576.591) (-1570.606) [-1569.949] (-1576.404) -- 0:03:19 Average standard deviation of split frequencies: 0.111304 5500 -- (-1583.044) (-1572.447) [-1574.653] (-1576.302) * (-1583.004) (-1575.773) [-1574.542] (-1583.011) -- 0:03:00 6000 -- [-1572.672] (-1581.755) (-1576.430) (-1573.428) * (-1574.351) (-1573.951) [-1573.294] (-1570.638) -- 0:02:45 6500 -- (-1585.107) (-1576.354) (-1578.919) [-1577.908] * (-1575.796) [-1572.534] (-1578.261) (-1576.744) -- 0:02:32 7000 -- (-1568.654) (-1578.720) [-1573.382] (-1571.239) * [-1574.521] (-1577.164) (-1584.690) (-1574.196) -- 0:02:21 7500 -- (-1566.571) (-1575.594) [-1576.973] (-1574.808) * [-1587.788] (-1573.362) (-1571.091) (-1573.071) -- 0:02:12 8000 -- (-1568.795) (-1576.745) [-1575.881] (-1574.461) * (-1580.102) (-1573.551) (-1577.638) [-1578.041] -- 0:02:04 8500 -- (-1566.501) (-1575.224) (-1575.886) [-1567.674] * (-1578.978) [-1570.604] (-1572.361) (-1580.004) -- 0:01:56 9000 -- (-1567.004) [-1571.354] (-1574.978) (-1570.766) * [-1574.083] (-1575.334) (-1586.998) (-1578.212) -- 0:01:50 9500 -- (-1565.809) [-1577.246] (-1573.320) (-1568.848) * (-1578.232) [-1569.556] (-1573.004) (-1577.508) -- 0:01:44 10000 -- (-1567.248) [-1580.742] (-1585.668) (-1568.301) * [-1576.564] (-1578.948) (-1576.373) (-1577.966) -- 0:01:39 Average standard deviation of split frequencies: 0.052612 10500 -- (-1567.415) (-1576.919) [-1578.601] (-1565.741) * (-1582.985) (-1581.703) (-1574.102) [-1573.070] -- 0:01:34 11000 -- (-1566.571) [-1572.528] (-1576.018) (-1566.113) * [-1579.200] (-1579.169) (-1573.132) (-1576.646) -- 0:01:29 11500 -- [-1566.026] (-1573.335) (-1585.096) (-1566.216) * (-1583.321) (-1579.082) [-1577.350] (-1581.786) -- 0:01:25 12000 -- (-1567.088) (-1570.653) (-1575.077) [-1566.412] * (-1572.319) (-1586.805) (-1577.529) [-1572.410] -- 0:01:22 12500 -- (-1565.447) (-1575.831) [-1576.631] (-1566.081) * (-1573.510) (-1575.860) (-1578.572) [-1573.869] -- 0:01:19 13000 -- (-1566.596) (-1573.809) [-1575.067] (-1571.448) * [-1576.812] (-1575.494) (-1578.327) (-1576.113) -- 0:01:15 13500 -- (-1566.879) [-1573.596] (-1573.230) (-1569.284) * (-1570.260) [-1577.890] (-1578.588) (-1577.915) -- 0:01:13 14000 -- (-1565.674) (-1578.734) (-1582.511) [-1564.881] * [-1569.931] (-1571.369) (-1573.613) (-1582.518) -- 0:01:10 14500 -- (-1565.073) (-1576.199) (-1571.799) [-1565.545] * (-1569.624) [-1576.473] (-1577.817) (-1590.248) -- 0:01:07 15000 -- (-1565.116) (-1582.757) [-1569.338] (-1566.443) * (-1572.203) (-1587.386) (-1575.477) [-1567.210] -- 0:01:05 Average standard deviation of split frequencies: 0.054274 15500 -- (-1567.120) (-1581.050) [-1573.979] (-1567.085) * (-1572.745) [-1580.923] (-1571.814) (-1569.783) -- 0:01:03 16000 -- (-1567.105) (-1581.142) (-1578.217) [-1566.882] * [-1568.818] (-1574.249) (-1584.318) (-1569.346) -- 0:01:01 16500 -- (-1567.073) (-1581.408) [-1572.716] (-1566.563) * (-1570.460) [-1575.744] (-1574.792) (-1570.326) -- 0:00:59 17000 -- (-1567.202) [-1576.348] (-1575.919) (-1566.676) * [-1567.850] (-1577.330) (-1571.068) (-1569.613) -- 0:01:55 17500 -- (-1566.919) (-1580.928) (-1578.568) [-1566.831] * (-1566.653) (-1574.071) [-1569.991] (-1568.145) -- 0:01:52 18000 -- (-1574.285) [-1575.951] (-1579.138) (-1565.678) * [-1566.532] (-1567.758) (-1573.667) (-1565.630) -- 0:01:49 18500 -- (-1568.561) (-1576.235) [-1575.748] (-1565.686) * [-1567.043] (-1566.194) (-1579.398) (-1567.210) -- 0:01:46 19000 -- (-1566.286) (-1579.849) [-1578.003] (-1565.612) * (-1567.336) (-1567.622) (-1574.596) [-1566.772] -- 0:01:43 19500 -- (-1566.813) (-1583.712) [-1576.399] (-1566.783) * (-1566.416) [-1566.128] (-1569.517) (-1569.294) -- 0:01:40 20000 -- (-1566.872) (-1577.577) [-1571.097] (-1566.232) * (-1568.187) (-1565.769) [-1575.848] (-1567.055) -- 0:01:38 Average standard deviation of split frequencies: 0.048021 20500 -- [-1566.298] (-1584.540) (-1576.254) (-1567.724) * [-1567.785] (-1566.142) (-1572.916) (-1566.038) -- 0:01:35 21000 -- [-1565.164] (-1579.384) (-1577.903) (-1567.750) * [-1568.081] (-1566.620) (-1578.125) (-1565.901) -- 0:01:33 21500 -- (-1567.178) (-1576.159) (-1578.555) [-1568.268] * (-1567.046) (-1566.092) [-1577.791] (-1567.219) -- 0:01:31 22000 -- (-1565.844) (-1573.097) [-1572.981] (-1569.688) * (-1567.593) [-1566.178] (-1577.154) (-1564.929) -- 0:01:28 22500 -- [-1565.808] (-1576.301) (-1571.954) (-1567.466) * [-1565.228] (-1569.238) (-1581.833) (-1564.931) -- 0:01:26 23000 -- (-1566.038) [-1580.852] (-1576.745) (-1567.228) * (-1565.720) (-1568.575) (-1576.730) [-1566.481] -- 0:01:24 23500 -- (-1565.987) (-1579.650) [-1579.990] (-1567.619) * (-1567.928) [-1566.808] (-1571.248) (-1570.296) -- 0:01:23 24000 -- [-1566.706] (-1575.695) (-1574.456) (-1566.076) * (-1565.882) [-1568.121] (-1579.833) (-1567.460) -- 0:01:21 24500 -- (-1567.027) [-1572.840] (-1577.010) (-1566.030) * [-1566.578] (-1565.418) (-1577.423) (-1566.584) -- 0:01:19 25000 -- (-1567.097) [-1572.236] (-1588.565) (-1567.927) * (-1567.044) (-1565.088) (-1573.531) [-1566.130] -- 0:01:18 Average standard deviation of split frequencies: 0.044421 25500 -- (-1568.635) [-1576.237] (-1579.979) (-1569.934) * (-1565.796) [-1568.964] (-1576.673) (-1566.055) -- 0:01:16 26000 -- (-1569.423) (-1582.829) (-1577.257) [-1569.799] * [-1565.452] (-1569.115) (-1587.226) (-1566.062) -- 0:01:14 26500 -- (-1568.931) [-1573.022] (-1574.116) (-1568.371) * (-1566.136) (-1568.647) (-1572.758) [-1569.670] -- 0:01:13 27000 -- [-1565.332] (-1575.156) (-1582.286) (-1567.838) * [-1566.327] (-1569.028) (-1574.323) (-1569.306) -- 0:01:12 27500 -- (-1566.886) [-1575.688] (-1583.491) (-1569.064) * (-1566.553) (-1568.246) [-1580.618] (-1568.003) -- 0:01:10 28000 -- [-1567.114] (-1575.089) (-1576.035) (-1568.919) * (-1565.568) (-1570.190) [-1577.172] (-1568.173) -- 0:01:09 28500 -- [-1565.501] (-1574.035) (-1579.232) (-1567.816) * (-1565.643) [-1571.965] (-1576.633) (-1567.730) -- 0:01:08 29000 -- (-1568.267) [-1576.110] (-1573.018) (-1566.328) * (-1567.987) (-1568.628) (-1586.673) [-1567.111] -- 0:01:06 29500 -- (-1576.359) (-1579.508) (-1579.717) [-1565.832] * (-1567.059) [-1567.948] (-1598.225) (-1566.954) -- 0:01:05 30000 -- (-1566.790) (-1572.690) (-1572.499) [-1564.805] * (-1565.362) [-1572.131] (-1572.507) (-1567.013) -- 0:01:04 Average standard deviation of split frequencies: 0.041923 30500 -- (-1566.491) [-1573.269] (-1580.908) (-1564.931) * (-1564.620) (-1568.202) (-1575.890) [-1566.562] -- 0:01:03 31000 -- (-1568.705) [-1571.402] (-1581.945) (-1564.818) * [-1564.657] (-1569.605) (-1571.014) (-1566.156) -- 0:01:02 31500 -- [-1570.572] (-1574.491) (-1578.356) (-1569.266) * [-1564.659] (-1570.795) (-1580.866) (-1568.086) -- 0:01:01 32000 -- [-1566.540] (-1576.590) (-1574.764) (-1569.274) * (-1567.210) (-1567.983) (-1576.330) [-1567.397] -- 0:01:00 32500 -- (-1566.702) (-1579.078) [-1570.172] (-1566.390) * (-1568.786) (-1569.435) (-1579.820) [-1565.815] -- 0:01:29 33000 -- (-1567.094) (-1574.219) [-1572.841] (-1566.515) * (-1569.744) (-1569.394) [-1579.308] (-1566.596) -- 0:01:27 33500 -- (-1566.588) (-1571.317) (-1580.674) [-1565.650] * (-1565.757) (-1567.526) (-1576.448) [-1568.928] -- 0:01:26 34000 -- (-1567.998) (-1580.689) (-1578.876) [-1565.385] * (-1565.475) (-1566.449) [-1572.509] (-1568.001) -- 0:01:25 34500 -- (-1567.244) [-1582.144] (-1578.737) (-1565.336) * (-1565.223) (-1566.881) [-1572.060] (-1565.836) -- 0:01:23 35000 -- [-1565.543] (-1579.166) (-1577.964) (-1567.571) * (-1565.171) [-1567.307] (-1584.727) (-1570.661) -- 0:01:22 Average standard deviation of split frequencies: 0.044641 35500 -- (-1565.571) (-1576.853) [-1568.238] (-1566.785) * [-1565.317] (-1568.195) (-1577.401) (-1568.363) -- 0:01:21 36000 -- (-1568.116) [-1573.136] (-1574.603) (-1567.328) * (-1564.673) (-1567.457) (-1567.985) [-1569.433] -- 0:01:20 36500 -- (-1565.575) [-1572.565] (-1574.923) (-1569.932) * (-1565.552) [-1567.598] (-1565.026) (-1569.416) -- 0:01:19 37000 -- (-1566.542) (-1572.847) (-1573.414) [-1568.537] * (-1564.702) (-1573.153) [-1564.861] (-1569.354) -- 0:01:18 37500 -- (-1567.121) (-1585.637) (-1565.936) [-1565.868] * (-1565.949) (-1572.249) [-1565.902] (-1567.297) -- 0:01:17 38000 -- (-1569.339) (-1579.692) (-1569.637) [-1567.922] * (-1565.721) (-1568.381) (-1565.963) [-1572.172] -- 0:01:15 38500 -- (-1565.933) (-1578.866) (-1567.409) [-1565.417] * (-1567.459) [-1568.073] (-1568.332) (-1566.787) -- 0:01:14 39000 -- (-1570.181) [-1573.451] (-1566.295) (-1568.096) * (-1565.733) [-1565.165] (-1566.065) (-1565.813) -- 0:01:13 39500 -- (-1566.155) [-1580.534] (-1567.506) (-1568.843) * (-1566.810) [-1566.386] (-1567.991) (-1566.854) -- 0:01:12 40000 -- (-1566.304) (-1581.998) (-1566.138) [-1570.127] * [-1566.740] (-1567.228) (-1568.576) (-1566.859) -- 0:01:12 Average standard deviation of split frequencies: 0.045816 40500 -- (-1570.728) (-1574.383) (-1567.251) [-1565.392] * (-1566.135) (-1568.112) (-1565.554) [-1566.698] -- 0:01:11 41000 -- (-1573.811) [-1578.189] (-1567.468) (-1566.205) * [-1566.834] (-1569.060) (-1567.406) (-1568.889) -- 0:01:10 41500 -- (-1568.992) [-1580.595] (-1567.084) (-1565.697) * [-1567.488] (-1567.609) (-1569.252) (-1574.007) -- 0:01:09 42000 -- (-1569.733) (-1581.372) (-1566.911) [-1567.211] * [-1569.424] (-1566.953) (-1567.969) (-1567.007) -- 0:01:08 42500 -- [-1567.434] (-1578.982) (-1565.004) (-1567.756) * (-1564.814) (-1569.426) [-1567.001] (-1565.501) -- 0:01:07 43000 -- (-1566.834) (-1581.201) [-1565.064] (-1569.695) * [-1564.814] (-1571.241) (-1566.881) (-1567.145) -- 0:01:06 43500 -- (-1565.635) (-1579.922) [-1566.099] (-1569.060) * [-1566.244] (-1567.567) (-1564.803) (-1566.037) -- 0:01:05 44000 -- (-1567.059) (-1579.602) [-1566.660] (-1567.470) * (-1568.692) (-1567.414) (-1564.818) [-1565.874] -- 0:01:05 44500 -- (-1566.493) (-1580.377) [-1567.361] (-1569.668) * [-1569.685] (-1567.682) (-1569.442) (-1566.927) -- 0:01:04 45000 -- (-1568.706) [-1571.886] (-1568.393) (-1572.204) * (-1566.185) [-1567.428] (-1567.116) (-1566.861) -- 0:01:03 Average standard deviation of split frequencies: 0.049532 45500 -- (-1568.569) [-1571.560] (-1565.797) (-1568.492) * (-1569.332) (-1573.539) [-1566.291] (-1567.071) -- 0:01:02 46000 -- (-1569.848) (-1578.946) [-1565.825] (-1566.306) * (-1565.074) (-1569.383) (-1565.250) [-1568.186] -- 0:01:02 46500 -- (-1567.724) [-1567.247] (-1566.241) (-1569.214) * (-1566.260) [-1567.616] (-1570.408) (-1566.765) -- 0:01:01 47000 -- (-1570.587) (-1565.925) (-1566.235) [-1566.314] * (-1568.903) (-1571.339) [-1567.454] (-1565.002) -- 0:01:00 47500 -- (-1574.425) (-1565.250) [-1567.096] (-1568.188) * (-1567.265) [-1572.217] (-1565.342) (-1564.992) -- 0:01:00 48000 -- (-1567.786) (-1565.313) (-1566.907) [-1567.305] * (-1565.475) (-1567.372) (-1565.097) [-1567.369] -- 0:00:59 48500 -- (-1568.704) (-1568.496) (-1566.501) [-1567.571] * (-1566.885) [-1567.211] (-1564.934) (-1564.687) -- 0:01:18 49000 -- (-1570.705) (-1568.656) (-1566.258) [-1568.109] * [-1569.162] (-1566.011) (-1564.916) (-1566.400) -- 0:01:17 49500 -- (-1565.831) (-1568.526) (-1566.774) [-1567.298] * (-1566.538) [-1566.011] (-1564.835) (-1565.949) -- 0:01:16 50000 -- (-1566.238) (-1568.776) (-1567.337) [-1571.959] * (-1565.877) (-1566.016) (-1564.812) [-1565.689] -- 0:01:16 Average standard deviation of split frequencies: 0.045711 50500 -- (-1566.897) (-1568.794) [-1565.756] (-1567.407) * (-1566.662) (-1568.596) [-1564.812] (-1565.143) -- 0:01:15 51000 -- [-1568.025] (-1570.620) (-1566.261) (-1566.612) * (-1567.340) [-1566.222] (-1564.812) (-1565.158) -- 0:01:14 51500 -- (-1568.863) (-1569.963) (-1565.539) [-1567.645] * (-1568.971) [-1566.117] (-1564.764) (-1566.093) -- 0:01:13 52000 -- (-1569.685) (-1568.874) [-1565.412] (-1567.420) * (-1565.690) (-1565.961) (-1566.103) [-1566.123] -- 0:01:12 52500 -- (-1572.432) (-1567.871) (-1567.813) [-1567.242] * (-1566.092) (-1564.931) [-1565.710] (-1566.913) -- 0:01:12 53000 -- (-1571.117) (-1566.902) (-1566.004) [-1565.412] * (-1567.112) [-1566.349] (-1565.537) (-1569.049) -- 0:01:11 53500 -- [-1569.949] (-1566.415) (-1564.991) (-1566.105) * (-1566.931) (-1570.016) [-1565.986] (-1567.732) -- 0:01:10 54000 -- (-1566.149) [-1568.060] (-1568.806) (-1566.105) * (-1567.264) [-1566.594] (-1564.895) (-1568.880) -- 0:01:10 54500 -- (-1570.760) (-1565.459) (-1571.378) [-1567.658] * (-1566.506) (-1566.591) (-1565.748) [-1568.905] -- 0:01:09 55000 -- (-1570.941) (-1566.054) [-1565.769] (-1565.481) * (-1565.591) [-1564.809] (-1564.956) (-1572.618) -- 0:01:08 Average standard deviation of split frequencies: 0.043862 55500 -- (-1566.279) [-1565.033] (-1565.588) (-1565.474) * [-1565.591] (-1564.829) (-1565.372) (-1568.558) -- 0:01:08 56000 -- (-1564.753) (-1566.815) (-1565.893) [-1566.448] * [-1565.978] (-1565.313) (-1570.248) (-1566.607) -- 0:01:07 56500 -- (-1567.268) (-1570.801) [-1565.738] (-1566.226) * (-1565.978) (-1568.031) (-1569.904) [-1566.852] -- 0:01:06 57000 -- [-1565.794] (-1569.701) (-1566.088) (-1567.536) * [-1566.752] (-1565.632) (-1568.612) (-1567.410) -- 0:01:06 57500 -- (-1564.770) (-1571.565) [-1565.893] (-1570.657) * (-1566.457) [-1567.269] (-1568.627) (-1567.470) -- 0:01:05 58000 -- (-1564.636) (-1569.818) [-1567.506] (-1568.839) * [-1565.116] (-1564.939) (-1567.619) (-1567.037) -- 0:01:04 58500 -- (-1564.981) (-1567.509) [-1570.559] (-1567.638) * (-1567.407) [-1565.119] (-1569.217) (-1570.501) -- 0:01:04 59000 -- [-1565.992] (-1567.926) (-1568.917) (-1567.166) * (-1566.681) (-1567.401) (-1566.758) [-1571.965] -- 0:01:03 59500 -- [-1566.046] (-1573.892) (-1566.128) (-1566.576) * (-1565.566) [-1567.585] (-1567.669) (-1569.301) -- 0:01:03 60000 -- (-1565.980) [-1567.519] (-1566.601) (-1566.913) * (-1565.118) [-1565.027] (-1568.055) (-1567.163) -- 0:01:02 Average standard deviation of split frequencies: 0.038852 60500 -- (-1568.016) (-1571.017) (-1572.354) [-1566.165] * (-1564.963) (-1565.130) [-1567.885] (-1569.057) -- 