--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 12:45:30 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/mtb12/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -687.53 -691.60
2 -687.52 -690.98
--------------------------------------
TOTAL -687.52 -691.34
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889151 0.087381 0.358969 1.441778 0.858068 1351.56 1426.28 1.000
r(A<->C){all} 0.169986 0.018358 0.000031 0.428662 0.137168 287.30 309.40 1.001
r(A<->G){all} 0.177551 0.021377 0.000017 0.462466 0.139982 231.20 269.89 1.000
r(A<->T){all} 0.167585 0.019554 0.000043 0.439143 0.128636 212.45 213.85 1.000
r(C<->G){all} 0.147261 0.016567 0.000013 0.402725 0.114249 198.70 253.01 1.001
r(C<->T){all} 0.166514 0.019161 0.000176 0.442858 0.130210 155.03 315.13 1.001
r(G<->T){all} 0.171103 0.019170 0.000044 0.458149 0.136513 196.37 223.48 1.001
pi(A){all} 0.200083 0.000314 0.165987 0.234303 0.199702 1212.01 1239.59 1.000
pi(C){all} 0.293563 0.000392 0.256174 0.333487 0.292839 1346.12 1370.19 1.000
pi(G){all} 0.298446 0.000419 0.256684 0.337835 0.297748 1236.86 1244.34 1.000
pi(T){all} 0.207908 0.000313 0.172985 0.242167 0.207543 1156.50 1184.44 1.000
alpha{1,2} 0.409648 0.238435 0.000160 1.370729 0.233874 1219.89 1267.76 1.000
alpha{3} 0.462465 0.220261 0.000600 1.389817 0.325699 1140.89 1252.61 1.000
pinvar{all} 0.996886 0.000014 0.989630 0.999998 0.998093 1154.48 1198.80 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -658.012176
Model 2: PositiveSelection -658.01213
Model 0: one-ratio -658.01244
Model 7: beta -658.01213
Model 8: beta&w>1 -658.01213
Model 0 vs 1 5.280000000311702E-4
Model 2 vs 1 9.1999999995096E-5
Model 8 vs 7 0.0
>C1
MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
WVLSRHSAMELLQAAGR
>C2
MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
WVLSRHSAMELLQAAGR
>C3
MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
WVLSRHSAMELLQAAGR
>C4
MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
WVLSRHSAMELLQAAGR
>C5
MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
WVLSRHSAMELLQAAGR
>C6
MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
WVLSRHSAMELLQAAGR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=167
C1 MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
C2 MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
C3 MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
C4 MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
C5 MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
C6 MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
**************************************************
C1 PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
C2 PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
C3 PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
C4 PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
C5 PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
C6 PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
**************************************************
C1 AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
C2 AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
C3 AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
C4 AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
C5 AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
C6 AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
**************************************************
C1 WVLSRHSAMELLQAAGR
C2 WVLSRHSAMELLQAAGR
C3 WVLSRHSAMELLQAAGR
C4 WVLSRHSAMELLQAAGR
C5 WVLSRHSAMELLQAAGR
C6 WVLSRHSAMELLQAAGR
*****************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 167 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 167 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5010]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5010]--->[5010]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.471 Mb, Max= 30.704 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
C2 MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
C3 MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
C4 MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
C5 MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
C6 MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
**************************************************
C1 PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
C2 PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
C3 PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
C4 PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
C5 PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
C6 PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
**************************************************
C1 AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
C2 AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
C3 AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
C4 AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
C5 AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
C6 AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
**************************************************
C1 WVLSRHSAMELLQAAGR
C2 WVLSRHSAMELLQAAGR
C3 WVLSRHSAMELLQAAGR
C4 WVLSRHSAMELLQAAGR
C5 WVLSRHSAMELLQAAGR
C6 WVLSRHSAMELLQAAGR
*****************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC
C2 ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC
C3 ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC
C4 ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC
C5 ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC
C6 ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC
**************************************************
C1 CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT
C2 CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT
C3 CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT
C4 CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT
C5 CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT
C6 CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT
**************************************************
C1 CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA
C2 CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA
C3 CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA
C4 CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA
C5 CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA
C6 CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA
**************************************************
C1 CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA
C2 CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA
C3 CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA
C4 CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA
C5 CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA
C6 CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA
**************************************************
C1 AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG
C2 AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG
C3 AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG
C4 AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG
C5 AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG
C6 AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG
**************************************************
C1 GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT
C2 GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT
C3 GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT
C4 GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT
C5 GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT
C6 GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT
**************************************************
C1 GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG
C2 GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG
C3 GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG
C4 GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG
C5 GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG
C6 GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG
**************************************************
C1 ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA
C2 ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA
C3 ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA
C4 ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA
C5 ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA
C6 ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA
**************************************************
C1 AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC
C2 AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC
C3 AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC
C4 AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC
C5 AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC
C6 AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC
**************************************************
C1 TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG
C2 TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG
C3 TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG
C4 TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG
C5 TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG
C6 TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG
**************************************************
C1 T
C2 T
C3 T
C4 T
C5 T
C6 T
*
>C1
ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC
CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT
CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA
CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA
AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG
GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT
GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG
ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA
AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC
TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG
T
>C2
ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC
CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT
CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA
CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA
AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG
GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT
GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG
ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA
AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC
TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG
T
>C3
ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC
CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT
CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA
CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA
AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG
GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT
GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG
ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA
AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC
TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG
T
>C4
ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC
CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT
CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA
CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA
AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG
GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT
GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG
ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA
AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC
TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG
T
>C5
ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC
CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT
CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA
CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA
AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG
GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT
GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG
ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA
AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC
TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG
T
>C6
ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC
CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT
CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA
CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA
AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG
GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT
GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG
ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA
AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC
TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG
T
>C1
MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
WVLSRHSAMELLQAAGR
>C2
MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
WVLSRHSAMELLQAAGR
>C3
MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
WVLSRHSAMELLQAAGR
>C4
MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
WVLSRHSAMELLQAAGR
>C5
MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
WVLSRHSAMELLQAAGR
>C6
MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
WVLSRHSAMELLQAAGR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 501 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579783454
Setting output file names to "/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 791931465
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9275462235
Seed = 109632827
Swapseed = 1579783454
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1121.262018 -- -24.965149
Chain 2 -- -1121.262018 -- -24.965149
Chain 3 -- -1121.261954 -- -24.965149
Chain 4 -- -1121.262018 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1121.262018 -- -24.965149
Chain 2 -- -1121.262018 -- -24.965149
Chain 3 -- -1121.262018 -- -24.965149
Chain 4 -- -1121.262018 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1121.262] (-1121.262) (-1121.262) (-1121.262) * [-1121.262] (-1121.262) (-1121.262) (-1121.262)
500 -- (-706.915) (-700.705) [-698.383] (-697.440) * [-697.753] (-699.158) (-693.494) (-697.356) -- 0:33:19
1000 -- (-697.601) (-700.079) (-701.694) [-698.953] * (-696.356) [-699.355] (-693.486) (-704.088) -- 0:16:39
1500 -- (-698.809) (-698.533) [-695.010] (-700.106) * (-701.059) (-700.898) [-698.178] (-697.627) -- 0:11:05
2000 -- (-698.576) (-699.634) (-695.153) [-697.794] * (-700.512) [-696.102] (-692.696) (-697.721) -- 0:08:19
2500 -- (-692.208) (-695.524) (-705.112) [-699.542] * [-697.340] (-696.405) (-694.473) (-698.623) -- 0:06:39
3000 -- [-693.757] (-692.181) (-709.545) (-705.310) * (-695.729) (-697.802) [-692.286] (-693.579) -- 0:05:32
3500 -- [-698.516] (-693.917) (-699.464) (-700.121) * (-694.485) (-701.104) [-696.449] (-695.987) -- 0:04:44
4000 -- (-700.105) (-693.926) (-696.879) [-696.828] * (-693.521) (-694.395) (-694.174) [-698.804] -- 0:04:09
4500 -- (-694.415) [-703.464] (-693.992) (-706.067) * (-698.055) (-701.149) [-694.958] (-689.912) -- 0:03:41
5000 -- (-700.190) [-701.605] (-705.362) (-699.847) * (-696.561) [-691.510] (-698.162) (-696.340) -- 0:03:19
Average standard deviation of split frequencies: 0.057140
5500 -- (-703.634) [-697.193] (-698.797) (-701.929) * (-700.798) (-700.186) [-695.657] (-695.994) -- 0:03:00
6000 -- (-698.935) (-691.918) (-696.306) [-691.209] * (-696.057) [-697.548] (-696.098) (-691.726) -- 0:02:45
6500 -- [-700.355] (-691.967) (-706.104) (-695.739) * (-691.493) (-707.395) (-691.943) [-695.501] -- 0:02:32
7000 -- [-695.336] (-694.629) (-699.604) (-693.108) * (-714.135) [-696.789] (-692.798) (-702.549) -- 0:02:21
7500 -- (-694.736) [-691.808] (-701.842) (-698.122) * (-698.466) [-692.371] (-700.877) (-698.927) -- 0:02:12
8000 -- (-700.424) (-702.827) [-697.293] (-702.558) * (-695.434) (-698.143) (-692.380) [-696.027] -- 0:02:04
8500 -- (-697.753) [-698.174] (-699.845) (-703.550) * (-704.413) (-697.436) (-695.302) [-695.828] -- 0:01:56
9000 -- (-694.778) (-702.626) [-693.237] (-704.057) * (-696.025) (-694.231) [-693.357] (-698.446) -- 0:01:50
9500 -- [-691.792] (-697.491) (-694.940) (-693.976) * [-695.917] (-696.347) (-691.900) (-704.678) -- 0:01:44
10000 -- (-701.858) [-694.848] (-707.755) (-702.090) * (-702.321) (-694.708) (-698.360) [-692.806] -- 0:01:39
Average standard deviation of split frequencies: 0.065239
10500 -- (-695.220) (-696.045) [-688.802] (-691.941) * (-700.277) (-701.280) (-701.654) [-696.761] -- 0:01:34
11000 -- (-700.087) [-693.904] (-688.673) (-697.309) * (-691.246) (-701.806) (-694.824) [-699.084] -- 0:01:29
11500 -- (-697.615) [-692.350] (-690.295) (-695.332) * (-696.963) (-706.332) (-699.369) [-700.347] -- 0:01:25
12000 -- (-708.078) (-701.634) [-689.723] (-699.853) * (-696.842) [-691.575] (-697.693) (-702.817) -- 0:01:22
12500 -- (-698.400) (-712.400) (-693.266) [-693.118] * (-694.240) (-690.561) (-693.699) [-694.958] -- 0:01:19
13000 -- (-703.261) (-698.446) (-687.165) [-700.027] * (-694.174) (-689.932) [-693.161] (-698.691) -- 0:01:15
13500 -- (-705.436) [-686.164] (-687.907) (-696.353) * [-700.482] (-689.217) (-698.391) (-695.730) -- 0:01:13