0:01:02 61000 -- (-1565.686) (-1566.224) (-1565.464) [-1571.097] * (-1564.932) [-1565.130] (-1566.976) (-1566.138) -- 0:01:01 61500 -- [-1564.678] (-1568.505) (-1567.337) (-1568.283) * (-1566.079) (-1565.063) (-1571.765) [-1566.005] -- 0:01:01 62000 -- (-1567.709) (-1567.161) [-1565.640] (-1569.814) * (-1565.553) (-1565.976) (-1570.781) [-1567.051] -- 0:01:00 62500 -- (-1565.172) (-1570.056) [-1565.520] (-1566.527) * [-1565.533] (-1567.787) (-1569.057) (-1566.267) -- 0:01:00 63000 -- [-1567.925] (-1566.375) (-1565.192) (-1568.104) * (-1566.186) (-1567.519) (-1567.955) [-1566.667] -- 0:00:59 63500 -- [-1568.880] (-1568.830) (-1565.461) (-1565.326) * [-1566.778] (-1567.110) (-1567.955) (-1567.477) -- 0:00:58 64000 -- (-1570.745) [-1569.146] (-1566.348) (-1565.322) * (-1565.651) [-1569.723] (-1566.943) (-1567.586) -- 0:01:13 64500 -- (-1569.489) [-1568.610] (-1569.744) (-1565.131) * (-1566.453) (-1566.591) [-1567.874] (-1567.047) -- 0:01:12 65000 -- (-1570.442) (-1568.363) [-1568.001] (-1565.036) * (-1566.468) (-1568.513) (-1568.105) [-1567.688] -- 0:01:11 Average standard deviation of split frequencies: 0.030713 65500 -- (-1574.830) (-1567.164) (-1567.415) [-1564.995] * [-1567.272] (-1569.322) (-1568.772) (-1565.399) -- 0:01:11 66000 -- [-1575.654] (-1568.270) (-1567.493) (-1564.910) * (-1567.605) (-1568.630) (-1567.526) [-1565.419] -- 0:01:10 66500 -- (-1565.885) [-1568.904] (-1566.887) (-1574.519) * (-1568.311) (-1567.548) [-1565.536] (-1569.247) -- 0:01:10 67000 -- (-1567.104) (-1567.124) [-1567.135] (-1566.838) * (-1566.666) (-1572.638) (-1565.935) [-1569.859] -- 0:01:09 67500 -- [-1565.074] (-1566.517) (-1566.226) (-1571.891) * [-1565.982] (-1568.305) (-1567.181) (-1567.183) -- 0:01:09 68000 -- (-1567.212) (-1570.524) [-1568.009] (-1566.469) * (-1565.947) [-1567.437] (-1567.181) (-1565.457) -- 0:01:08 68500 -- (-1566.676) (-1572.412) (-1569.040) [-1567.299] * (-1569.210) (-1566.046) [-1567.617] (-1566.122) -- 0:01:07 69000 -- (-1568.097) (-1569.161) [-1568.088] (-1567.214) * [-1566.353] (-1564.622) (-1566.955) (-1568.121) -- 0:01:07 69500 -- (-1569.391) (-1568.026) [-1566.735] (-1568.107) * [-1567.827] (-1564.751) (-1567.573) (-1565.616) -- 0:01:06 70000 -- (-1566.136) (-1566.500) [-1566.397] (-1566.708) * (-1569.082) [-1566.668] (-1565.559) (-1566.039) -- 0:01:06 Average standard deviation of split frequencies: 0.029843 70500 -- (-1567.159) (-1566.686) [-1566.934] (-1567.485) * (-1568.556) (-1570.154) [-1565.793] (-1568.210) -- 0:01:05 71000 -- (-1566.555) (-1567.496) [-1567.104] (-1566.547) * [-1567.361] (-1573.068) (-1567.474) (-1566.635) -- 0:01:05 71500 -- [-1567.692] (-1566.284) (-1566.269) (-1565.399) * (-1567.291) (-1569.074) [-1567.841] (-1565.063) -- 0:01:04 72000 -- (-1565.594) [-1566.709] (-1565.599) (-1566.483) * [-1569.228] (-1570.498) (-1566.026) (-1564.953) -- 0:01:04 72500 -- (-1565.812) [-1566.590] (-1568.105) (-1567.671) * (-1570.074) [-1566.723] (-1567.036) (-1568.115) -- 0:01:03 73000 -- (-1566.921) [-1577.300] (-1570.883) (-1570.339) * (-1569.384) (-1567.685) [-1566.998] (-1565.866) -- 0:01:03 73500 -- (-1566.668) (-1567.599) (-1572.348) [-1568.697] * (-1568.981) (-1565.911) (-1567.047) [-1565.871] -- 0:01:03 74000 -- (-1567.223) [-1569.436] (-1571.214) (-1568.584) * (-1572.614) (-1566.111) (-1566.553) [-1566.456] -- 0:01:02 74500 -- [-1565.997] (-1570.388) (-1567.436) (-1570.505) * (-1567.275) [-1565.706] (-1570.402) (-1566.104) -- 0:01:02 75000 -- (-1565.173) [-1565.817] (-1569.633) (-1581.183) * (-1569.641) (-1565.363) (-1565.693) [-1566.348] -- 0:01:01 Average standard deviation of split frequencies: 0.032047 75500 -- [-1566.282] (-1568.605) (-1568.357) (-1576.053) * (-1565.630) (-1565.298) [-1566.245] (-1571.052) -- 0:01:01 76000 -- (-1570.610) [-1567.626] (-1567.011) (-1574.880) * (-1568.579) [-1565.317] (-1567.460) (-1566.291) -- 0:01:00 76500 -- (-1566.722) (-1566.645) (-1569.595) [-1566.964] * (-1565.600) (-1564.735) (-1565.450) [-1566.083] -- 0:01:00 77000 -- (-1567.213) (-1566.693) (-1568.742) [-1564.918] * (-1566.035) (-1565.626) (-1565.282) [-1566.059] -- 0:00:59 77500 -- (-1568.821) (-1566.653) (-1569.679) [-1564.965] * (-1565.300) (-1566.743) (-1566.455) [-1566.594] -- 0:00:59 78000 -- (-1566.865) (-1567.099) (-1566.841) [-1565.340] * [-1565.526] (-1565.475) (-1567.401) (-1566.537) -- 0:00:59 78500 -- [-1566.281] (-1566.667) (-1570.948) (-1566.021) * (-1565.552) (-1565.484) [-1565.948] (-1565.692) -- 0:00:58 79000 -- (-1568.772) (-1566.789) (-1573.789) [-1566.206] * (-1564.867) [-1565.179] (-1567.883) (-1567.366) -- 0:00:58 79500 -- (-1567.341) [-1566.031] (-1567.295) (-1566.715) * (-1567.070) (-1565.775) (-1568.277) [-1565.242] -- 0:00:57 80000 -- (-1569.424) (-1567.156) [-1568.039] (-1568.564) * (-1568.164) (-1565.235) [-1569.575] (-1570.676) -- 0:01:09 Average standard deviation of split frequencies: 0.032141 80500 -- (-1567.938) [-1564.612] (-1568.436) (-1565.953) * [-1568.296] (-1567.178) (-1572.573) (-1567.758) -- 0:01:08 81000 -- (-1566.243) (-1566.797) [-1568.319] (-1565.681) * (-1567.180) (-1566.106) [-1565.235] (-1567.004) -- 0:01:08 81500 -- (-1569.063) (-1568.170) (-1566.013) [-1565.612] * (-1569.079) (-1567.208) (-1565.519) [-1567.304] -- 0:01:07 82000 -- [-1568.733] (-1568.599) (-1570.276) (-1567.545) * [-1566.503] (-1567.206) (-1568.294) (-1566.434) -- 0:01:07 82500 -- (-1570.641) (-1566.152) (-1567.268) [-1566.165] * (-1567.792) (-1569.781) (-1566.503) [-1566.003] -- 0:01:06 83000 -- (-1569.647) (-1569.999) [-1567.379] (-1569.005) * (-1566.391) [-1568.016] (-1569.455) (-1566.232) -- 0:01:06 83500 -- (-1569.523) (-1569.135) (-1566.710) [-1566.352] * (-1567.992) (-1566.777) (-1565.502) [-1567.403] -- 0:01:05 84000 -- (-1572.308) [-1564.609] (-1570.339) (-1568.069) * [-1565.901] (-1565.858) (-1565.205) (-1568.071) -- 0:01:05 84500 -- [-1569.996] (-1565.551) (-1569.079) (-1569.313) * (-1566.919) (-1565.858) (-1568.072) [-1569.451] -- 0:01:05 85000 -- (-1570.981) [-1567.452] (-1567.852) (-1566.874) * [-1567.675] (-1565.180) (-1569.039) (-1567.281) -- 0:01:04 Average standard deviation of split frequencies: 0.029427 85500 -- (-1568.368) (-1564.965) [-1566.882] (-1567.097) * (-1567.806) [-1565.638] (-1567.655) (-1565.314) -- 0:01:04 86000 -- (-1570.967) [-1565.220] (-1566.601) (-1566.151) * (-1568.181) (-1566.518) (-1565.949) [-1566.588] -- 0:01:03 86500 -- (-1567.016) (-1570.247) (-1565.211) [-1569.083] * (-1566.273) (-1566.961) (-1565.031) [-1566.045] -- 0:01:03 87000 -- [-1567.870] (-1567.863) (-1564.838) (-1570.975) * (-1567.180) (-1567.056) (-1564.972) [-1568.769] -- 0:01:02 87500 -- (-1567.383) (-1568.310) (-1565.358) [-1568.369] * (-1566.848) [-1565.467] (-1565.642) (-1568.232) -- 0:01:02 88000 -- (-1567.291) (-1567.696) [-1565.731] (-1569.858) * (-1565.945) (-1566.981) [-1565.226] (-1572.820) -- 0:01:02 88500 -- (-1567.135) (-1567.023) (-1564.924) [-1568.741] * (-1566.806) (-1565.868) (-1566.132) [-1566.223] -- 0:01:01 89000 -- (-1567.473) [-1565.596] (-1565.599) (-1566.466) * (-1566.439) (-1567.381) (-1568.127) [-1565.341] -- 0:01:01 89500 -- [-1566.924] (-1566.030) (-1566.558) (-1568.458) * (-1566.412) (-1567.256) [-1565.503] (-1565.203) -- 0:01:01 90000 -- [-1567.303] (-1566.848) (-1564.953) (-1566.599) * [-1566.799] (-1570.622) (-1565.929) (-1565.976) -- 0:01:00 Average standard deviation of split frequencies: 0.029828 90500 -- (-1566.284) [-1565.653] (-1564.953) (-1566.596) * (-1570.091) (-1566.875) (-1565.364) [-1564.645] -- 0:01:00 91000 -- (-1567.319) (-1568.036) [-1564.953] (-1567.092) * (-1571.027) (-1566.247) [-1567.262] (-1564.530) -- 0:00:59 91500 -- (-1566.896) [-1565.903] (-1564.771) (-1567.464) * (-1569.846) [-1566.099] (-1567.677) (-1564.789) -- 0:00:59 92000 -- (-1568.530) (-1566.007) [-1564.899] (-1568.323) * (-1568.815) (-1566.548) (-1566.629) [-1564.814] -- 0:00:59 92500 -- (-1566.676) (-1567.911) [-1566.262] (-1569.460) * [-1566.725] (-1566.925) (-1570.881) (-1567.306) -- 0:00:58 93000 -- [-1569.571] (-1567.917) (-1564.920) (-1567.400) * (-1566.153) (-1569.477) (-1568.012) [-1568.860] -- 0:00:58 93500 -- (-1566.942) (-1568.168) (-1566.802) [-1566.787] * (-1566.550) (-1566.572) (-1566.202) [-1568.215] -- 0:00:58 94000 -- [-1566.947] (-1567.385) (-1572.086) (-1568.614) * (-1565.537) (-1566.483) [-1566.127] (-1567.325) -- 0:00:57 94500 -- (-1567.074) [-1566.632] (-1565.877) (-1576.662) * (-1565.431) (-1566.484) [-1564.810] (-1569.376) -- 0:00:57 95000 -- (-1566.536) [-1566.365] (-1566.301) (-1570.631) * [-1567.273] (-1567.138) (-1565.961) (-1566.239) -- 0:00:57 Average standard deviation of split frequencies: 0.031100 95500 -- [-1566.191] (-1566.678) (-1566.153) (-1568.583) * [-1568.257] (-1567.244) (-1566.451) (-1566.041) -- 0:00:56 96000 -- (-1565.682) (-1567.013) [-1565.407] (-1576.837) * (-1567.738) (-1565.918) (-1566.813) [-1569.663] -- 0:01:05 96500 -- [-1566.047] (-1565.699) (-1567.904) (-1568.949) * (-1568.737) [-1569.757] (-1565.186) (-1565.964) -- 0:01:05 97000 -- (-1566.672) (-1566.055) [-1566.401] (-1568.151) * (-1570.052) (-1567.187) (-1566.134) [-1565.037] -- 0:01:05 97500 -- (-1568.209) [-1567.232] (-1567.072) (-1565.987) * (-1565.603) [-1565.562] (-1566.134) (-1567.422) -- 0:01:04 98000 -- (-1568.410) (-1566.781) [-1567.743] (-1565.775) * (-1566.729) [-1566.736] (-1567.206) (-1567.422) -- 0:01:04 98500 -- [-1566.457] (-1566.143) (-1573.215) (-1566.118) * (-1565.725) (-1566.162) (-1565.800) [-1566.466] -- 0:01:04 99000 -- [-1567.505] (-1565.740) (-1565.807) (-1567.225) * (-1566.904) (-1564.598) (-1565.086) [-1567.291] -- 0:01:03 99500 -- (-1567.586) [-1566.931] (-1565.938) (-1565.933) * (-1565.630) (-1565.004) (-1565.067) [-1566.787] -- 0:01:03 100000 -- [-1568.947] (-1568.205) (-1566.608) (-1565.814) * [-1565.802] (-1567.467) (-1566.385) (-1565.561) -- 0:01:02 Average standard deviation of split frequencies: 0.029138 100500 -- (-1566.586) (-1574.737) (-1566.121) [-1565.988] * [-1567.006] (-1567.209) (-1567.289) (-1565.280) -- 0:01:02 101000 -- (-1567.084) [-1571.590] (-1565.830) (-1565.561) * (-1566.973) (-1567.512) (-1565.371) [-1566.306] -- 0:01:02 101500 -- (-1568.192) [-1566.771] (-1566.084) (-1565.242) * (-1571.552) (-1568.520) [-1566.296] (-1568.144) -- 0:01:01 102000 -- (-1566.027) (-1566.944) (-1569.148) [-1567.288] * (-1566.683) (-1569.217) (-1567.450) [-1567.507] -- 0:01:01 102500 -- [-1565.436] (-1565.393) (-1569.748) (-1565.808) * [-1566.744] (-1567.255) (-1571.031) (-1567.978) -- 0:01:01 103000 -- [-1565.325] (-1567.617) (-1568.152) (-1566.855) * (-1565.111) [-1567.935] (-1569.056) (-1565.472) -- 0:01:00 103500 -- (-1566.247) (-1568.452) (-1569.614) [-1565.700] * (-1567.719) (-1566.842) (-1566.933) [-1569.306] -- 0:01:00 104000 -- (-1569.008) [-1568.652] (-1568.685) (-1567.003) * [-1566.462] (-1569.677) (-1568.990) (-1568.631) -- 0:01:00 104500 -- (-1565.428) (-1569.809) [-1568.620] (-1567.527) * (-1566.318) (-1568.382) (-1566.805) [-1566.342] -- 0:00:59 105000 -- (-1566.035) (-1572.784) [-1566.068] (-1565.681) * (-1567.844) (-1574.768) (-1567.443) [-1566.355] -- 0:00:59 Average standard deviation of split frequencies: 0.024237 105500 -- [-1566.403] (-1569.004) (-1565.882) (-1565.966) * (-1565.942) [-1566.096] (-1568.997) (-1567.779) -- 0:00:59 106000 -- [-1568.157] (-1569.123) (-1565.926) (-1568.947) * [-1565.768] (-1565.178) (-1569.018) (-1567.920) -- 0:00:59 106500 -- [-1566.445] (-1567.046) (-1568.543) (-1566.654) * (-1565.669) (-1565.428) (-1571.347) [-1572.715] -- 0:00:58 107000 -- (-1565.682) (-1567.681) (-1568.740) [-1566.652] * (-1565.811) [-1565.566] (-1570.210) (-1571.307) -- 0:00:58 107500 -- [-1567.793] (-1566.804) (-1566.644) (-1565.963) * (-1566.661) [-1565.406] (-1570.340) (-1566.668) -- 0:00:58 108000 -- (-1567.840) (-1565.655) (-1567.737) [-1566.796] * (-1567.148) (-1565.420) (-1566.590) [-1566.446] -- 0:00:57 108500 -- (-1567.841) (-1572.734) [-1567.736] (-1567.012) * (-1565.403) [-1565.506] (-1566.860) (-1566.662) -- 0:00:57 109000 -- (-1566.401) [-1566.645] (-1568.876) (-1565.811) * (-1566.160) (-1567.148) [-1565.454] (-1565.749) -- 0:00:57 109500 -- [-1566.411] (-1565.829) (-1567.910) (-1568.082) * (-1565.618) [-1569.360] (-1567.475) (-1565.068) -- 0:00:56 110000 -- (-1566.645) (-1566.108) (-1567.811) [-1569.905] * [-1568.523] (-1566.053) (-1568.828) (-1565.157) -- 0:00:56 Average standard deviation of split frequencies: 0.026059 110500 -- [-1565.850] (-1565.422) (-1568.853) (-1568.122) * [-1565.008] (-1567.114) (-1567.652) (-1565.391) -- 0:00:56 111000 -- (-1565.097) (-1570.464) (-1568.048) [-1566.952] * (-1567.018) [-1566.630] (-1570.272) (-1565.528) -- 0:00:56 111500 -- (-1566.418) (-1568.399) (-1567.402) [-1566.258] * (-1567.197) [-1568.515] (-1567.164) (-1565.270) -- 0:01:03 112000 -- (-1567.043) [-1571.240] (-1568.247) (-1568.723) * [-1565.917] (-1569.700) (-1568.894) (-1568.662) -- 0:01:03 112500 -- [-1568.124] (-1568.150) (-1567.162) (-1568.501) * (-1566.424) [-1566.956] (-1567.228) (-1567.076) -- 0:01:03 113000 -- (-1567.977) (-1568.042) (-1569.898) [-1569.086] * (-1568.666) [-1567.553] (-1571.676) (-1564.951) -- 0:01:02 113500 -- (-1567.742) (-1565.811) (-1566.396) [-1568.642] * (-1569.501) [-1568.561] (-1567.833) (-1565.186) -- 0:01:02 114000 -- (-1571.260) (-1565.664) [-1568.428] (-1570.577) * (-1567.775) [-1566.323] (-1566.564) (-1568.521) -- 0:01:02 114500 -- [-1566.985] (-1566.000) (-1569.586) (-1567.147) * (-1567.832) [-1566.545] (-1567.133) (-1568.599) -- 0:01:01 115000 -- (-1566.877) (-1567.937) (-1567.134) [-1566.876] * (-1567.976) [-1566.239] (-1565.041) (-1569.562) -- 0:01:01 Average standard deviation of split frequencies: 0.024891 115500 -- (-1567.056) (-1567.331) (-1566.838) [-1567.208] * (-1568.833) [-1565.264] (-1566.038) (-1566.257) -- 0:01:01 116000 -- (-1568.496) (-1566.214) [-1566.742] (-1567.986) * (-1570.512) (-1565.406) (-1566.661) [-1565.319] -- 0:01:00 116500 -- (-1567.897) [-1566.700] (-1567.850) (-1567.878) * (-1566.829) [-1565.247] (-1565.708) (-1565.662) -- 0:01:00 117000 -- (-1574.822) (-1566.813) (-1568.260) [-1567.399] * (-1568.859) (-1565.778) (-1569.335) [-1564.890] -- 0:01:00 117500 -- [-1566.587] (-1567.232) (-1568.325) (-1566.562) * (-1567.227) [-1565.111] (-1566.013) (-1568.589) -- 0:01:00 118000 -- (-1566.514) (-1565.373) (-1568.525) [-1566.604] * [-1568.182] (-1566.283) (-1565.086) (-1566.716) -- 0:00:59 118500 -- (-1569.170) (-1569.582) (-1565.795) [-1567.069] * (-1570.145) [-1567.410] (-1566.660) (-1571.574) -- 0:00:59 119000 -- [-1566.876] (-1568.237) (-1567.792) (-1566.791) * (-1567.832) (-1567.166) [-1567.827] (-1568.514) -- 0:00:59 119500 -- (-1567.535) [-1567.205] (-1569.189) (-1567.268) * (-1569.244) (-1566.542) (-1570.575) [-1567.219] -- 0:00:58 120000 -- (-1565.951) (-1566.889) [-1569.454] (-1571.480) * (-1571.409) (-1566.705) (-1569.107) [-1566.701] -- 0:00:58 Average standard deviation of split frequencies: 0.020266 120500 -- (-1567.405) [-1566.767] (-1567.183) (-1572.842) * (-1571.565) (-1569.057) (-1565.243) [-1566.404] -- 0:00:58 121000 -- (-1566.429) (-1566.202) [-1567.322] (-1567.187) * (-1570.989) (-1566.707) (-1566.425) [-1565.508] -- 0:00:58 121500 -- [-1567.576] (-1564.882) (-1568.986) (-1567.101) * (-1568.830) [-1568.873] (-1567.751) (-1574.564) -- 0:00:57 122000 -- (-1567.996) [-1565.988] (-1568.172) (-1567.434) * [-1568.657] (-1565.529) (-1567.033) (-1567.805) -- 0:00:57 122500 -- (-1567.930) [-1566.115] (-1568.664) (-1567.457) * (-1567.080) [-1565.006] (-1571.067) (-1568.432) -- 0:00:57 123000 -- (-1568.467) (-1566.642) (-1569.208) [-1566.069] * (-1569.875) (-1566.140) [-1570.077] (-1571.437) -- 0:00:57 123500 -- (-1569.036) (-1570.723) [-1569.508] (-1566.715) * (-1568.508) (-1569.460) (-1568.273) [-1571.174] -- 0:00:56 124000 -- (-1566.554) (-1566.511) [-1570.899] (-1565.431) * (-1567.508) (-1568.221) (-1566.592) [-1565.767] -- 0:00:56 124500 -- (-1569.349) (-1567.177) (-1569.488) [-1568.894] * [-1567.937] (-1569.232) (-1569.123) (-1569.390) -- 0:00:56 125000 -- (-1568.452) [-1567.449] (-1570.361) (-1567.089) * (-1568.475) [-1568.010] (-1566.072) (-1566.359) -- 0:00:56 Average standard deviation of split frequencies: 0.019746 125500 -- (-1570.513) (-1567.975) (-1568.934) [-1566.812] * (-1573.463) (-1571.632) (-1566.943) [-1567.112] -- 0:00:55 126000 -- (-1567.153) (-1570.542) [-1568.755] (-1567.415) * (-1571.746) [-1568.973] (-1566.419) (-1569.683) -- 0:00:55 126500 -- (-1569.035) [-1565.362] (-1569.330) (-1569.095) * [-1568.102] (-1567.915) (-1568.510) (-1568.533) -- 0:00:55 127000 -- (-1566.056) (-1566.465) (-1567.563) [-1567.655] * (-1567.625) (-1569.551) [-1566.505] (-1568.060) -- 0:00:54 127500 -- (-1567.998) (-1565.965) [-1567.280] (-1567.959) * [-1569.533] (-1569.478) (-1567.378) (-1568.859) -- 0:01:01 128000 -- (-1566.210) (-1567.008) (-1567.388) [-1569.291] * (-1565.701) (-1569.517) (-1566.023) [-1567.947] -- 0:01:01 128500 -- (-1566.210) [-1565.148] (-1567.731) (-1566.250) * (-1565.477) [-1567.137] (-1565.944) (-1566.890) -- 0:01:01 129000 -- (-1569.681) (-1566.323) (-1566.922) [-1567.224] * (-1568.237) (-1568.104) [-1565.389] (-1571.967) -- 0:01:00 129500 -- (-1566.008) (-1565.358) [-1566.220] (-1566.221) * (-1568.303) [-1570.241] (-1565.692) (-1576.337) -- 0:01:00 130000 -- (-1565.929) [-1566.020] (-1566.042) (-1565.971) * (-1568.977) (-1566.832) (-1565.616) [-1567.237] -- 0:01:00 Average standard deviation of split frequencies: 0.017437 130500 -- [-1565.704] (-1570.487) (-1568.778) (-1567.912) * (-1571.244) (-1566.667) (-1565.213) [-1568.217] -- 0:00:59 131000 -- [-1567.513] (-1567.570) (-1566.909) (-1567.813) * [-1570.289] (-1566.225) (-1567.003) (-1568.810) -- 0:00:59 131500 -- (-1567.514) [-1569.463] (-1566.129) (-1570.441) * (-1571.398) [-1566.092] (-1568.007) (-1570.219) -- 0:00:59 132000 -- (-1567.279) (-1565.762) (-1568.611) [-1567.304] * (-1570.163) (-1566.051) (-1567.477) [-1567.433] -- 0:00:59 132500 -- (-1568.476) (-1570.183) [-1568.827] (-1566.755) * [-1567.266] (-1568.055) (-1568.909) (-1568.831) -- 0:00:58 133000 -- (-1567.782) (-1567.426) (-1567.258) [-1565.567] * (-1566.449) (-1566.037) [-1567.460] (-1570.087) -- 0:00:58 133500 -- (-1567.032) (-1566.419) (-1565.034) [-1565.901] * (-1565.705) [-1576.283] (-1568.470) (-1566.690) -- 0:00:58 134000 -- (-1570.096) (-1567.200) (-1565.014) [-1565.911] * (-1566.058) (-1569.002) (-1567.532) [-1565.346] -- 0:00:58 134500 -- [-1568.102] (-1568.452) (-1566.072) (-1566.897) * (-1567.400) (-1568.876) [-1567.527] (-1569.305) -- 0:00:57 135000 -- (-1566.088) [-1567.572] (-1566.063) (-1567.911) * (-1566.064) (-1564.962) (-1566.750) [-1569.146] -- 0:00:57 Average standard deviation of split frequencies: 0.017535 135500 -- [-1567.218] (-1567.058) (-1566.132) (-1567.134) * (-1567.854) (-1565.278) (-1564.930) [-1567.213] -- 0:00:57 136000 -- [-1566.026] (-1567.475) (-1566.723) (-1567.259) * (-1567.823) (-1565.558) (-1566.546) [-1565.282] -- 0:00:57 136500 -- (-1566.933) (-1566.569) [-1566.274] (-1567.599) * (-1570.220) [-1566.124] (-1569.520) (-1567.361) -- 0:00:56 137000 -- (-1566.378) [-1565.285] (-1566.740) (-1566.461) * (-1571.001) [-1565.884] (-1567.316) (-1567.860) -- 0:00:56 137500 -- [-1570.864] (-1568.355) (-1565.974) (-1565.928) * [-1566.154] (-1567.122) (-1566.493) (-1567.497) -- 0:00:56 138000 -- (-1569.942) (-1572.718) [-1565.918] (-1565.762) * (-1566.827) (-1567.447) (-1567.335) [-1568.827] -- 0:00:56 138500 -- (-1567.778) (-1568.507) (-1569.151) [-1566.765] * [-1567.158] (-1569.687) (-1567.148) (-1566.162) -- 0:00:55 139000 -- (-1569.389) (-1568.313) (-1567.441) [-1567.428] * (-1565.990) (-1568.146) (-1566.379) [-1565.724] -- 0:00:55 139500 -- [-1567.702] (-1566.503) (-1567.994) (-1567.292) * (-1567.544) (-1566.241) [-1565.881] (-1565.636) -- 0:00:55 140000 -- (-1568.642) (-1568.618) [-1565.173] (-1566.825) * (-1567.118) (-1565.965) [-1565.845] (-1567.296) -- 0:00:55 Average standard deviation of split frequencies: 0.017501 140500 -- (-1569.719) (-1570.616) (-1565.677) [-1567.257] * (-1565.330) [-1565.302] (-1569.245) (-1567.210) -- 0:00:55 141000 -- (-1572.801) [-1566.642] (-1565.044) (-1567.252) * (-1566.560) (-1566.531) [-1567.851] (-1565.356) -- 0:00:54 141500 -- (-1576.261) (-1565.240) (-1569.413) [-1565.416] * (-1566.271) [-1565.241] (-1565.295) (-1565.811) -- 0:00:54 142000 -- (-1569.928) [-1565.792] (-1569.273) (-1566.183) * (-1564.746) (-1567.819) [-1565.705] (-1569.495) -- 0:00:54 142500 -- (-1571.327) [-1565.576] (-1566.643) (-1565.038) * (-1565.720) (-1566.072) [-1565.598] (-1565.724) -- 0:00:54 143000 -- (-1572.258) [-1564.780] (-1565.908) (-1565.027) * (-1565.037) (-1566.629) [-1565.535] (-1565.342) -- 0:00:59 143500 -- (-1571.968) (-1565.829) [-1567.604] (-1565.037) * [-1564.907] (-1566.367) (-1566.008) (-1565.342) -- 0:00:59 144000 -- (-1568.766) (-1567.112) [-1566.020] (-1567.858) * (-1565.170) (-1566.367) (-1565.336) [-1572.552] -- 0:00:59 144500 -- (-1568.474) [-1567.291] (-1565.099) (-1569.393) * (-1565.170) [-1566.520] (-1566.738) (-1566.313) -- 0:00:59 145000 -- (-1566.885) [-1570.260] (-1566.488) (-1569.048) * (-1565.901) (-1566.810) (-1567.130) [-1564.844] -- 0:00:58 Average standard deviation of split frequencies: 0.019193 145500 -- (-1568.043) (-1567.004) [-1568.231] (-1568.005) * (-1565.893) (-1565.466) [-1566.617] (-1565.668) -- 0:00:58 146000 -- (-1566.069) (-1567.828) [-1569.028] (-1568.858) * (-1565.143) [-1565.442] (-1565.807) (-1566.809) -- 0:00:58 146500 -- (-1569.172) [-1564.872] (-1566.182) (-1571.278) * (-1565.159) (-1567.702) [-1566.825] (-1568.918) -- 0:00:58 147000 -- (-1567.643) [-1565.034] (-1565.356) (-1566.256) * (-1565.151) (-1567.299) (-1566.389) [-1566.158] -- 0:00:58 147500 -- [-1565.224] (-1564.735) (-1566.172) (-1566.891) * [-1565.623] (-1566.460) (-1566.477) (-1566.433) -- 0:00:57 148000 -- (-1566.439) (-1566.943) [-1567.622] (-1565.921) * (-1567.748) [-1568.938] (-1568.585) (-1566.918) -- 0:00:57 148500 -- (-1564.988) (-1567.078) [-1567.027] (-1565.962) * (-1567.788) (-1568.428) [-1565.522] (-1567.010) -- 0:00:57 149000 -- (-1569.691) (-1568.693) (-1567.021) [-1565.316] * (-1567.368) [-1568.083] (-1566.039) (-1567.656) -- 0:00:57 149500 -- (-1565.967) (-1568.818) (-1570.854) [-1565.296] * [-1565.917] (-1569.070) (-1567.106) (-1566.122) -- 0:00:56 150000 -- [-1566.147] (-1569.805) (-1566.811) (-1565.442) * (-1565.338) (-1573.067) (-1567.090) [-1567.097] -- 0:00:56 Average standard deviation of split frequencies: 0.019120 150500 -- (-1567.499) (-1568.269) [-1566.159] (-1565.011) * (-1566.967) [-1569.048] (-1567.188) (-1567.852) -- 0:00:56 151000 -- (-1570.808) [-1565.923] (-1567.142) (-1565.011) * [-1565.821] (-1571.361) (-1569.587) (-1567.886) -- 0:00:56 151500 -- (-1572.096) (-1565.596) [-1568.624] (-1565.550) * (-1567.139) [-1567.458] (-1570.211) (-1565.927) -- 0:00:56 152000 -- (-1567.954) [-1565.562] (-1568.084) (-1566.532) * (-1569.722) [-1569.089] (-1574.873) (-1566.471) -- 0:00:55 152500 -- (-1564.996) (-1566.850) (-1568.523) [-1565.259] * [-1569.039] (-1570.117) (-1574.244) (-1566.174) -- 0:00:55 153000 -- [-1565.644] (-1568.107) (-1566.939) (-1565.177) * [-1566.865] (-1570.774) (-1567.872) (-1565.215) -- 0:00:55 153500 -- [-1568.237] (-1567.340) (-1566.570) (-1566.553) * [-1565.688] (-1570.981) (-1568.122) (-1565.357) -- 0:00:55 154000 -- [-1569.409] (-1569.938) (-1566.834) (-1566.976) * (-1568.538) [-1569.619] (-1564.554) (-1565.212) -- 0:00:54 154500 -- (-1567.528) [-1570.776] (-1566.831) (-1566.488) * [-1567.101] (-1567.900) (-1565.051) (-1567.660) -- 0:00:54 155000 -- (-1568.258) (-1566.801) [-1570.064] (-1566.637) * (-1566.097) (-1567.337) [-1566.061] (-1567.703) -- 0:00:54 Average standard deviation of split frequencies: 0.020481 155500 -- [-1567.285] (-1568.027) (-1565.637) (-1566.990) * [-1565.489] (-1567.058) (-1568.593) (-1567.694) -- 0:00:54 156000 -- (-1569.867) [-1569.137] (-1566.487) (-1565.702) * (-1565.628) (-1566.341) [-1566.559] (-1570.124) -- 0:00:54 156500 -- (-1567.027) (-1565.265) [-1566.919] (-1567.806) * (-1569.691) [-1565.190] (-1568.094) (-1566.412) -- 0:00:53 157000 -- (-1567.561) [-1565.342] (-1565.792) (-1568.699) * (-1568.453) (-1565.191) (-1566.962) [-1566.977] -- 0:00:53 157500 -- (-1567.373) (-1567.093) [-1566.147] (-1570.131) * (-1570.702) (-1568.483) (-1566.427) [-1569.435] -- 0:00:53 158000 -- [-1570.736] (-1566.818) (-1566.792) (-1568.294) * (-1565.820) (-1567.472) [-1568.173] (-1570.268) -- 0:00:53 158500 -- (-1568.487) (-1567.006) (-1567.193) [-1568.319] * (-1567.147) (-1568.117) [-1567.590] (-1567.735) -- 0:00:53 159000 -- (-1565.790) [-1566.215] (-1567.337) (-1570.188) * (-1568.597) [-1565.932] (-1568.115) (-1567.800) -- 0:00:58 159500 -- (-1566.966) [-1566.124] (-1566.166) (-1570.188) * (-1565.128) [-1566.058] (-1567.252) (-1565.804) -- 0:00:57 160000 -- (-1568.516) (-1568.911) [-1570.315] (-1567.097) * (-1566.941) (-1567.414) (-1568.474) [-1567.518] -- 0:00:57 Average standard deviation of split frequencies: 0.018985 160500 -- (-1566.510) (-1567.711) (-1569.294) [-1566.632] * (-1565.983) (-1565.955) [-1566.559] (-1570.700) -- 0:00:57 161000 -- (-1567.792) (-1566.918) (-1569.643) [-1566.440] * (-1567.233) (-1565.753) (-1566.566) [-1569.581] -- 0:00:57 161500 -- [-1568.814] (-1567.259) (-1568.625) (-1566.411) * (-1565.567) (-1567.222) [-1566.031] (-1569.314) -- 0:00:57 162000 -- (-1568.765) [-1566.355] (-1567.338) (-1567.553) * (-1565.573) (-1567.176) (-1565.478) [-1568.929] -- 0:00:56 162500 -- [-1570.630] (-1567.750) (-1568.554) (-1567.284) * (-1565.281) (-1567.224) (-1564.879) [-1570.055] -- 0:00:56 163000 -- (-1565.924) [-1567.526] (-1568.351) (-1566.671) * (-1565.179) (-1565.423) [-1564.685] (-1571.909) -- 0:00:56 163500 -- (-1572.068) (-1567.936) (-1572.324) [-1565.239] * (-1569.676) (-1565.281) (-1566.179) [-1567.234] -- 0:00:56 164000 -- [-1568.760] (-1566.464) (-1572.491) (-1567.553) * (-1568.542) (-1566.171) [-1565.251] (-1566.047) -- 0:00:56 164500 -- [-1567.816] (-1565.592) (-1570.207) (-1567.345) * [-1566.682] (-1566.222) (-1565.251) (-1572.038) -- 0:00:55 165000 -- (-1566.801) [-1567.873] (-1569.193) (-1566.717) * [-1568.194] (-1570.764) (-1566.746) (-1565.669) -- 0:00:55 Average standard deviation of split frequencies: 0.018774 165500 -- (-1566.006) [-1566.842] (-1568.332) (-1565.131) * [-1567.278] (-1567.973) (-1565.775) (-1566.651) -- 0:00:55 166000 -- (-1565.825) (-1566.697) [-1566.523] (-1565.894) * (-1565.559) (-1568.060) [-1565.556] (-1566.970) -- 0:00:55 166500 -- [-1567.149] (-1569.817) (-1570.137) (-1565.253) * (-1565.922) [-1568.684] (-1566.208) (-1567.428) -- 0:00:55 167000 -- (-1565.581) (-1569.119) [-1570.950] (-1569.371) * (-1567.336) [-1569.198] (-1568.221) (-1567.353) -- 0:00:54 167500 -- [-1565.050] (-1567.867) (-1566.428) (-1571.240) * (-1566.477) (-1568.544) [-1565.850] (-1566.902) -- 0:00:54 168000 -- [-1565.602] (-1566.331) (-1565.247) (-1569.319) * (-1566.477) [-1566.287] (-1566.083) (-1566.625) -- 0:00:54 168500 -- (-1565.438) [-1567.323] (-1565.247) (-1565.527) * (-1567.133) (-1566.523) (-1566.006) [-1566.722] -- 0:00:54 169000 -- [-1568.660] (-1567.653) (-1567.484) (-1566.228) * (-1569.909) [-1572.899] (-1568.400) (-1567.504) -- 0:00:54 169500 -- [-1569.719] (-1567.876) (-1566.350) (-1567.075) * [-1566.523] (-1577.633) (-1565.260) (-1566.770) -- 0:00:53 170000 -- (-1565.604) [-1570.198] (-1572.698) (-1567.686) * (-1572.812) [-1567.337] (-1569.070) (-1567.509) -- 0:00:53 Average standard deviation of split frequencies: 0.018198 170500 -- [-1565.641] (-1570.440) (-1565.736) (-1567.471) * (-1570.352) (-1566.511) [-1567.534] (-1567.959) -- 0:00:53 171000 -- (-1569.567) [-1565.529] (-1565.333) (-1565.570) * (-1570.341) (-1567.206) [-1570.374] (-1569.448) -- 0:00:53 171500 -- (-1569.830) [-1565.166] (-1568.276) (-1567.644) * (-1568.752) [-1567.318] (-1565.182) (-1569.860) -- 0:00:53 172000 -- (-1569.687) (-1568.278) (-1567.902) [-1569.032] * (-1568.630) (-1569.360) (-1564.869) [-1569.116] -- 0:00:52 172500 -- [-1570.795] (-1566.516) (-1566.055) (-1568.863) * (-1570.244) (-1568.357) [-1564.782] (-1567.925) -- 0:00:52 173000 -- (-1567.834) (-1566.867) (-1566.300) [-1566.056] * (-1568.077) [-1567.084] (-1565.044) (-1570.406) -- 0:00:52 173500 -- (-1566.445) [-1565.450] (-1566.733) (-1567.193) * (-1566.513) [-1570.049] (-1565.135) (-1567.111) -- 0:00:52 174000 -- [-1566.642] (-1565.268) (-1567.824) (-1567.566) * (-1565.350) (-1571.557) (-1565.018) [-1565.846] -- 0:00:52 174500 -- (-1572.249) (-1567.226) [-1566.687] (-1566.886) * (-1565.618) [-1566.069] (-1566.637) (-1566.483) -- 0:00:52 175000 -- (-1570.767) [-1565.813] (-1567.934) (-1569.469) * (-1566.445) (-1567.169) (-1566.382) [-1570.236] -- 0:00:56 Average standard deviation of split frequencies: 0.017261 175500 -- (-1568.103) [-1565.704] (-1568.285) (-1566.522) * (-1566.446) (-1565.761) (-1567.122) [-1569.530] -- 0:00:56 176000 -- (-1568.081) (-1565.864) [-1567.158] (-1568.333) * (-1568.167) (-1567.466) [-1565.451] (-1568.024) -- 0:00:56 176500 -- (-1572.660) (-1566.711) (-1569.755) [-1566.595] * (-1566.307) (-1567.537) (-1565.451) [-1565.902] -- 0:00:55 177000 -- (-1569.516) [-1566.645] (-1569.372) (-1569.559) * (-1566.930) (-1566.525) (-1566.686) [-1566.373] -- 0:00:55 177500 -- (-1568.406) (-1570.385) (-1574.553) [-1567.709] * (-1567.027) [-1565.119] (-1566.133) (-1566.535) -- 0:00:55 178000 -- (-1567.761) (-1567.239) [-1569.609] (-1568.275) * (-1566.874) [-1565.559] (-1566.133) (-1570.220) -- 0:00:55 178500 -- (-1567.504) [-1566.560] (-1566.032) (-1568.615) * (-1568.280) (-1567.623) [-1565.355] (-1571.228) -- 0:00:55 179000 -- (-1566.104) (-1565.162) [-1565.354] (-1568.206) * (-1565.325) (-1566.236) (-1566.048) [-1568.214] -- 0:00:55 179500 -- (-1564.769) (-1565.708) [-1567.660] (-1569.121) * (-1565.228) [-1566.558] (-1567.093) (-1566.587) -- 0:00:54 180000 -- [-1566.799] (-1569.883) (-1566.265) (-1567.402) * [-1564.836] (-1565.734) (-1566.486) (-1565.579) -- 0:00:54 Average standard deviation of split frequencies: 0.016090 180500 -- (-1566.780) (-1568.562) (-1568.556) [-1565.939] * (-1565.612) [-1568.018] (-1565.859) (-1568.121) -- 0:00:54 181000 -- (-1566.823) (-1567.376) (-1571.005) [-1565.701] * (-1567.493) (-1565.874) [-1566.702] (-1568.016) -- 0:00:54 181500 -- (-1566.823) [-1570.214] (-1565.720) (-1565.855) * [-1566.435] (-1567.177) (-1565.015) (-1567.488) -- 0:00:54 182000 -- (-1567.080) [-1566.433] (-1566.589) (-1568.343) * (-1565.462) (-1567.159) (-1565.477) [-1565.858] -- 0:00:53 182500 -- [-1567.250] (-1567.417) (-1568.486) (-1566.530) * (-1565.796) (-1570.608) [-1565.310] (-1566.633) -- 0:00:53 183000 -- (-1566.682) [-1567.105] (-1572.892) (-1570.162) * [-1565.352] (-1566.320) (-1568.419) (-1565.491) -- 0:00:53 183500 -- (-1566.096) [-1567.026] (-1568.361) (-1567.107) * (-1566.240) (-1565.568) [-1567.563] (-1565.887) -- 0:00:53 184000 -- (-1566.845) (-1569.234) [-1568.677] (-1568.605) * (-1569.623) (-1565.414) (-1566.905) [-1565.695] -- 0:00:53 184500 -- [-1569.447] (-1567.477) (-1568.897) (-1567.935) * (-1565.252) [-1565.585] (-1568.317) (-1568.234) -- 0:00:53 185000 -- (-1567.444) (-1565.478) [-1567.431] (-1569.132) * (-1565.559) (-1566.176) [-1567.773] (-1568.869) -- 0:00:52 Average standard deviation of split frequencies: 0.016615 185500 -- (-1565.941) [-1565.492] (-1567.834) (-1566.186) * [-1565.696] (-1566.554) (-1567.981) (-1569.475) -- 0:00:52 186000 -- (-1566.166) (-1571.870) (-1572.205) [-1565.185] * [-1566.159] (-1565.698) (-1567.656) (-1567.439) -- 0:00:52 186500 -- (-1566.240) (-1567.323) [-1573.295] (-1566.328) * (-1566.918) [-1564.982] (-1568.731) (-1567.826) -- 0:00:52 187000 -- (-1567.378) [-1568.816] (-1567.771) (-1566.992) * (-1566.769) [-1567.738] (-1569.468) (-1565.032) -- 0:00:52 187500 -- (-1565.798) (-1570.144) [-1565.623] (-1566.223) * [-1567.861] (-1565.396) (-1567.642) (-1567.018) -- 0:00:52 188000 -- (-1565.806) [-1567.548] (-1566.006) (-1568.551) * (-1567.477) (-1567.417) [-1572.171] (-1565.644) -- 0:00:51 188500 -- [-1565.743] (-1566.014) (-1565.174) (-1568.880) * (-1567.490) [-1565.225] (-1566.317) (-1566.601) -- 0:00:51 189000 -- [-1568.611] (-1566.067) (-1566.784) (-1570.264) * (-1569.915) (-1568.269) (-1569.213) [-1565.036] -- 0:00:51 189500 -- (-1566.628) [-1566.570] (-1566.454) (-1566.505) * (-1569.472) (-1569.794) (-1567.540) [-1565.502] -- 0:00:51 190000 -- (-1568.816) [-1565.969] (-1566.031) (-1565.211) * [-1567.633] (-1565.464) (-1567.272) (-1566.190) -- 0:00:51 Average standard deviation of split frequencies: 0.015329 190500 -- [-1567.715] (-1567.665) (-1567.202) (-1566.736) * (-1565.467) (-1566.052) [-1564.908] (-1565.489) -- 0:00:50 191000 -- [-1566.679] (-1567.370) (-1569.339) (-1566.259) * [-1565.708] (-1566.700) (-1567.492) (-1566.348) -- 0:00:55 191500 -- (-1567.563) [-1566.933] (-1569.654) (-1567.751) * (-1567.345) (-1565.370) [-1566.341] (-1565.797) -- 0:00:54 192000 -- [-1567.642] (-1566.911) (-1569.480) (-1570.989) * (-1567.741) (-1566.196) (-1566.749) [-1565.830] -- 0:00:54 192500 -- (-1568.443) (-1566.871) (-1566.854) [-1571.625] * (-1565.399) (-1565.562) (-1566.789) [-1569.342] -- 0:00:54 193000 -- (-1567.740) [-1565.460] (-1566.689) (-1567.702) * [-1566.717] (-1566.550) (-1565.360) (-1567.661) -- 0:00:54 193500 -- (-1567.659) [-1566.424] (-1568.127) (-1566.904) * (-1565.266) (-1568.032) [-1566.431] (-1566.279) -- 0:00:54 194000 -- (-1568.138) (-1566.488) (-1570.447) [-1567.922] * (-1567.526) (-1567.060) [-1566.489] (-1565.763) -- 0:00:54 194500 -- (-1569.086) (-1565.386) (-1570.188) [-1566.964] * (-1565.793) (-1569.270) [-1570.695] (-1566.092) -- 0:00:53 195000 -- (-1566.718) (-1567.357) (-1568.483) [-1568.302] * [-1566.217] (-1567.405) (-1567.429) (-1567.605) -- 0:00:53 Average standard deviation of split frequencies: 0.013896 195500 -- (-1567.893) (-1567.253) [-1565.933] (-1566.261) * (-1566.640) (-1567.735) (-1567.870) [-1566.417] -- 0:00:53 196000 -- (-1566.169) [-1564.979] (-1567.921) (-1565.165) * (-1565.630) (-1566.057) (-1567.936) [-1566.417] -- 0:00:53 196500 -- (-1565.046) [-1566.901] (-1569.461) (-1565.460) * (-1567.340) [-1566.543] (-1569.645) (-1566.583) -- 0:00:53 197000 -- [-1566.287] (-1568.182) (-1566.397) (-1568.689) * (-1566.329) (-1567.677) (-1567.260) [-1566.833] -- 0:00:52 197500 -- (-1566.677) (-1568.542) (-1566.397) [-1566.681] * (-1565.564) (-1567.429) (-1569.994) [-1565.437] -- 0:00:52 198000 -- [-1566.635] (-1567.268) (-1566.017) (-1566.668) * [-1565.709] (-1566.784) (-1567.259) (-1565.249) -- 0:00:52 198500 -- (-1566.599) (-1568.013) [-1568.717] (-1567.506) * (-1566.772) (-1570.679) [-1566.329] (-1565.311) -- 0:00:52 199000 -- [-1568.064] (-1568.011) (-1569.591) (-1566.647) * (-1567.165) (-1568.469) (-1568.193) [-1565.341] -- 0:00:52 199500 -- (-1567.861) (-1568.618) [-1567.711] (-1570.121) * (-1568.861) (-1567.472) (-1565.918) [-1566.430] -- 0:00:52 200000 -- (-1567.837) (-1566.335) (-1566.095) [-1565.950] * (-1570.271) [-1566.737] (-1567.194) (-1565.837) -- 0:00:51 Average standard deviation of split frequencies: 0.011615 200500 -- (-1566.952) [-1566.842] (-1569.430) (-1570.441) * (-1565.831) (-1566.927) (-1565.911) [-1566.989] -- 0:00:51 201000 -- (-1572.031) (-1567.195) (-1568.756) [-1567.209] * (-1566.716) [-1567.038] (-1566.365) (-1566.479) -- 0:00:51 201500 -- (-1567.813) (-1568.953) [-1564.906] (-1567.366) * (-1566.272) [-1566.286] (-1568.722) (-1566.401) -- 0:00:51 202000 -- (-1565.572) [-1566.754] (-1565.822) (-1570.133) * (-1566.631) (-1567.294) [-1571.138] (-1568.922) -- 0:00:51 202500 -- [-1566.159] (-1568.953) (-1565.239) (-1569.334) * (-1567.234) (-1568.503) (-1569.071) [-1567.677] -- 0:00:51 203000 -- (-1565.875) (-1565.954) (-1567.215) [-1567.063] * [-1568.670] (-1567.114) (-1567.346) (-1568.095) -- 0:00:51 203500 -- (-1565.981) (-1566.317) (-1570.896) [-1565.695] * (-1565.601) [-1568.470] (-1565.246) (-1566.146) -- 0:00:50 204000 -- (-1566.997) [-1564.815] (-1566.943) (-1568.566) * (-1565.592) (-1572.116) (-1565.788) [-1565.087] -- 0:00:50 204500 -- (-1566.211) [-1565.683] (-1566.124) (-1565.520) * [-1564.725] (-1570.618) (-1565.913) (-1569.265) -- 0:00:50 205000 -- [-1566.690] (-1565.758) (-1566.705) (-1567.628) * (-1564.725) (-1566.822) [-1565.682] (-1567.176) -- 0:00:50 Average standard deviation of split frequencies: 0.012243 205500 -- (-1568.939) (-1567.497) (-1566.492) [-1566.625] * (-1565.957) (-1566.025) [-1565.680] (-1566.134) -- 0:00:50 206000 -- (-1566.763) (-1567.003) [-1566.466] (-1568.473) * (-1573.490) (-1565.610) (-1566.119) [-1565.509] -- 0:00:50 206500 -- (-1567.998) (-1565.547) [-1566.637] (-1568.261) * (-1569.349) [-1565.186] (-1567.483) (-1566.630) -- 0:00:49 207000 -- (-1570.444) (-1567.244) (-1566.254) [-1566.851] * (-1566.870) (-1565.014) [-1571.356] (-1566.452) -- 0:00:53 207500 -- (-1568.101) [-1568.066] (-1565.917) (-1566.817) * (-1567.036) [-1565.600] (-1572.990) (-1566.262) -- 0:00:53 208000 -- [-1565.925] (-1567.790) (-1565.048) (-1565.489) * (-1566.751) (-1567.248) [-1567.670] (-1565.872) -- 0:00:53 208500 -- (-1566.303) [-1569.338] (-1565.206) (-1566.305) * (-1565.796) [-1567.546] (-1565.979) (-1568.268) -- 0:00:53 209000 -- [-1566.274] (-1569.819) (-1565.864) (-1573.037) * (-1565.390) (-1568.202) (-1565.280) [-1568.213] -- 0:00:52 209500 -- (-1567.575) (-1566.133) (-1567.069) [-1567.821] * (-1565.365) (-1567.137) [-1565.139] (-1567.593) -- 0:00:52 210000 -- (-1566.611) (-1566.669) [-1567.882] (-1567.846) * (-1566.132) [-1565.166] (-1567.153) (-1570.445) -- 0:00:52 Average standard deviation of split frequencies: 0.012955 210500 -- [-1565.529] (-1571.885) (-1568.366) (-1565.627) * (-1565.894) (-1567.502) [-1564.886] (-1567.748) -- 0:00:52 211000 -- (-1565.334) (-1568.488) (-1570.008) [-1567.724] * [-1567.101] (-1566.371) (-1565.638) (-1566.835) -- 0:00:52 211500 -- (-1565.956) (-1568.252) (-1566.867) [-1568.757] * [-1567.032] (-1565.059) (-1566.154) (-1567.444) -- 0:00:52 212000 -- (-1568.167) (-1566.427) (-1571.590) [-1565.434] * (-1569.035) (-1566.170) [-1568.882] (-1565.440) -- 0:00:52 212500 -- (-1566.218) (-1566.397) [-1568.297] (-1566.419) * (-1571.478) (-1565.453) [-1568.613] (-1565.566) -- 0:00:51 213000 -- (-1565.987) (-1566.000) (-1567.414) [-1567.365] * [-1566.354] (-1565.137) (-1567.256) (-1565.455) -- 0:00:51 213500 -- (-1565.121) [-1566.118] (-1566.945) (-1567.273) * [-1569.285] (-1565.184) (-1569.417) (-1571.743) -- 0:00:51 214000 -- (-1565.330) [-1568.183] (-1566.946) (-1568.719) * (-1566.480) [-1567.264] (-1569.469) (-1572.631) -- 0:00:51 214500 -- (-1567.307) [-1566.521] (-1567.517) (-1567.777) * (-1565.601) (-1566.814) (-1569.106) [-1570.086] -- 0:00:51 215000 -- [-1571.317] (-1566.386) (-1566.336) (-1566.067) * (-1566.855) (-1571.683) [-1567.643] (-1569.800) -- 0:00:51 Average standard deviation of split frequencies: 0.010912 215500 -- [-1566.243] (-1567.673) (-1567.911) (-1568.172) * (-1567.886) [-1570.005] (-1565.538) (-1569.742) -- 0:00:50 216000 -- [-1565.243] (-1567.379) (-1568.382) (-1567.614) * (-1566.285) [-1568.082] (-1566.474) (-1567.545) -- 0:00:50 216500 -- (-1566.317) (-1567.461) (-1568.067) [-1567.271] * (-1565.613) [-1566.105] (-1568.386) (-1571.884) -- 0:00:50 217000 -- [-1565.904] (-1567.017) (-1569.499) (-1567.857) * (-1565.154) (-1564.922) [-1566.140] (-1571.889) -- 0:00:50 217500 -- [-1566.550] (-1566.356) (-1566.620) (-1571.723) * (-1565.137) (-1567.601) (-1567.408) [-1570.006] -- 0:00:50 218000 -- [-1565.755] (-1564.704) (-1566.616) (-1573.513) * (-1564.915) [-1567.834] (-1567.243) (-1566.642) -- 0:00:50 218500 -- (-1567.139) (-1566.181) (-1566.419) [-1569.354] * (-1565.658) (-1566.698) [-1566.977] (-1567.262) -- 0:00:50 219000 -- (-1565.775) (-1570.926) [-1566.186] (-1565.280) * (-1566.330) (-1565.746) (-1569.610) [-1566.381] -- 0:00:49 219500 -- (-1565.079) [-1567.179] (-1567.068) (-1569.740) * [-1567.407] (-1568.357) (-1567.533) (-1567.025) -- 0:00:49 220000 -- (-1566.070) (-1566.392) (-1566.858) [-1567.080] * (-1565.852) (-1568.193) (-1569.278) [-1568.162] -- 0:00:49 Average standard deviation of split frequencies: 0.009495 220500 -- (-1565.502) (-1569.716) [-1566.457] (-1565.055) * (-1569.018) [-1568.812] (-1568.425) (-1566.742) -- 0:00:49 221000 -- (-1564.789) (-1571.649) [-1568.958] (-1568.305) * (-1565.342) (-1567.873) (-1566.790) [-1565.146] -- 0:00:49 221500 -- [-1564.837] (-1565.404) (-1568.728) (-1566.288) * (-1566.195) (-1569.767) (-1567.299) [-1565.285] -- 0:00:49 222000 -- (-1569.097) [-1565.404] (-1566.444) (-1566.812) * (-1566.602) (-1569.334) (-1567.950) [-1565.082] -- 0:00:49 222500 -- (-1568.331) (-1565.265) [-1566.538] (-1568.812) * (-1567.647) [-1567.315] (-1566.166) (-1569.841) -- 0:00:48 223000 -- (-1569.588) (-1571.173) [-1565.369] (-1566.680) * (-1565.242) [-1565.558] (-1565.435) (-1569.110) -- 0:00:52 223500 -- (-1566.469) [-1571.057] (-1568.344) (-1565.995) * (-1568.488) (-1566.108) (-1565.733) [-1569.130] -- 0:00:52 224000 -- (-1566.146) (-1568.131) (-1566.796) [-1566.195] * (-1565.742) [-1566.231] (-1568.714) (-1569.012) -- 0:00:51 224500 -- [-1569.172] (-1565.331) (-1568.555) (-1566.480) * (-1566.561) [-1566.819] (-1569.348) (-1565.299) -- 0:00:51 225000 -- (-1568.137) [-1566.358] (-1567.494) (-1570.263) * (-1567.263) [-1567.696] (-1566.571) (-1565.966) -- 0:00:51 Average standard deviation of split frequencies: 0.012296 225500 -- [-1567.667] (-1566.204) (-1566.545) (-1565.200) * [-1566.080] (-1569.907) (-1566.417) (-1569.139) -- 0:00:51 226000 -- (-1568.364) (-1567.626) [-1566.904] (-1566.965) * (-1565.000) [-1566.583] (-1565.301) (-1564.999) -- 0:00:51 226500 -- (-1568.109) [-1567.573] (-1567.328) (-1566.219) * (-1569.012) (-1567.263) (-1567.653) [-1565.291] -- 0:00:51 227000 -- (-1567.191) (-1568.441) (-1566.109) [-1567.182] * (-1569.181) [-1565.619] (-1569.066) (-1567.278) -- 0:00:51 227500 -- (-1571.897) (-1565.155) [-1566.840] (-1567.220) * [-1567.541] (-1568.538) (-1569.872) (-1566.858) -- 0:00:50 228000 -- (-1568.155) (-1565.147) [-1566.243] (-1567.761) * (-1566.794) (-1569.278) (-1570.066) [-1566.361] -- 0:00:50 228500 -- (-1570.307) (-1565.650) [-1566.460] (-1567.769) * [-1565.074] (-1565.824) (-1566.571) (-1566.263) -- 0:00:50 229000 -- (-1567.160) [-1566.382] (-1566.408) (-1568.271) * (-1566.916) [-1566.162] (-1565.249) (-1565.251) -- 0:00:50 229500 -- (-1566.613) (-1565.755) (-1565.897) [-1566.525] * (-1567.155) [-1566.421] (-1567.083) (-1566.165) -- 0:00:50 230000 -- [-1566.586] (-1568.552) (-1566.600) (-1566.411) * (-1567.171) [-1572.458] (-1567.420) (-1567.679) -- 0:00:50 Average standard deviation of split frequencies: 0.013768 230500 -- (-1566.586) [-1569.846] (-1567.168) (-1567.104) * (-1568.604) [-1571.548] (-1571.785) (-1568.374) -- 0:00:50 231000 -- (-1568.014) (-1566.134) [-1566.849] (-1566.890) * (-1568.461) (-1568.482) (-1567.079) [-1565.207] -- 0:00:49 231500 -- [-1572.229] (-1565.744) (-1566.799) (-1565.457) * [-1565.899] (-1570.039) (-1566.374) (-1566.320) -- 0:00:49 232000 -- (-1568.200) (-1565.238) [-1565.265] (-1569.090) * (-1566.845) [-1568.497] (-1569.535) (-1568.226) -- 0:00:49 232500 -- (-1568.202) (-1567.917) [-1567.480] (-1567.124) * (-1566.471) (-1568.622) [-1566.866] (-1564.765) -- 0:00:49 233000 -- (-1567.234) (-1568.795) [-1570.557] (-1566.331) * (-1567.217) (-1575.281) [-1566.103] (-1564.926) -- 0:00:49 233500 -- [-1567.786] (-1567.676) (-1568.015) (-1566.132) * [-1565.740] (-1567.508) (-1566.682) (-1565.030) -- 0:00:49 234000 -- (-1567.473) (-1565.903) [-1567.672] (-1566.084) * (-1568.430) (-1568.116) (-1566.892) [-1566.376] -- 0:00:49 234500 -- (-1567.780) (-1565.712) (-1568.120) [-1566.447] * (-1566.906) [-1568.530] (-1567.517) (-1566.386) -- 0:00:48 235000 -- (-1567.985) (-1565.419) [-1566.715] (-1573.444) * (-1566.906) [-1567.859] (-1568.295) (-1565.912) -- 0:00:48 Average standard deviation of split frequencies: 0.015314 235500 -- (-1567.514) [-1566.274] (-1567.005) (-1572.206) * [-1566.166] (-1566.412) (-1567.010) (-1565.891) -- 0:00:48 236000 -- (-1566.662) (-1565.974) [-1566.867] (-1566.710) * [-1566.909] (-1567.170) (-1567.240) (-1566.841) -- 0:00:48 236500 -- [-1565.899] (-1567.493) (-1568.267) (-1565.351) * (-1568.848) [-1566.767] (-1566.671) (-1565.579) -- 0:00:48 237000 -- (-1565.932) (-1566.744) (-1567.211) [-1567.322] * [-1568.104] (-1566.742) (-1567.287) (-1565.183) -- 0:00:48 237500 -- [-1566.503] (-1566.689) (-1566.866) (-1566.932) * (-1568.599) (-1567.262) [-1565.456] (-1567.816) -- 0:00:48 238000 -- (-1566.494) (-1565.527) (-1566.828) [-1567.315] * (-1568.375) [-1565.762] (-1566.670) (-1566.985) -- 0:00:48 238500 -- (-1568.145) (-1565.855) (-1570.517) [-1566.745] * (-1570.183) (-1568.361) (-1566.052) [-1566.269] -- 0:00:47 239000 -- [-1565.360] (-1565.581) (-1565.695) (-1566.113) * (-1567.264) (-1567.998) [-1566.511] (-1566.584) -- 0:00:50 239500 -- (-1565.758) [-1565.582] (-1566.953) (-1567.763) * (-1566.996) [-1567.782] (-1566.823) (-1567.518) -- 0:00:50 240000 -- [-1567.150] (-1571.044) (-1567.114) (-1567.762) * (-1569.658) (-1567.719) [-1566.402] (-1566.398) -- 0:00:50 Average standard deviation of split frequencies: 0.012732 240500 -- (-1568.064) [-1568.664] (-1568.908) (-1566.474) * (-1568.035) [-1567.811] (-1567.836) (-1566.463) -- 0:00:50 241000 -- (-1565.034) [-1565.672] (-1566.345) (-1567.141) * (-1569.559) [-1566.641] (-1565.135) (-1567.621) -- 0:00:50 241500 -- (-1565.594) (-1566.830) (-1574.409) [-1566.341] * (-1570.158) [-1567.036] (-1565.146) (-1567.023) -- 0:00:50 242000 -- (-1565.234) [-1569.172] (-1566.217) (-1567.612) * [-1569.854] (-1567.634) (-1565.891) (-1567.250) -- 0:00:50 242500 -- (-1565.850) (-1570.642) [-1565.139] (-1565.584) * (-1568.194) (-1571.227) (-1565.635) [-1564.832] -- 0:00:49 243000 -- [-1564.678] (-1567.495) (-1568.280) (-1565.720) * (-1566.726) (-1568.102) [-1565.649] (-1567.451) -- 0:00:49 243500 -- (-1565.453) (-1565.741) (-1565.926) [-1564.971] * (-1567.400) [-1568.152] (-1566.091) (-1569.355) -- 0:00:49 244000 -- [-1566.394] (-1564.698) (-1565.412) (-1568.955) * (-1570.047) [-1569.812] (-1565.302) (-1570.450) -- 0:00:49 244500 -- (-1567.696) (-1564.913) (-1565.945) [-1569.861] * [-1566.865] (-1570.809) (-1565.524) (-1566.073) -- 0:00:49 245000 -- (-1567.150) (-1564.887) [-1565.004] (-1568.520) * (-1565.571) (-1566.388) [-1564.981] (-1565.984) -- 0:00:49 Average standard deviation of split frequencies: 0.013520 245500 -- (-1569.642) [-1564.978] (-1565.297) (-1567.591) * (-1569.982) (-1565.440) [-1566.094] (-1566.739) -- 0:00:49 246000 -- (-1567.550) [-1565.061] (-1565.294) (-1572.945) * (-1565.961) [-1568.007] (-1566.183) (-1571.708) -- 0:00:49 246500 -- (-1566.330) [-1565.612] (-1564.980) (-1568.526) * (-1566.766) [-1567.907] (-1565.919) (-1570.023) -- 0:00:48 247000 -- (-1565.722) [-1567.022] (-1564.957) (-1567.834) * (-1567.934) (-1571.813) [-1566.269] (-1566.380) -- 0:00:48 247500 -- (-1569.713) [-1570.323] (-1569.110) (-1571.843) * (-1568.711) (-1574.921) (-1567.168) [-1568.532] -- 0:00:48 248000 -- [-1571.321] (-1566.445) (-1570.168) (-1572.130) * [-1567.379] (-1572.899) (-1568.077) (-1566.555) -- 0:00:48 248500 -- (-1573.286) [-1565.233] (-1567.526) (-1571.514) * (-1565.083) (-1569.881) [-1569.882] (-1566.724) -- 0:00:48 249000 -- (-1572.257) [-1565.219] (-1566.972) (-1572.984) * (-1567.832) [-1567.180] (-1566.774) (-1567.846) -- 0:00:48 249500 -- (-1566.032) (-1566.643) [-1568.545] (-1569.153) * (-1568.605) [-1565.493] (-1568.373) (-1566.080) -- 0:00:48 250000 -- [-1568.610] (-1567.577) (-1569.366) (-1565.719) * [-1569.179] (-1569.544) (-1565.912) (-1570.212) -- 0:00:48 Average standard deviation of split frequencies: 0.013060 250500 -- (-1564.965) [-1567.078] (-1571.371) (-1565.372) * (-1565.831) (-1568.152) [-1567.368] (-1570.282) -- 0:00:47 251000 -- [-1567.454] (-1565.820) (-1566.983) (-1566.544) * [-1565.841] (-1568.848) (-1571.696) (-1568.401) -- 0:00:47 251500 -- (-1567.134) (-1565.494) [-1569.026] (-1566.667) * [-1565.637] (-1567.718) (-1565.936) (-1565.653) -- 0:00:47 252000 -- (-1566.102) (-1570.309) [-1569.139] (-1568.217) * (-1567.893) (-1565.899) (-1566.133) [-1566.563] -- 0:00:47 252500 -- (-1565.909) [-1566.698] (-1571.241) (-1569.538) * (-1567.763) [-1565.818] (-1569.452) (-1567.106) -- 0:00:47 253000 -- (-1565.001) (-1566.287) [-1565.361] (-1570.484) * [-1567.559] (-1566.957) (-1569.389) (-1568.835) -- 0:00:47 253500 -- (-1567.283) [-1566.636] (-1571.069) (-1567.408) * [-1565.847] (-1565.613) (-1572.393) (-1566.257) -- 0:00:47 254000 -- [-1565.702] (-1566.692) (-1566.860) (-1566.804) * [-1567.794] (-1566.670) (-1567.400) (-1571.127) -- 0:00:46 254500 -- (-1568.923) (-1566.729) [-1566.423] (-1570.942) * (-1566.594) (-1566.629) (-1569.968) [-1569.470] -- 0:00:46 255000 -- [-1565.504] (-1568.034) (-1567.159) (-1566.398) * (-1566.984) (-1565.964) (-1573.822) [-1567.211] -- 0:00:49 Average standard deviation of split frequencies: 0.012583 255500 -- (-1565.610) (-1565.578) [-1566.242] (-1565.366) * (-1566.848) (-1565.676) [-1566.767] (-1567.685) -- 0:00:49 256000 -- (-1564.792) (-1566.133) [-1565.009] (-1565.343) * (-1565.080) [-1566.227] (-1579.497) (-1567.543) -- 0:00:49 256500 -- [-1564.787] (-1564.868) (-1568.534) (-1566.338) * [-1564.548] (-1566.101) (-1572.145) (-1568.079) -- 0:00:49 257000 -- (-1565.354) (-1566.497) (-1572.424) [-1566.843] * (-1566.225) [-1565.279] (-1567.445) (-1566.692) -- 0:00:49 257500 -- [-1566.769] (-1565.533) (-1570.070) (-1567.504) * (-1566.519) [-1566.968] (-1567.244) (-1568.143) -- 0:00:49 258000 -- (-1566.600) [-1565.230] (-1569.691) (-1571.049) * (-1567.370) (-1566.751) [-1566.410] (-1565.905) -- 0:00:48 258500 -- (-1567.039) (-1565.444) [-1569.393] (-1570.995) * (-1566.455) (-1566.393) (-1566.375) [-1565.813] -- 0:00:48 259000 -- (-1565.230) (-1564.969) (-1566.845) [-1569.488] * (-1568.872) [-1566.432] (-1566.375) (-1567.133) -- 0:00:48 259500 -- (-1565.090) (-1565.253) [-1565.317] (-1566.790) * (-1566.449) [-1565.532] (-1568.089) (-1568.749) -- 0:00:48 260000 -- (-1565.710) [-1565.506] (-1565.431) (-1566.277) * [-1568.155] (-1567.178) (-1566.420) (-1567.904) -- 0:00:48 Average standard deviation of split frequencies: 0.013162 260500 -- (-1566.443) [-1566.150] (-1565.257) (-1566.847) * (-1569.011) (-1567.414) (-1567.835) [-1567.528] -- 0:00:48 261000 -- (-1565.366) (-1568.598) [-1566.273] (-1565.735) * (-1567.816) (-1568.406) [-1566.854] (-1565.382) -- 0:00:48 261500 -- [-1565.366] (-1568.896) (-1566.413) (-1565.352) * (-1569.876) [-1568.256] (-1565.921) (-1565.382) -- 0:00:48 262000 -- (-1568.448) [-1567.891] (-1570.488) (-1566.721) * (-1567.340) [-1565.834] (-1569.126) (-1565.940) -- 0:00:47 262500 -- (-1567.135) (-1568.121) [-1565.272] (-1567.634) * [-1566.303] (-1565.153) (-1568.333) (-1566.554) -- 0:00:47 263000 -- (-1566.976) [-1566.442] (-1568.604) (-1567.704) * [-1566.588] (-1568.370) (-1569.645) (-1566.381) -- 0:00:47 263500 -- (-1569.227) [-1567.296] (-1566.850) (-1566.264) * (-1567.763) (-1568.301) [-1569.159] (-1571.947) -- 0:00:47 264000 -- (-1566.755) (-1567.654) (-1567.431) [-1565.256] * (-1566.733) [-1568.315] (-1569.292) (-1567.934) -- 0:00:47 264500 -- (-1567.608) (-1566.517) (-1567.194) [-1568.738] * (-1566.760) (-1565.611) (-1568.729) [-1568.773] -- 0:00:47 265000 -- (-1566.266) (-1566.958) [-1566.640] (-1569.087) * [-1565.376] (-1566.164) (-1569.699) (-1572.340) -- 0:00:47 Average standard deviation of split frequencies: 0.012614 265500 -- (-1564.715) (-1566.366) [-1567.019] (-1567.591) * (-1566.288) (-1569.012) (-1572.885) [-1567.486] -- 0:00:47 266000 -- (-1567.442) (-1568.621) (-1568.288) [-1566.450] * (-1567.027) (-1565.534) (-1568.500) [-1565.315] -- 0:00:46 266500 -- (-1564.760) [-1567.442] (-1568.410) (-1567.239) * (-1566.411) [-1566.067] (-1569.662) (-1568.280) -- 0:00:46 267000 -- [-1565.125] (-1571.403) (-1569.025) (-1567.810) * (-1568.684) (-1565.998) [-1569.358] (-1565.733) -- 0:00:46 267500 -- (-1565.116) (-1569.521) [-1565.721] (-1566.980) * (-1568.623) [-1566.900] (-1568.758) (-1565.658) -- 0:00:46 268000 -- (-1565.592) (-1567.525) [-1566.041] (-1565.620) * (-1567.252) (-1567.495) (-1565.982) [-1567.139] -- 0:00:46 268500 -- (-1568.403) [-1566.835] (-1565.050) (-1565.242) * (-1566.029) (-1567.245) (-1567.527) [-1565.660] -- 0:00:46 269000 -- (-1572.756) (-1566.622) [-1565.648] (-1568.147) * [-1568.138] (-1566.617) (-1568.836) (-1568.564) -- 0:00:46 269500 -- (-1575.482) [-1567.363] (-1565.267) (-1566.429) * (-1565.324) (-1565.666) (-1567.157) [-1565.133] -- 0:00:46 270000 -- [-1565.640] (-1566.269) (-1566.280) (-1569.303) * (-1566.114) [-1565.511] (-1570.313) (-1565.566) -- 0:00:45 Average standard deviation of split frequencies: 0.013216 270500 -- (-1568.369) (-1566.818) [-1567.484] (-1566.983) * (-1565.693) [-1564.938] (-1570.675) (-1565.337) -- 0:00:45 271000 -- (-1570.116) (-1567.466) (-1566.761) [-1568.732] * (-1565.261) [-1566.874] (-1568.675) (-1565.405) -- 0:00:48 271500 -- [-1570.277] (-1569.389) (-1565.642) (-1568.996) * [-1565.225] (-1570.266) (-1567.974) (-1565.401) -- 0:00:48 272000 -- (-1566.398) (-1569.417) [-1565.804] (-1565.905) * (-1568.017) (-1565.263) (-1567.680) [-1565.667] -- 0:00:48 272500 -- (-1572.876) (-1566.901) [-1569.227] (-1565.751) * [-1566.894] (-1565.193) (-1569.410) (-1565.447) -- 0:00:48 273000 -- (-1574.000) (-1565.698) (-1568.308) [-1565.267] * (-1567.663) (-1566.917) (-1568.133) [-1565.674] -- 0:00:47 273500 -- (-1569.714) [-1569.881] (-1570.922) (-1565.554) * (-1567.616) [-1565.505] (-1566.163) (-1567.080) -- 0:00:47 274000 -- (-1565.598) (-1570.616) (-1567.288) [-1565.554] * (-1568.695) (-1567.659) [-1567.315] (-1571.861) -- 0:00:47 274500 -- [-1565.535] (-1566.812) (-1566.319) (-1565.601) * (-1569.788) [-1565.993] (-1565.940) (-1573.325) -- 0:00:47 275000 -- (-1565.790) [-1566.600] (-1566.930) (-1568.259) * (-1569.895) [-1567.081] (-1571.555) (-1567.743) -- 0:00:47 Average standard deviation of split frequencies: 0.013379 275500 -- (-1567.832) (-1569.157) [-1567.869] (-1576.681) * (-1568.600) (-1565.815) (-1566.492) [-1565.168] -- 0:00:47 276000 -- (-1571.201) (-1565.891) (-1569.207) [-1565.785] * (-1569.080) (-1569.697) [-1566.152] (-1566.323) -- 0:00:47 276500 -- (-1573.781) (-1566.460) [-1569.282] (-1566.125) * (-1570.638) [-1568.047] (-1565.451) (-1567.931) -- 0:00:47 277000 -- (-1577.166) (-1567.513) (-1568.694) [-1565.581] * (-1575.409) (-1575.853) [-1565.895] (-1569.382) -- 0:00:46 277500 -- (-1565.889) [-1567.211] (-1567.052) (-1566.714) * [-1567.770] (-1576.081) (-1566.761) (-1568.783) -- 0:00:46 278000 -- (-1565.365) (-1566.287) (-1566.941) [-1566.225] * (-1567.877) (-1576.219) (-1569.266) [-1566.023] -- 0:00:46 278500 -- (-1567.962) [-1567.790] (-1569.642) (-1567.879) * (-1566.886) (-1566.303) (-1566.356) [-1565.727] -- 0:00:46 279000 -- (-1566.116) (-1567.375) (-1567.520) [-1570.975] * (-1567.430) [-1567.986] (-1567.261) (-1565.906) -- 0:00:46 279500 -- [-1565.468] (-1564.974) (-1567.921) (-1566.777) * (-1575.448) (-1568.774) [-1565.932] (-1566.187) -- 0:00:46 280000 -- [-1568.205] (-1565.632) (-1565.219) (-1567.817) * (-1572.112) [-1569.606] (-1566.429) (-1565.967) -- 0:00:46 Average standard deviation of split frequencies: 0.013634 280500 -- (-1566.049) (-1565.202) [-1565.442] (-1565.096) * (-1565.880) (-1573.318) [-1566.078] (-1566.057) -- 0:00:46 281000 -- [-1565.870] (-1567.826) (-1565.399) (-1566.531) * (-1565.555) (-1567.206) (-1566.303) [-1565.350] -- 0:00:46 281500 -- [-1565.860] (-1566.096) (-1566.039) (-1568.368) * [-1565.663] (-1565.252) (-1568.325) (-1565.332) -- 0:00:45 282000 -- (-1566.390) [-1565.927] (-1566.777) (-1566.279) * [-1566.230] (-1566.179) (-1567.886) (-1565.930) -- 0:00:45 282500 -- (-1565.159) (-1565.553) [-1566.405] (-1573.181) * (-1566.708) (-1566.781) (-1565.344) [-1564.876] -- 0:00:45 283000 -- (-1566.591) (-1570.857) [-1570.510] (-1569.121) * [-1566.585] (-1568.298) (-1566.737) (-1565.007) -- 0:00:45 283500 -- (-1565.402) [-1565.987] (-1571.641) (-1567.904) * (-1571.511) (-1567.714) [-1569.041] (-1566.326) -- 0:00:45 284000 -- [-1565.410] (-1571.155) (-1568.396) (-1567.232) * (-1568.734) (-1566.653) (-1565.358) [-1565.061] -- 0:00:45 284500 -- (-1575.009) (-1570.943) [-1565.183] (-1567.073) * [-1565.957] (-1566.104) (-1566.725) (-1565.261) -- 0:00:45 285000 -- (-1565.462) (-1570.689) [-1566.306] (-1568.877) * (-1567.263) (-1565.744) (-1569.152) [-1566.368] -- 0:00:45 Average standard deviation of split frequencies: 0.013477 285500 -- (-1567.261) (-1566.729) (-1565.624) [-1568.626] * (-1571.941) (-1566.515) [-1566.826] (-1567.554) -- 0:00:45 286000 -- (-1566.560) (-1568.186) (-1570.477) [-1567.689] * (-1570.880) (-1565.851) [-1565.417] (-1566.383) -- 0:00:44 286500 -- (-1567.027) [-1565.189] (-1571.073) (-1568.489) * (-1567.202) (-1566.638) [-1565.010] (-1568.017) -- 0:00:44 287000 -- (-1568.952) (-1568.377) (-1568.273) [-1567.917] * (-1566.136) (-1564.659) [-1566.859] (-1568.292) -- 0:00:47 287500 -- (-1570.870) (-1568.036) [-1568.924] (-1567.458) * [-1565.283] (-1564.931) (-1568.280) (-1565.880) -- 0:00:47 288000 -- (-1567.267) (-1566.558) [-1565.186] (-1567.385) * (-1567.366) [-1565.025] (-1570.553) (-1566.501) -- 0:00:46 288500 -- (-1566.528) [-1566.801] (-1567.779) (-1568.120) * [-1565.662] (-1566.004) (-1572.129) (-1567.148) -- 0:00:46 289000 -- (-1567.378) [-1565.653] (-1564.778) (-1570.743) * [-1565.055] (-1565.622) (-1566.934) (-1573.912) -- 0:00:46 289500 -- [-1566.133] (-1566.351) (-1565.060) (-1568.818) * (-1566.597) (-1565.963) [-1566.500] (-1575.999) -- 0:00:46 290000 -- (-1569.459) [-1565.287] (-1565.852) (-1565.329) * (-1567.397) (-1566.184) [-1565.464] (-1568.493) -- 0:00:46 Average standard deviation of split frequencies: 0.014236 290500 -- (-1568.131) [-1566.986] (-1565.855) (-1566.237) * (-1565.700) (-1566.124) (-1565.742) [-1567.100] -- 0:00:46 291000 -- (-1570.492) [-1567.367] (-1565.244) (-1565.126) * [-1565.767] (-1564.894) (-1566.480) (-1566.606) -- 0:00:46 291500 -- (-1570.431) [-1566.975] (-1565.089) (-1567.307) * (-1566.256) (-1566.468) [-1566.539] (-1566.600) -- 0:00:46 292000 -- (-1568.173) (-1571.159) [-1564.888] (-1565.968) * (-1566.293) (-1565.594) (-1568.558) [-1566.948] -- 0:00:46 292500 -- (-1568.440) (-1569.204) [-1564.894] (-1567.815) * [-1565.866] (-1565.470) (-1568.695) (-1565.226) -- 0:00:45 293000 -- [-1569.664] (-1568.758) (-1568.108) (-1565.736) * (-1567.028) (-1565.405) (-1567.851) [-1565.154] -- 0:00:45 293500 -- (-1565.242) (-1567.378) [-1567.666] (-1565.734) * (-1567.417) (-1564.822) [-1567.887] (-1568.594) -- 0:00:45 294000 -- (-1566.281) (-1567.077) (-1566.039) [-1565.816] * [-1567.233] (-1566.105) (-1569.647) (-1565.759) -- 0:00:45 294500 -- (-1568.874) (-1568.352) (-1567.725) [-1567.995] * (-1566.204) (-1565.451) [-1572.738] (-1568.029) -- 0:00:45 295000 -- (-1568.594) (-1568.179) (-1572.341) [-1566.506] * (-1564.953) [-1565.466] (-1570.126) (-1569.554) -- 0:00:45 Average standard deviation of split frequencies: 0.013714 295500 -- [-1570.081] (-1565.795) (-1567.481) (-1566.437) * [-1565.729] (-1566.893) (-1567.417) (-1567.893) -- 0:00:45 296000 -- (-1567.217) (-1567.615) [-1565.577] (-1565.506) * [-1565.746] (-1566.852) (-1568.850) (-1566.003) -- 0:00:45 296500 -- [-1571.018] (-1569.195) (-1565.713) (-1565.691) * [-1566.306] (-1572.557) (-1566.307) (-1566.651) -- 0:00:45 297000 -- (-1568.924) [-1568.323] (-1565.568) (-1566.667) * [-1568.259] (-1567.962) (-1565.486) (-1565.243) -- 0:00:44 297500 -- (-1569.328) [-1566.284] (-1566.135) (-1566.603) * (-1566.833) (-1567.140) [-1565.058] (-1568.748) -- 0:00:44 298000 -- (-1565.306) (-1567.387) (-1567.905) [-1567.628] * [-1568.430] (-1568.866) (-1567.078) (-1564.773) -- 0:00:44 298500 -- [-1566.536] (-1568.066) (-1568.416) (-1567.654) * (-1565.981) (-1564.889) (-1565.409) [-1565.791] -- 0:00:44 299000 -- (-1566.277) (-1567.300) [-1570.934] (-1566.003) * [-1568.461] (-1567.720) (-1565.012) (-1567.844) -- 0:00:44 299500 -- (-1565.574) (-1569.435) [-1565.239] (-1565.475) * (-1564.846) (-1569.530) (-1565.622) [-1567.657] -- 0:00:44 300000 -- [-1565.730] (-1567.440) (-1567.474) (-1565.691) * [-1565.689] (-1567.508) (-1565.851) (-1574.842) -- 0:00:44 Average standard deviation of split frequencies: 0.012456 300500 -- (-1567.263) [-1567.458] (-1568.531) (-1565.458) * [-1565.736] (-1567.261) (-1568.078) (-1569.742) -- 0:00:44 301000 -- (-1566.983) [-1567.800] (-1568.856) (-1565.458) * (-1565.264) [-1572.860] (-1565.566) (-1572.546) -- 0:00:44 301500 -- (-1568.359) (-1568.224) [-1566.033] (-1564.889) * (-1567.949) (-1570.154) [-1566.642] (-1569.483) -- 0:00:44 302000 -- [-1566.381] (-1570.316) (-1565.448) (-1568.356) * [-1565.406] (-1571.753) (-1569.327) (-1569.571) -- 0:00:43 302500 -- (-1565.639) [-1567.020] (-1569.387) (-1566.474) * [-1565.014] (-1565.228) (-1566.312) (-1568.717) -- 0:00:43 303000 -- (-1566.777) (-1566.390) [-1566.385] (-1566.561) * (-1567.428) (-1567.459) (-1565.316) [-1566.653] -- 0:00:46 303500 -- (-1566.433) [-1568.017] (-1566.497) (-1568.096) * (-1568.465) [-1566.648] (-1564.920) (-1568.063) -- 0:00:45 304000 -- (-1565.281) (-1567.508) [-1566.095] (-1567.047) * (-1565.702) (-1570.356) [-1565.082] (-1567.544) -- 0:00:45 304500 -- (-1567.956) (-1570.824) [-1568.759] (-1566.856) * [-1566.249] (-1569.337) (-1565.120) (-1566.819) -- 0:00:45 305000 -- (-1565.416) (-1570.740) (-1568.786) [-1566.514] * (-1566.752) (-1568.625) [-1568.611] (-1567.240) -- 0:00:45 Average standard deviation of split frequencies: 0.011383 305500 -- (-1570.340) (-1565.691) (-1567.967) [-1565.514] * (-1566.417) (-1571.099) [-1567.293] (-1565.293) -- 0:00:45 306000 -- (-1570.538) (-1565.860) (-1567.055) [-1569.544] * (-1565.536) (-1566.743) [-1566.920] (-1566.619) -- 0:00:45 306500 -- (-1570.613) (-1566.439) (-1566.444) [-1568.054] * (-1574.639) (-1567.177) (-1565.314) [-1567.621] -- 0:00:45 307000 -- (-1565.615) [-1565.952] (-1566.974) (-1567.419) * (-1569.488) (-1570.378) [-1564.989] (-1566.212) -- 0:00:45 307500 -- [-1567.807] (-1565.918) (-1565.957) (-1567.407) * (-1566.184) (-1575.491) [-1567.156] (-1567.852) -- 0:00:45 308000 -- [-1565.338] (-1566.765) (-1570.372) (-1566.407) * (-1568.608) (-1567.536) [-1565.097] (-1568.778) -- 0:00:44 308500 -- (-1565.361) (-1566.893) (-1567.864) [-1566.871] * [-1566.474] (-1567.879) (-1567.402) (-1566.960) -- 0:00:44 309000 -- (-1566.235) (-1566.079) (-1569.064) [-1565.836] * (-1565.758) (-1567.269) [-1568.817] (-1569.473) -- 0:00:44 309500 -- [-1567.806] (-1566.521) (-1567.811) (-1566.670) * (-1566.059) (-1569.986) (-1567.498) [-1569.460] -- 0:00:44 310000 -- [-1568.885] (-1566.470) (-1567.199) (-1569.303) * (-1567.528) [-1568.451] (-1568.918) (-1567.222) -- 0:00:44 Average standard deviation of split frequencies: 0.010369 310500 -- (-1567.032) [-1565.262] (-1567.621) (-1565.432) * (-1565.875) (-1567.436) (-1567.523) [-1569.370] -- 0:00:44 311000 -- (-1569.829) [-1570.087] (-1569.996) (-1566.520) * [-1567.479] (-1568.853) (-1567.378) (-1568.634) -- 0:00:44 311500 -- (-1570.080) (-1565.654) [-1565.902] (-1565.583) * (-1567.382) (-1570.197) [-1567.708] (-1568.172) -- 0:00:44 312000 -- (-1570.023) (-1566.480) (-1565.645) [-1564.993] * (-1565.974) (-1569.786) (-1566.961) [-1565.883] -- 0:00:44 312500 -- (-1567.455) (-1568.785) [-1566.659] (-1567.862) * [-1566.567] (-1568.479) (-1565.631) (-1566.685) -- 0:00:44 313000 -- (-1568.554) [-1569.308] (-1565.848) (-1566.818) * (-1567.266) [-1568.651] (-1570.879) (-1566.019) -- 0:00:43 313500 -- (-1565.780) (-1568.967) (-1567.637) [-1568.462] * (-1567.444) [-1565.392] (-1570.998) (-1566.363) -- 0:00:43 314000 -- (-1565.924) (-1571.859) (-1568.391) [-1567.715] * (-1567.123) (-1567.519) (-1566.241) [-1564.962] -- 0:00:43 314500 -- (-1566.058) (-1569.562) (-1567.068) [-1565.350] * (-1566.228) (-1569.502) (-1566.190) [-1564.984] -- 0:00:43 315000 -- [-1573.599] (-1570.015) (-1568.304) (-1566.304) * [-1566.972] (-1567.133) (-1569.962) (-1565.790) -- 0:00:43 Average standard deviation of split frequencies: 0.010940 315500 -- (-1566.747) (-1566.207) (-1565.639) [-1565.894] * (-1566.136) (-1565.159) (-1570.544) [-1567.465] -- 0:00:43 316000 -- (-1566.723) (-1568.398) (-1565.514) [-1565.470] * (-1568.063) (-1565.019) (-1568.708) [-1567.898] -- 0:00:43 316500 -- (-1567.320) [-1566.662] (-1565.282) (-1565.814) * (-1567.086) (-1565.394) (-1571.232) [-1567.712] -- 0:00:43 317000 -- (-1566.628) (-1566.005) [-1566.955] (-1565.488) * (-1565.872) (-1565.239) [-1565.519] (-1568.531) -- 0:00:43 317500 -- (-1566.783) (-1567.753) [-1567.701] (-1565.812) * (-1568.128) [-1565.318] (-1567.768) (-1571.379) -- 0:00:42 318000 -- (-1567.763) (-1564.906) (-1568.673) [-1565.926] * (-1569.234) (-1567.184) [-1568.295] (-1567.670) -- 0:00:42 318500 -- (-1567.066) (-1567.452) [-1567.286] (-1566.606) * (-1570.274) (-1567.137) [-1568.444] (-1569.996) -- 0:00:42 319000 -- (-1566.987) (-1567.401) (-1564.933) [-1566.246] * (-1567.983) [-1565.628] (-1571.507) (-1566.401) -- 0:00:44 319500 -- (-1565.720) (-1567.077) (-1564.937) [-1566.661] * (-1564.868) [-1566.263] (-1569.940) (-1566.054) -- 0:00:44 320000 -- [-1569.531] (-1568.045) (-1565.308) (-1567.832) * (-1566.577) (-1565.950) (-1575.515) [-1565.626] -- 0:00:44 Average standard deviation of split frequencies: 0.010862 320500 -- [-1566.683] (-1564.881) (-1565.406) (-1566.416) * (-1566.880) (-1565.935) (-1568.405) [-1568.709] -- 0:00:44 321000 -- (-1566.837) (-1565.220) [-1566.153] (-1568.801) * (-1568.569) (-1565.469) (-1568.657) [-1565.448] -- 0:00:44 321500 -- (-1566.166) (-1567.128) [-1570.541] (-1569.372) * (-1566.280) (-1566.892) [-1564.906] (-1565.400) -- 0:00:44 322000 -- (-1566.607) (-1571.868) (-1567.033) [-1572.665] * [-1567.608] (-1567.254) (-1567.766) (-1566.928) -- 0:00:44 322500 -- [-1566.329] (-1571.745) (-1568.331) (-1566.654) * (-1570.235) (-1565.595) (-1564.763) [-1566.607] -- 0:00:44 323000 -- (-1569.432) [-1572.551] (-1568.344) (-1565.748) * (-1569.090) [-1566.554] (-1567.031) (-1568.877) -- 0:00:44 323500 -- (-1569.551) (-1568.876) [-1566.423] (-1571.037) * (-1566.788) (-1568.314) [-1566.954] (-1566.544) -- 0:00:43 324000 -- (-1570.367) (-1567.654) (-1572.825) [-1569.904] * [-1565.485] (-1567.992) (-1567.094) (-1568.415) -- 0:00:43 324500 -- (-1568.176) (-1567.159) [-1570.990] (-1567.611) * [-1566.208] (-1569.839) (-1566.171) (-1568.639) -- 0:00:43 325000 -- (-1568.934) [-1565.736] (-1569.053) (-1571.209) * (-1566.340) (-1568.060) [-1566.636] (-1568.222) -- 0:00:43 Average standard deviation of split frequencies: 0.011649 325500 -- (-1569.062) (-1569.882) (-1569.277) [-1565.462] * (-1572.314) (-1565.624) (-1565.709) [-1568.897] -- 0:00:43 326000 -- (-1570.873) (-1565.204) [-1565.494] (-1570.315) * [-1568.833] (-1566.039) (-1566.510) (-1572.625) -- 0:00:43 326500 -- (-1567.623) (-1567.100) (-1565.795) [-1566.279] * [-1567.872] (-1567.724) (-1567.911) (-1570.153) -- 0:00:43 327000 -- [-1565.941] (-1568.692) (-1567.951) (-1569.124) * [-1571.098] (-1565.217) (-1567.394) (-1567.138) -- 0:00:43 327500 -- [-1565.241] (-1569.339) (-1569.587) (-1569.239) * [-1568.227] (-1565.972) (-1567.024) (-1568.513) -- 0:00:43 328000 -- (-1566.730) [-1570.262] (-1571.546) (-1567.079) * (-1568.038) [-1566.895] (-1566.071) (-1565.795) -- 0:00:43 328500 -- (-1567.453) (-1566.286) (-1570.010) [-1565.550] * (-1567.279) [-1565.504] (-1567.249) (-1565.789) -- 0:00:42 329000 -- (-1565.330) [-1568.452] (-1566.470) (-1565.595) * (-1567.476) (-1564.915) [-1566.083] (-1566.888) -- 0:00:42 329500 -- (-1565.451) (-1567.198) (-1568.518) [-1567.675] * (-1570.479) (-1565.656) (-1565.954) [-1567.260] -- 0:00:42 330000 -- [-1566.485] (-1568.215) (-1567.379) (-1566.692) * (-1570.168) (-1566.320) (-1567.610) [-1565.030] -- 0:00:42 Average standard deviation of split frequencies: 0.011563 330500 -- (-1569.326) (-1569.615) [-1568.360] (-1566.052) * (-1568.099) [-1566.040] (-1565.787) (-1565.262) -- 0:00:42 331000 -- (-1565.808) [-1568.346] (-1565.687) (-1566.878) * [-1566.069] (-1567.801) (-1565.480) (-1568.641) -- 0:00:42 331500 -- (-1569.112) (-1570.696) [-1567.410] (-1566.041) * (-1571.255) (-1566.213) (-1564.943) [-1568.108] -- 0:00:42 332000 -- (-1566.473) (-1567.180) [-1567.892] (-1565.112) * (-1570.294) [-1566.341] (-1566.272) (-1569.046) -- 0:00:42 332500 -- (-1565.822) (-1566.716) [-1567.590] (-1570.345) * (-1569.957) (-1565.643) (-1565.141) [-1568.444] -- 0:00:42 333000 -- (-1566.686) (-1566.900) [-1565.941] (-1568.855) * [-1569.130] (-1566.737) (-1565.124) (-1567.742) -- 0:00:42 333500 -- (-1566.726) (-1566.674) [-1565.912] (-1568.866) * (-1568.557) (-1568.014) (-1569.467) [-1567.819] -- 0:00:41 334000 -- (-1569.310) [-1565.583] (-1567.072) (-1565.113) * (-1566.862) [-1566.122] (-1567.613) (-1570.159) -- 0:00:41 334500 -- (-1569.395) (-1567.352) [-1566.194] (-1566.231) * (-1564.982) (-1567.115) [-1565.950] (-1568.569) -- 0:00:41 335000 -- (-1565.310) (-1567.379) (-1566.637) [-1566.346] * [-1566.766] (-1567.708) (-1566.066) (-1565.599) -- 0:00:43 Average standard deviation of split frequencies: 0.012315 335500 -- (-1565.345) (-1566.008) [-1566.219] (-1566.475) * [-1565.461] (-1571.897) (-1566.372) (-1566.842) -- 0:00:43 336000 -- (-1566.188) [-1566.269] (-1568.725) (-1568.425) * (-1567.667) [-1566.534] (-1566.770) (-1568.596) -- 0:00:43 336500 -- (-1567.396) [-1567.323] (-1565.912) (-1568.572) * (-1566.869) [-1569.546] (-1569.205) (-1569.434) -- 0:00:43 337000 -- (-1566.084) (-1568.035) (-1565.495) [-1566.850] * (-1566.882) (-1569.437) [-1566.443] (-1566.825) -- 0:00:43 337500 -- (-1565.410) (-1566.758) (-1564.734) [-1567.386] * (-1566.848) (-1567.561) (-1566.296) [-1568.206] -- 0:00:43 338000 -- (-1565.056) (-1568.144) [-1565.733] (-1571.990) * [-1566.405] (-1566.654) (-1567.433) (-1571.403) -- 0:00:43 338500 -- (-1564.886) (-1567.022) (-1565.843) [-1570.754] * (-1566.250) (-1568.143) (-1569.201) [-1571.094] -- 0:00:42 339000 -- (-1565.180) [-1565.867] (-1565.465) (-1569.686) * (-1567.956) (-1568.089) [-1567.822] (-1570.080) -- 0:00:42 339500 -- (-1567.813) [-1564.849] (-1565.480) (-1567.971) * (-1569.162) (-1567.831) (-1569.096) [-1567.299] -- 0:00:42 340000 -- [-1566.410] (-1565.918) (-1565.753) (-1569.877) * (-1566.334) (-1567.556) (-1566.664) [-1569.715] -- 0:00:42 Average standard deviation of split frequencies: 0.012022 340500 -- (-1565.385) [-1568.377] (-1565.753) (-1566.818) * [-1566.123] (-1567.632) (-1565.588) (-1571.445) -- 0:00:42 341000 -- (-1565.605) (-1567.489) [-1565.253] (-1566.181) * (-1565.643) [-1565.550] (-1567.754) (-1569.023) -- 0:00:42 341500 -- [-1567.244] (-1566.778) (-1566.780) (-1569.201) * (-1566.406) (-1568.064) (-1566.902) [-1566.700] -- 0:00:42 342000 -- (-1566.662) [-1566.098] (-1566.184) (-1567.195) * (-1568.478) (-1568.086) [-1565.299] (-1567.006) -- 0:00:42 342500 -- (-1567.681) (-1565.021) [-1565.874] (-1565.769) * [-1568.015] (-1565.252) (-1566.639) (-1565.402) -- 0:00:42 343000 -- (-1569.813) [-1565.037] (-1565.804) (-1565.554) * (-1569.727) [-1565.247] (-1566.567) (-1566.943) -- 0:00:42 343500 -- [-1565.678] (-1566.435) (-1567.278) (-1565.683) * [-1568.082] (-1568.206) (-1565.707) (-1566.378) -- 0:00:42 344000 -- (-1564.958) (-1566.926) (-1568.537) [-1564.874] * (-1567.360) (-1570.589) [-1567.059] (-1568.703) -- 0:00:41 344500 -- [-1566.794] (-1567.068) (-1567.822) (-1568.230) * (-1570.008) (-1567.702) (-1568.587) [-1569.995] -- 0:00:41 345000 -- [-1565.242] (-1566.650) (-1569.873) (-1569.163) * (-1569.135) [-1566.514] (-1565.473) (-1565.815) -- 0:00:41 Average standard deviation of split frequencies: 0.012338 345500 -- (-1566.257) [-1566.382] (-1569.928) (-1573.795) * (-1570.723) [-1570.509] (-1566.318) (-1566.181) -- 0:00:41 346000 -- (-1567.777) (-1566.706) (-1569.928) [-1568.816] * (-1571.593) (-1566.422) [-1565.627] (-1564.920) -- 0:00:41 346500 -- [-1567.595] (-1572.451) (-1566.182) (-1568.724) * (-1566.026) (-1567.912) [-1568.586] (-1565.290) -- 0:00:41 347000 -- (-1569.378) (-1567.924) [-1565.772] (-1569.985) * (-1566.287) (-1565.805) [-1568.031] (-1566.864) -- 0:00:41 347500 -- (-1567.188) (-1567.200) [-1566.755] (-1565.834) * [-1567.219] (-1566.167) (-1566.768) (-1568.410) -- 0:00:41 348000 -- (-1564.875) [-1571.324] (-1566.774) (-1569.625) * (-1565.652) (-1566.143) (-1566.511) [-1569.836] -- 0:00:41 348500 -- [-1566.894] (-1569.790) (-1566.810) (-1569.025) * (-1565.403) (-1570.393) (-1566.061) [-1568.156] -- 0:00:41 349000 -- (-1567.027) (-1568.334) (-1565.719) [-1565.804] * (-1567.932) (-1569.825) [-1569.566] (-1566.584) -- 0:00:41 349500 -- [-1565.103] (-1573.459) (-1570.982) (-1566.507) * (-1566.164) (-1569.075) (-1566.620) [-1565.923] -- 0:00:40 350000 -- (-1566.285) (-1568.101) (-1566.798) [-1567.339] * (-1565.958) (-1568.742) [-1565.203] (-1565.833) -- 0:00:40 Average standard deviation of split frequencies: 0.012519 350500 -- [-1570.949] (-1575.355) (-1568.509) (-1568.664) * [-1565.952] (-1568.537) (-1569.641) (-1566.816) -- 0:00:40 351000 -- (-1565.338) [-1569.444] (-1567.278) (-1569.013) * (-1565.215) (-1566.822) [-1568.076] (-1565.527) -- 0:00:42 351500 -- [-1566.481] (-1566.983) (-1568.814) (-1568.571) * (-1567.660) (-1570.605) (-1569.861) [-1570.299] -- 0:00:42 352000 -- (-1565.538) (-1568.558) [-1566.286] (-1569.615) * [-1568.780] (-1568.230) (-1571.144) (-1567.669) -- 0:00:42 352500 -- (-1567.740) (-1566.708) [-1567.090] (-1566.557) * (-1568.642) (-1568.122) [-1570.944] (-1566.332) -- 0:00:42 353000 -- (-1565.717) [-1566.858] (-1569.181) (-1565.697) * (-1566.489) (-1564.727) (-1570.565) [-1568.013] -- 0:00:42 353500 -- [-1565.717] (-1566.834) (-1567.335) (-1571.582) * [-1565.961] (-1566.354) (-1568.598) (-1570.374) -- 0:00:42 354000 -- [-1565.717] (-1568.696) (-1567.171) (-1567.968) * (-1566.535) (-1565.544) [-1566.401] (-1565.517) -- 0:00:41 354500 -- (-1565.751) (-1567.663) [-1565.833] (-1567.117) * [-1566.879] (-1565.316) (-1567.289) (-1565.674) -- 0:00:41 355000 -- (-1565.766) (-1566.192) [-1565.765] (-1568.578) * (-1567.940) [-1565.205] (-1568.006) (-1565.753) -- 0:00:41 Average standard deviation of split frequencies: 0.012073 355500 -- (-1567.261) [-1566.956] (-1565.891) (-1567.297) * (-1565.599) (-1568.431) [-1570.557] (-1566.336) -- 0:00:41 356000 -- (-1567.383) (-1566.231) (-1567.052) [-1567.170] * [-1565.882] (-1567.831) (-1568.228) (-1565.868) -- 0:00:41 356500 -- (-1568.128) [-1566.228] (-1567.035) (-1565.699) * (-1566.601) (-1568.795) [-1571.303] (-1567.412) -- 0:00:41 357000 -- [-1570.347] (-1565.144) (-1570.242) (-1566.500) * [-1566.726] (-1567.907) (-1567.696) (-1568.423) -- 0:00:41 357500 -- [-1566.532] (-1566.301) (-1567.938) (-1567.106) * (-1565.436) [-1568.682] (-1567.869) (-1568.402) -- 0:00:41 358000 -- [-1567.217] (-1566.275) (-1568.338) (-1567.326) * (-1571.197) (-1567.710) (-1571.092) [-1567.793] -- 0:00:41 358500 -- (-1565.938) (-1568.735) [-1571.251] (-1568.937) * (-1567.932) [-1567.848] (-1566.238) (-1567.992) -- 0:00:41 359000 -- [-1565.583] (-1573.903) (-1567.340) (-1569.396) * (-1567.644) [-1565.295] (-1567.876) (-1569.204) -- 0:00:41 359500 -- (-1566.424) (-1572.161) [-1566.435] (-1567.387) * (-1568.896) [-1564.806] (-1566.255) (-1568.194) -- 0:00:40 360000 -- (-1569.387) [-1567.740] (-1569.970) (-1570.504) * (-1566.457) (-1564.966) [-1566.861] (-1564.724) -- 0:00:40 Average standard deviation of split frequencies: 0.010918 360500 -- (-1566.760) (-1567.403) (-1572.198) [-1566.594] * (-1568.043) [-1565.146] (-1567.927) (-1568.049) -- 0:00:40 361000 -- (-1566.760) (-1567.490) (-1569.395) [-1567.775] * (-1567.094) (-1565.690) [-1567.849] (-1570.292) -- 0:00:40 361500 -- [-1566.613] (-1564.767) (-1566.564) (-1566.007) * (-1564.953) [-1566.600] (-1565.177) (-1569.164) -- 0:00:40 362000 -- (-1567.994) [-1565.799] (-1566.569) (-1566.922) * [-1565.204] (-1569.745) (-1567.768) (-1565.907) -- 0:00:40 362500 -- [-1565.819] (-1571.605) (-1565.613) (-1567.655) * [-1565.844] (-1569.154) (-1569.849) (-1567.358) -- 0:00:40 363000 -- (-1565.078) (-1569.576) (-1569.689) [-1565.996] * [-1568.589] (-1567.879) (-1569.447) (-1566.450) -- 0:00:40 363500 -- (-1567.972) (-1567.312) [-1567.385] (-1566.428) * (-1570.805) [-1567.865] (-1566.072) (-1567.070) -- 0:00:40 364000 -- (-1570.556) [-1567.648] (-1566.460) (-1566.302) * (-1566.654) (-1568.880) [-1570.458] (-1567.670) -- 0:00:40 364500 -- (-1568.414) (-1567.836) (-1565.889) [-1567.524] * (-1565.542) (-1566.622) [-1570.619] (-1569.147) -- 0:00:40 365000 -- (-1568.784) (-1567.120) [-1566.372] (-1566.256) * (-1566.239) (-1568.109) (-1566.184) [-1565.952] -- 0:00:40 Average standard deviation of split frequencies: 0.011306 365500 -- (-1568.525) (-1564.993) [-1566.331] (-1565.972) * (-1566.727) (-1565.522) (-1567.546) [-1567.960] -- 0:00:39 366000 -- (-1568.830) [-1566.130] (-1566.236) (-1565.518) * [-1568.499] (-1565.438) (-1567.661) (-1566.001) -- 0:00:39 366500 -- (-1569.996) [-1566.532] (-1567.720) (-1569.955) * (-1567.239) [-1565.193] (-1569.450) (-1567.361) -- 0:00:39 367000 -- [-1567.343] (-1567.001) (-1568.512) (-1568.975) * (-1567.806) (-1568.624) (-1566.525) [-1567.376] -- 0:00:41 367500 -- (-1565.893) [-1565.513] (-1571.813) (-1566.312) * [-1565.377] (-1567.182) (-1566.241) (-1568.927) -- 0:00:41 368000 -- (-1567.314) (-1567.186) [-1566.396] (-1569.407) * [-1567.622] (-1569.077) (-1566.290) (-1569.871) -- 0:00:41 368500 -- (-1566.100) (-1565.679) (-1569.564) [-1570.546] * (-1565.300) (-1565.297) (-1566.591) [-1565.369] -- 0:00:41 369000 -- [-1566.512] (-1570.302) (-1567.801) (-1568.112) * [-1568.452] (-1565.898) (-1566.808) (-1565.010) -- 0:00:41 369500 -- [-1568.854] (-1569.876) (-1565.884) (-1567.689) * (-1566.581) (-1566.620) (-1568.038) [-1565.245] -- 0:00:40 370000 -- (-1566.737) (-1568.880) (-1565.890) [-1566.324] * (-1567.073) (-1566.237) (-1567.996) [-1564.672] -- 0:00:40 Average standard deviation of split frequencies: 0.009892 370500 -- (-1565.788) [-1568.234] (-1564.785) (-1565.924) * (-1567.445) (-1567.292) [-1566.258] (-1566.399) -- 0:00:40 371000 -- (-1572.043) (-1566.112) (-1565.488) [-1565.734] * (-1567.925) [-1564.965] (-1565.200) (-1566.221) -- 0:00:40 371500 -- (-1572.334) (-1565.583) [-1565.434] (-1566.468) * (-1570.449) (-1568.017) [-1565.198] (-1567.037) -- 0:00:40 372000 -- (-1571.803) (-1566.433) (-1566.787) [-1570.439] * [-1567.063] (-1566.144) (-1565.825) (-1565.128) -- 0:00:40 372500 -- (-1566.423) (-1567.447) [-1566.737] (-1569.769) * (-1564.955) (-1569.371) (-1565.899) [-1564.708] -- 0:00:40 373000 -- (-1565.671) [-1567.452] (-1570.548) (-1568.288) * [-1565.866] (-1566.511) (-1566.396) (-1566.002) -- 0:00:40 373500 -- [-1565.095] (-1565.762) (-1570.175) (-1567.109) * (-1565.841) [-1565.036] (-1567.139) (-1569.573) -- 0:00:40 374000 -- (-1565.238) (-1567.423) [-1570.240] (-1567.681) * (-1567.690) [-1565.414] (-1565.404) (-1566.950) -- 0:00:40 374500 -- [-1569.008] (-1569.596) (-1567.507) (-1567.896) * (-1569.998) [-1565.994] (-1565.526) (-1567.537) -- 0:00:40 375000 -- (-1569.523) (-1570.272) [-1567.112] (-1567.157) * (-1569.077) [-1565.792] (-1568.199) (-1568.112) -- 0:00:40 Average standard deviation of split frequencies: 0.010378 375500 -- (-1568.825) (-1566.131) [-1568.085] (-1568.053) * (-1569.485) [-1564.964] (-1568.996) (-1565.582) -- 0:00:39 376000 -- (-1567.234) (-1567.662) [-1566.859] (-1567.224) * (-1572.223) (-1571.557) [-1567.773] (-1566.962) -- 0:00:39 376500 -- (-1568.108) [-1568.715] (-1567.359) (-1565.471) * (-1566.258) (-1570.271) [-1570.839] (-1566.023) -- 0:00:39 377000 -- (-1566.823) (-1566.882) (-1566.398) [-1565.912] * (-1566.444) (-1569.458) [-1568.121] (-1567.635) -- 0:00:39 377500 -- (-1572.991) (-1565.782) [-1566.485] (-1565.060) * [-1566.722] (-1567.785) (-1566.117) (-1566.930) -- 0:00:39 378000 -- (-1570.080) (-1567.122) (-1567.624) [-1565.405] * (-1565.979) [-1568.722] (-1570.651) (-1566.428) -- 0:00:39 378500 -- (-1568.561) [-1567.282] (-1566.400) (-1569.398) * [-1566.041] (-1566.552) (-1569.087) (-1567.923) -- 0:00:39 379000 -- [-1569.800] (-1567.473) (-1567.093) (-1568.283) * [-1568.966] (-1566.941) (-1566.237) (-1567.394) -- 0:00:39 379500 -- [-1570.162] (-1567.280) (-1565.703) (-1567.949) * [-1567.039] (-1570.972) (-1566.528) (-1566.663) -- 0:00:39 380000 -- (-1570.248) (-1567.451) (-1566.079) [-1566.817] * (-1566.877) (-1564.783) (-1566.488) [-1569.375] -- 0:00:39 Average standard deviation of split frequencies: 0.010053 380500 -- (-1571.200) (-1567.781) (-1566.492) [-1570.249] * (-1568.795) [-1566.363] (-1566.137) (-1569.553) -- 0:00:39 381000 -- (-1566.454) (-1571.100) (-1568.633) [-1568.620] * (-1569.098) (-1566.474) [-1567.173] (-1567.718) -- 0:00:38 381500 -- (-1566.608) (-1567.312) (-1566.572) [-1565.521] * (-1568.540) (-1568.767) (-1566.035) [-1568.720] -- 0:00:38 382000 -- (-1570.266) [-1566.093] (-1567.869) (-1568.718) * (-1566.027) (-1566.043) (-1565.317) [-1567.897] -- 0:00:38 382500 -- (-1568.281) (-1568.795) (-1569.295) [-1567.708] * (-1565.142) (-1565.523) [-1565.446] (-1568.217) -- 0:00:38 383000 -- (-1567.843) (-1566.455) [-1566.779] (-1567.595) * (-1566.688) [-1568.689] (-1565.359) (-1569.737) -- 0:00:40 383500 -- (-1566.955) (-1568.015) (-1567.009) [-1566.074] * (-1568.362) (-1570.885) (-1566.357) [-1568.022] -- 0:00:40 384000 -- (-1568.414) (-1568.683) (-1567.083) [-1566.055] * (-1569.049) (-1566.488) [-1568.025] (-1565.229) -- 0:00:40 384500 -- (-1566.438) (-1565.688) [-1567.827] (-1565.234) * (-1568.537) (-1565.254) [-1566.340] (-1567.610) -- 0:00:40 385000 -- [-1567.148] (-1565.102) (-1566.580) (-1568.532) * (-1565.992) (-1567.924) (-1568.920) [-1566.144] -- 0:00:39 Average standard deviation of split frequencies: 0.010381 385500 -- (-1567.112) (-1564.977) (-1568.227) [-1565.305] * [-1566.554] (-1572.409) (-1568.180) (-1567.336) -- 0:00:39 386000 -- [-1566.340] (-1567.376) (-1569.758) (-1565.270) * (-1566.479) (-1568.099) (-1567.295) [-1566.097] -- 0:00:39 386500 -- (-1568.639) (-1567.566) (-1568.654) [-1565.303] * (-1566.154) [-1568.884] (-1568.997) (-1567.054) -- 0:00:39 387000 -- [-1567.330] (-1566.829) (-1568.473) (-1566.882) * [-1567.273] (-1569.085) (-1567.467) (-1567.209) -- 0:00:39 387500 -- (-1565.645) [-1566.229] (-1565.768) (-1565.844) * (-1567.490) [-1567.973] (-1569.269) (-1568.087) -- 0:00:39 388000 -- (-1567.510) [-1568.581] (-1565.508) (-1566.550) * (-1565.267) [-1565.376] (-1573.261) (-1566.043) -- 0:00:39 388500 -- (-1570.060) (-1568.911) (-1565.825) [-1566.922] * [-1565.539] (-1565.396) (-1570.055) (-1565.334) -- 0:00:39 389000 -- (-1567.380) (-1567.385) [-1568.886] (-1565.475) * (-1565.494) (-1566.215) (-1567.520) [-1565.105] -- 0:00:39 389500 -- (-1567.964) [-1566.281] (-1566.564) (-1566.646) * (-1567.841) (-1568.149) [-1565.724] (-1564.959) -- 0:00:39 390000 -- (-1572.224) (-1567.106) (-1567.223) [-1568.979] * (-1569.052) (-1568.034) (-1565.043) [-1564.765] -- 0:00:39 Average standard deviation of split frequencies: 0.010647 390500 -- (-1567.737) [-1568.203] (-1570.819) (-1567.054) * [-1566.388] (-1567.515) (-1566.853) (-1565.733) -- 0:00:39 391000 -- (-1566.807) (-1569.271) [-1573.374] (-1571.636) * (-1569.808) [-1565.046] (-1566.162) (-1567.869) -- 0:00:38 391500 -- (-1567.256) (-1567.095) (-1566.138) [-1567.811] * (-1567.294) [-1566.115] (-1565.666) (-1570.793) -- 0:00:38 392000 -- [-1565.594] (-1567.815) (-1571.385) (-1565.639) * (-1568.165) (-1567.900) [-1569.986] (-1573.569) -- 0:00:38 392500 -- (-1569.692) (-1571.189) (-1569.652) [-1567.370] * (-1572.953) [-1566.432] (-1568.879) (-1568.912) -- 0:00:38 393000 -- [-1568.687] (-1568.570) (-1566.969) (-1567.930) * [-1566.663] (-1568.798) (-1569.384) (-1565.650) -- 0:00:38 393500 -- (-1567.601) (-1569.815) (-1567.755) [-1569.821] * (-1568.931) (-1570.991) [-1569.195] (-1568.200) -- 0:00:38 394000 -- (-1565.611) (-1568.683) [-1567.776] (-1567.027) * (-1567.719) (-1569.594) (-1569.106) [-1564.954] -- 0:00:38 394500 -- (-1567.313) (-1567.647) [-1567.635] (-1567.619) * (-1567.129) (-1566.079) (-1569.919) [-1566.102] -- 0:00:38 395000 -- (-1565.821) (-1568.440) (-1573.074) [-1565.590] * [-1565.389] (-1568.569) (-1570.475) (-1566.578) -- 0:00:38 Average standard deviation of split frequencies: 0.009523 395500 -- [-1566.985] (-1566.907) (-1569.080) (-1567.058) * (-1569.450) (-1568.506) [-1567.841] (-1566.414) -- 0:00:38 396000 -- (-1566.645) (-1571.303) (-1580.789) [-1567.852] * [-1568.942] (-1566.651) (-1566.977) (-1566.558) -- 0:00:38 396500 -- (-1567.117) (-1569.532) (-1568.936) [-1567.807] * (-1570.294) [-1567.886] (-1565.467) (-1565.383) -- 0:00:38 397000 -- (-1565.779) [-1570.727] (-1569.616) (-1566.807) * (-1566.215) (-1565.261) (-1564.949) [-1565.218] -- 0:00:37 397500 -- [-1565.415] (-1572.716) (-1567.516) (-1566.187) * [-1567.055] (-1566.212) (-1566.604) (-1568.122) -- 0:00:37 398000 -- [-1566.512] (-1568.697) (-1565.912) (-1566.034) * [-1567.049] (-1566.433) (-1564.970) (-1565.820) -- 0:00:37 398500 -- (-1568.411) [-1567.694] (-1567.536) (-1568.250) * [-1565.768] (-1568.118) (-1564.809) (-1568.191) -- 0:00:37 399000 -- (-1566.302) [-1566.576] (-1569.780) (-1568.540) * (-1567.087) (-1565.645) (-1565.886) [-1567.881] -- 0:00:39 399500 -- [-1566.407] (-1566.832) (-1570.168) (-1569.161) * (-1570.234) [-1564.938] (-1564.639) (-1567.530) -- 0:00:39 400000 -- (-1566.022) (-1566.500) [-1568.896] (-1567.103) * [-1565.831] (-1566.049) (-1568.919) (-1567.432) -- 0:00:39 Average standard deviation of split frequencies: 0.009689 400500 -- (-1566.802) (-1566.571) (-1565.124) [-1566.672] * (-1567.177) (-1568.267) (-1566.491) [-1565.382] -- 0:00:38 401000 -- (-1566.465) (-1567.862) [-1565.016] (-1566.018) * (-1567.033) [-1568.208] (-1569.163) (-1565.189) -- 0:00:38 401500 -- (-1565.859) (-1574.329) (-1566.061) [-1566.276] * (-1565.323) [-1568.643] (-1566.497) (-1567.718) -- 0:00:38 402000 -- (-1569.691) (-1571.249) [-1565.982] (-1568.192) * [-1565.447] (-1568.462) (-1565.656) (-1566.843) -- 0:00:38 402500 -- [-1568.794] (-1569.450) (-1567.610) (-1567.561) * (-1567.417) [-1566.248] (-1567.398) (-1566.869) -- 0:00:38 403000 -- (-1566.547) [-1567.935] (-1568.275) (-1565.865) * (-1573.067) (-1565.956) [-1572.448] (-1567.864) -- 0:00:38 403500 -- (-1568.406) (-1570.414) [-1569.760] (-1567.134) * (-1565.548) (-1567.184) [-1568.740] (-1567.430) -- 0:00:38 404000 -- [-1565.359] (-1566.867) (-1566.620) (-1570.311) * [-1565.222] (-1569.642) (-1571.337) (-1567.495) -- 0:00:38 404500 -- [-1565.078] (-1565.961) (-1566.612) (-1567.534) * (-1567.300) (-1571.352) [-1569.787] (-1570.388) -- 0:00:38 405000 -- (-1565.189) [-1566.461] (-1567.941) (-1566.158) * (-1568.325) (-1568.405) (-1569.700) [-1568.390] -- 0:00:38 Average standard deviation of split frequencies: 0.010655 405500 -- (-1569.732) [-1567.587] (-1567.843) (-1565.095) * [-1566.349] (-1567.413) (-1573.543) (-1569.431) -- 0:00:38 406000 -- [-1565.624] (-1568.811) (-1569.211) (-1565.717) * (-1565.253) (-1569.492) [-1568.574] (-1568.650) -- 0:00:38 406500 -- (-1564.687) (-1567.217) (-1575.028) [-1567.106] * (-1567.493) [-1567.918] (-1569.425) (-1568.905) -- 0:00:37 407000 -- [-1565.281] (-1566.525) (-1567.238) (-1567.535) * (-1568.847) [-1565.974] (-1567.876) (-1568.294) -- 0:00:37 407500 -- [-1564.888] (-1568.275) (-1566.266) (-1567.304) * (-1570.663) [-1568.119] (-1564.757) (-1567.310) -- 0:00:37 408000 -- [-1566.897] (-1569.110) (-1568.656) (-1567.032) * (-1568.576) [-1567.134] (-1566.735) (-1570.577) -- 0:00:37 408500 -- (-1567.581) [-1570.202] (-1564.820) (-1566.797) * (-1566.223) [-1566.487] (-1566.143) (-1565.265) -- 0:00:37 409000 -- (-1569.907) [-1567.338] (-1566.192) (-1571.163) * [-1565.940] (-1565.456) (-1568.732) (-1566.468) -- 0:00:37 409500 -- (-1569.504) [-1566.346] (-1567.689) (-1568.626) * [-1566.675] (-1566.095) (-1567.465) (-1571.282) -- 0:00:37 410000 -- [-1568.084] (-1566.374) (-1568.077) (-1568.986) * [-1564.945] (-1567.552) (-1566.780) (-1569.420) -- 0:00:37 Average standard deviation of split frequencies: 0.009926 410500 -- (-1568.486) (-1566.855) (-1568.256) [-1565.927] * [-1564.944] (-1567.595) (-1566.811) (-1565.116) -- 0:00:37 411000 -- (-1567.361) (-1567.524) [-1566.008] (-1565.827) * (-1564.949) (-1569.289) (-1566.206) [-1565.964] -- 0:00:37 411500 -- (-1567.884) [-1566.958] (-1567.888) (-1566.870) * [-1564.886] (-1567.217) (-1565.370) (-1569.633) -- 0:00:37 412000 -- (-1567.805) (-1572.357) [-1566.968] (-1566.723) * (-1567.130) (-1566.858) (-1566.714) [-1567.688] -- 0:00:37 412500 -- (-1568.349) (-1571.628) [-1568.479] (-1566.985) * (-1566.672) [-1565.835] (-1567.213) (-1569.618) -- 0:00:37 413000 -- (-1567.560) (-1569.890) (-1568.260) [-1565.369] * (-1565.547) (-1566.633) (-1569.129) [-1567.931] -- 0:00:36 413500 -- (-1568.425) (-1567.047) (-1566.808) [-1565.002] * (-1566.116) [-1565.653] (-1569.407) (-1567.337) -- 0:00:36 414000 -- [-1565.814] (-1567.485) (-1572.647) (-1565.235) * (-1569.572) (-1565.762) (-1566.988) [-1565.063] -- 0:00:36 414500 -- (-1565.620) (-1570.807) (-1567.281) [-1565.946] * (-1568.474) [-1565.979] (-1566.070) (-1565.021) -- 0:00:36 415000 -- (-1566.689) (-1582.944) [-1565.481] (-1566.573) * (-1567.581) (-1565.909) [-1566.236] (-1565.351) -- 0:00:38 Average standard deviation of split frequencies: 0.009999 415500 -- [-1567.089] (-1567.245) (-1567.759) (-1565.109) * [-1566.456] (-1567.448) (-1566.444) (-1568.217) -- 0:00:37 416000 -- [-1567.023] (-1567.120) (-1567.231) (-1566.038) * (-1566.685) (-1566.996) (-1568.931) [-1566.104] -- 0:00:37 416500 -- (-1567.425) (-1568.058) (-1569.429) [-1567.375] * [-1565.244] (-1567.177) (-1565.949) (-1567.054) -- 0:00:37 417000 -- (-1566.653) (-1567.355) [-1567.873] (-1566.642) * (-1566.372) (-1567.338) [-1566.657] (-1569.201) -- 0:00:37 417500 -- [-1566.694] (-1568.843) (-1567.610) (-1566.971) * (-1566.568) (-1567.062) (-1566.849) [-1567.847] -- 0:00:37 418000 -- (-1566.452) [-1567.700] (-1566.414) (-1566.242) * [-1565.735] (-1567.009) (-1570.103) (-1567.582) -- 0:00:37 418500 -- (-1566.399) (-1568.992) (-1566.301) [-1567.062] * [-1565.790] (-1567.495) (-1566.513) (-1566.877) -- 0:00:37 419000 -- [-1565.959] (-1566.237) (-1566.187) (-1568.975) * (-1565.600) (-1566.652) [-1566.747] (-1566.328) -- 0:00:37 419500 -- (-1566.464) (-1569.247) [-1565.349] (-1567.171) * [-1565.945] (-1566.381) (-1568.880) (-1567.467) -- 0:00:37 420000 -- [-1568.788] (-1570.993) (-1566.301) (-1566.459) * [-1566.668] (-1567.234) (-1566.622) (-1566.925) -- 0:00:37 Average standard deviation of split frequencies: 0.009756 420500 -- [-1569.621] (-1569.823) (-1567.246) (-1565.362) * [-1566.250] (-1570.140) (-1565.103) (-1570.295) -- 0:00:37 421000 -- (-1566.313) [-1568.187] (-1568.777) (-1567.302) * (-1567.454) [-1565.614] (-1565.374) (-1571.392) -- 0:00:37 421500 -- (-1569.831) [-1569.386] (-1567.881) (-1565.687) * [-1568.191] (-1566.297) (-1566.569) (-1565.637) -- 0:00:37 422000 -- (-1574.962) (-1566.310) [-1565.669] (-1566.175) * (-1568.084) (-1567.842) (-1572.492) [-1566.700] -- 0:00:36 422500 -- [-1571.064] (-1567.881) (-1567.662) (-1565.987) * (-1567.156) (-1569.924) [-1571.956] (-1566.713) -- 0:00:36 423000 -- (-1568.358) [-1569.248] (-1569.099) (-1566.782) * (-1567.313) (-1567.411) (-1567.456) [-1568.980] -- 0:00:36 423500 -- (-1567.706) (-1566.687) (-1571.671) [-1568.624] * (-1565.682) (-1571.708) (-1567.018) [-1566.628] -- 0:00:36 424000 -- (-1566.918) (-1568.176) (-1571.788) [-1568.247] * (-1568.015) (-1566.751) [-1566.426] (-1567.018) -- 0:00:36 424500 -- (-1565.542) [-1567.350] (-1566.853) (-1566.405) * (-1565.734) (-1565.680) [-1565.925] (-1565.299) -- 0:00:36 425000 -- [-1566.424] (-1569.260) (-1565.359) (-1567.797) * (-1567.467) [-1565.699] (-1566.515) (-1565.743) -- 0:00:36 Average standard deviation of split frequencies: 0.010089 425500 -- (-1567.851) (-1575.810) (-1564.895) [-1566.278] * (-1567.993) [-1565.516] (-1566.714) (-1565.401) -- 0:00:36 426000 -- (-1567.630) (-1568.731) [-1566.423] (-1568.871) * (-1568.371) (-1565.516) (-1568.558) [-1568.505] -- 0:00:36 426500 -- (-1565.601) (-1569.937) [-1566.336] (-1568.651) * (-1568.646) (-1565.311) [-1570.171] (-1568.878) -- 0:00:36 427000 -- (-1570.516) (-1567.437) (-1566.127) [-1565.954] * (-1566.810) (-1566.612) [-1566.595] (-1566.612) -- 0:00:36 427500 -- [-1565.532] (-1566.269) (-1569.524) (-1565.965) * (-1567.252) (-1568.330) (-1565.161) [-1566.273] -- 0:00:36 428000 -- (-1566.551) (-1568.273) (-1570.908) [-1565.823] * (-1568.294) (-1569.863) (-1564.992) [-1566.081] -- 0:00:36 428500 -- [-1565.200] (-1565.351) (-1565.444) (-1564.947) * (-1568.933) (-1568.192) [-1565.879] (-1566.067) -- 0:00:36 429000 -- (-1565.147) (-1567.347) [-1565.816] (-1565.928) * (-1566.895) (-1568.283) (-1565.085) [-1567.038] -- 0:00:35 429500 -- (-1566.246) [-1567.657] (-1567.272) (-1566.076) * (-1567.338) (-1567.992) (-1565.722) [-1565.913] -- 0:00:35 430000 -- (-1567.853) (-1565.396) (-1567.422) [-1565.911] * [-1566.489] (-1567.684) (-1566.247) (-1568.206) -- 0:00:35 Average standard deviation of split frequencies: 0.009723 430500 -- (-1567.490) (-1570.839) (-1565.926) [-1569.749] * [-1565.338] (-1571.131) (-1565.988) (-1569.575) -- 0:00:35 431000 -- (-1567.268) (-1567.376) [-1566.174] (-1565.021) * (-1565.533) (-1570.102) (-1567.160) [-1564.933] -- 0:00:36 431500 -- (-1566.158) [-1567.524] (-1567.320) (-1565.635) * (-1567.637) [-1569.416] (-1570.668) (-1565.621) -- 0:00:36 432000 -- [-1566.582] (-1569.929) (-1565.820) (-1568.019) * [-1567.200] (-1569.915) (-1567.618) (-1566.241) -- 0:00:36 432500 -- (-1565.446) [-1567.215] (-1569.026) (-1569.916) * (-1566.151) [-1566.146] (-1568.434) (-1567.179) -- 0:00:36 433000 -- (-1567.522) [-1566.844] (-1565.997) (-1565.445) * (-1566.459) [-1568.962] (-1567.590) (-1566.876) -- 0:00:36 433500 -- (-1566.452) (-1565.505) [-1566.013] (-1567.792) * (-1567.090) [-1569.319] (-1565.777) (-1568.879) -- 0:00:36 434000 -- (-1566.286) (-1565.886) [-1567.295] (-1568.976) * (-1571.598) (-1565.839) (-1567.661) [-1567.067] -- 0:00:36 434500 -- [-1565.903] (-1565.622) (-1568.171) (-1567.841) * (-1565.943) (-1565.983) (-1570.585) [-1565.296] -- 0:00:36 435000 -- (-1566.121) (-1568.387) [-1566.994] (-1566.654) * [-1569.616] (-1565.085) (-1570.120) (-1565.296) -- 0:00:36 Average standard deviation of split frequencies: 0.010240 435500 -- (-1573.063) (-1565.956) [-1568.101] (-1567.163) * (-1566.778) (-1565.582) [-1569.498] (-1565.903) -- 0:00:36 436000 -- (-1571.636) (-1565.606) (-1567.546) [-1569.182] * (-1567.924) (-1566.429) [-1567.982] (-1564.913) -- 0:00:36 436500 -- (-1572.116) (-1565.545) [-1570.958] (-1567.125) * (-1569.143) [-1567.216] (-1568.255) (-1567.570) -- 0:00:36 437000 -- (-1571.116) (-1566.566) (-1565.190) [-1567.057] * (-1565.258) (-1566.939) [-1568.043] (-1566.599) -- 0:00:36 437500 -- (-1569.639) (-1567.851) (-1565.466) [-1566.176] * [-1564.663] (-1568.779) (-1566.549) (-1565.030) -- 0:00:36 438000 -- [-1569.128] (-1567.508) (-1568.784) (-1567.437) * (-1565.233) [-1566.451] (-1565.897) (-1565.640) -- 0:00:35 438500 -- [-1566.980] (-1565.886) (-1569.450) (-1567.437) * [-1565.845] (-1567.320) (-1568.032) (-1570.105) -- 0:00:35 439000 -- (-1566.367) (-1568.387) [-1569.548] (-1567.385) * (-1567.110) (-1566.130) (-1570.097) [-1568.855] -- 0:00:35 439500 -- (-1569.638) (-1571.903) [-1565.045] (-1569.100) * (-1570.154) (-1567.129) [-1567.597] (-1567.068) -- 0:00:35 440000 -- (-1567.307) [-1566.055] (-1565.339) (-1570.923) * [-1565.939] (-1567.865) (-1566.137) (-1566.290) -- 0:00:35 Average standard deviation of split frequencies: 0.010194 440500 -- [-1565.675] (-1565.888) (-1565.737) (-1567.343) * (-1565.322) (-1566.945) (-1569.482) [-1565.587] -- 0:00:35 441000 -- (-1566.723) [-1565.469] (-1566.439) (-1565.784) * (-1565.109) (-1571.062) (-1566.864) [-1565.416] -- 0:00:35 441500 -- (-1567.765) (-1567.275) (-1566.292) [-1566.782] * (-1567.407) (-1568.360) (-1566.566) [-1568.801] -- 0:00:35 442000 -- [-1564.902] (-1567.704) (-1568.117) (-1565.204) * (-1567.041) (-1567.427) (-1566.654) [-1573.068] -- 0:00:35 442500 -- [-1567.226] (-1565.765) (-1565.547) (-1565.150) * (-1565.841) (-1566.886) (-1566.564) [-1569.943] -- 0:00:35 443000 -- (-1566.862) (-1564.936) [-1566.649] (-1565.855) * [-1565.529] (-1569.324) (-1566.602) (-1568.455) -- 0:00:35 443500 -- (-1567.079) (-1571.373) [-1568.288] (-1566.571) * (-1567.666) [-1569.041] (-1566.168) (-1568.850) -- 0:00:35 444000 -- (-1568.345) (-1566.264) (-1569.195) [-1566.511] * [-1568.208] (-1569.076) (-1567.093) (-1567.603) -- 0:00:35 444500 -- (-1568.392) (-1565.205) [-1567.018] (-1568.112) * [-1566.606] (-1567.175) (-1567.724) (-1565.624) -- 0:00:34 445000 -- (-1570.148) (-1566.212) [-1567.190] (-1568.717) * [-1566.748] (-1571.430) (-1568.911) (-1565.727) -- 0:00:34 Average standard deviation of split frequencies: 0.010383 445500 -- (-1569.208) (-1565.942) [-1566.251] (-1568.950) * [-1566.574] (-1564.966) (-1566.099) (-1566.890) -- 0:00:34 446000 -- [-1571.590] (-1566.494) (-1566.302) (-1570.061) * (-1566.686) [-1565.644] (-1565.753) (-1566.241) -- 0:00:34 446500 -- (-1567.529) (-1566.874) (-1566.366) [-1565.589] * (-1567.498) (-1566.200) (-1566.240) [-1565.220] -- 0:00:35 447000 -- (-1566.258) (-1566.576) (-1566.368) [-1565.560] * (-1566.412) [-1566.671] (-1569.583) (-1565.842) -- 0:00:35 447500 -- [-1567.797] (-1569.250) (-1566.368) (-1565.121) * (-1565.891) [-1565.884] (-1569.472) (-1566.318) -- 0:00:35 448000 -- [-1568.979] (-1566.429) (-1566.572) (-1565.992) * (-1566.835) (-1567.002) (-1566.264) [-1565.746] -- 0:00:35 448500 --