14000 -- [-689.307] (-687.456) (-688.303) (-709.354) * [-694.427] (-686.878) (-701.745) (-694.162) -- 0:01:10
14500 -- (-689.349) (-687.065) [-687.746] (-693.897) * (-704.554) (-689.370) [-696.620] (-698.021) -- 0:01:07
15000 -- [-689.141] (-689.049) (-688.849) (-696.208) * [-692.885] (-688.003) (-699.981) (-699.873) -- 0:01:05
Average standard deviation of split frequencies: 0.078076
15500 -- (-689.989) [-689.267] (-689.159) (-696.835) * (-693.666) (-688.223) (-704.667) [-698.341] -- 0:01:03
16000 -- (-692.973) [-687.031] (-687.217) (-702.545) * (-693.936) [-688.418] (-704.565) (-691.269) -- 0:01:01
16500 -- (-687.864) (-687.373) [-689.639] (-700.615) * (-700.301) (-688.797) (-713.521) [-697.012] -- 0:01:59
17000 -- (-688.284) [-689.705] (-689.007) (-703.159) * (-694.534) (-687.571) (-695.098) [-695.893] -- 0:01:55
17500 -- [-687.119] (-690.345) (-687.823) (-695.515) * (-693.772) (-688.928) (-699.927) [-699.875] -- 0:01:52
18000 -- [-686.098] (-690.719) (-691.589) (-691.867) * (-694.162) (-686.490) [-696.567] (-700.297) -- 0:01:49
18500 -- (-689.759) [-688.078] (-689.576) (-697.318) * (-700.301) [-687.606] (-698.979) (-704.275) -- 0:01:46
19000 -- (-689.727) (-687.007) [-688.894] (-698.010) * (-692.603) (-686.757) (-700.873) [-692.588] -- 0:01:43
19500 -- [-687.910] (-688.687) (-686.817) (-706.247) * (-697.509) (-686.583) [-695.773] (-698.093) -- 0:01:40
20000 -- (-689.060) (-690.854) [-686.861] (-700.599) * (-699.455) (-686.446) [-695.614] (-695.672) -- 0:01:38
Average standard deviation of split frequencies: 0.049421
20500 -- [-688.474] (-688.114) (-687.864) (-699.182) * (-696.443) (-686.738) (-696.379) [-696.908] -- 0:01:35
21000 -- (-690.005) (-686.354) [-688.881] (-694.918) * [-695.207] (-690.667) (-695.999) (-695.508) -- 0:01:33
21500 -- (-687.716) (-686.068) [-689.410] (-702.287) * (-696.567) (-687.483) [-702.971] (-691.691) -- 0:01:31
22000 -- (-687.868) [-686.335] (-690.777) (-705.436) * (-700.349) [-687.400] (-694.374) (-695.309) -- 0:01:28
22500 -- (-688.690) (-688.312) [-688.270] (-707.974) * (-700.586) [-687.414] (-704.724) (-694.826) -- 0:01:26
23000 -- (-687.296) [-688.385] (-689.361) (-698.701) * (-698.487) (-689.161) (-695.492) [-694.466] -- 0:01:24
23500 -- [-687.817] (-689.287) (-688.599) (-697.554) * [-694.713] (-690.031) (-704.012) (-692.839) -- 0:01:23
24000 -- (-690.452) [-687.971] (-690.650) (-696.228) * (-698.558) (-688.971) (-703.034) [-696.519] -- 0:01:21
24500 -- (-688.215) [-689.192] (-690.931) (-708.889) * [-702.994] (-688.398) (-687.490) (-697.734) -- 0:01:19
25000 -- (-687.800) [-687.271] (-687.419) (-703.195) * (-704.067) (-687.572) [-687.546] (-695.740) -- 0:01:18
Average standard deviation of split frequencies: 0.041780
25500 -- [-686.312] (-688.246) (-688.307) (-687.893) * (-700.972) (-688.091) [-689.257] (-699.563) -- 0:01:16
26000 -- (-688.328) (-687.938) (-689.781) [-689.062] * [-698.203] (-687.654) (-686.292) (-694.811) -- 0:01:14
26500 -- (-688.773) [-689.091] (-690.011) (-693.480) * (-695.613) [-686.860] (-687.753) (-696.166) -- 0:01:13
27000 -- (-689.746) [-690.689] (-688.968) (-692.862) * [-692.760] (-689.414) (-686.997) (-701.919) -- 0:01:12
27500 -- (-689.982) [-689.220] (-688.342) (-695.182) * [-702.102] (-688.480) (-688.159) (-698.956) -- 0:01:10
28000 -- (-690.895) (-688.245) (-688.525) [-689.884] * (-703.474) (-690.565) (-687.569) [-695.785] -- 0:01:09
28500 -- (-691.209) [-687.240] (-687.754) (-688.090) * [-702.529] (-689.662) (-687.497) (-697.059) -- 0:01:08
29000 -- (-687.366) [-687.380] (-689.130) (-689.110) * [-695.334] (-693.544) (-687.387) (-699.641) -- 0:01:06
29500 -- (-688.857) (-688.049) [-689.413] (-690.443) * (-705.327) (-689.134) (-687.184) [-697.861] -- 0:01:05
30000 -- [-689.104] (-688.206) (-686.905) (-689.202) * [-696.868] (-688.453) (-687.894) (-700.741) -- 0:01:04
Average standard deviation of split frequencies: 0.043041
30500 -- (-687.100) (-687.702) (-686.202) [-688.163] * (-694.675) (-688.582) (-691.047) [-696.006] -- 0:01:03
31000 -- (-687.534) (-687.254) (-687.092) [-686.427] * [-695.859] (-687.131) (-687.229) (-702.467) -- 0:01:02
31500 -- [-688.227] (-689.034) (-686.442) (-690.255) * [-692.900] (-687.343) (-687.400) (-695.628) -- 0:01:01
32000 -- (-692.727) (-691.798) (-688.970) [-687.783] * (-697.303) (-686.972) [-687.968] (-699.448) -- 0:01:00
32500 -- (-688.582) [-689.978] (-688.065) (-687.530) * [-693.331] (-687.659) (-687.073) (-696.506) -- 0:00:59
33000 -- (-686.703) [-686.300] (-688.698) (-687.499) * (-691.405) [-686.437] (-689.680) (-701.402) -- 0:01:27
33500 -- (-689.853) [-687.370] (-687.159) (-688.012) * (-692.620) (-686.003) (-689.408) [-694.755] -- 0:01:26
34000 -- (-686.682) [-691.860] (-689.977) (-690.478) * (-697.586) (-687.588) [-686.977] (-696.148) -- 0:01:25
34500 -- (-687.731) (-690.359) [-689.493] (-692.631) * [-689.904] (-686.568) (-688.641) (-702.495) -- 0:01:23
35000 -- [-687.757] (-689.592) (-689.023) (-688.504) * (-699.691) [-688.127] (-690.592) (-695.860) -- 0:01:22
Average standard deviation of split frequencies: 0.034662
35500 -- (-687.364) (-688.552) [-687.852] (-694.451) * [-695.978] (-688.822) (-690.631) (-699.800) -- 0:01:21
36000 -- (-689.263) (-691.290) [-687.748] (-689.135) * (-701.840) [-686.216] (-689.697) (-705.395) -- 0:01:20
36500 -- (-688.064) (-687.718) [-690.001] (-689.535) * (-702.541) (-688.098) (-688.238) [-699.009] -- 0:01:19
37000 -- (-686.700) [-686.230] (-687.225) (-687.638) * (-699.986) (-691.650) (-690.656) [-698.103] -- 0:01:18
37500 -- (-686.279) (-688.260) (-686.200) [-692.989] * (-699.278) (-692.100) (-688.547) [-698.579] -- 0:01:17
38000 -- [-687.939] (-687.837) (-691.310) (-686.549) * [-693.004] (-689.768) (-688.448) (-699.014) -- 0:01:15
38500 -- (-687.103) [-686.756] (-692.351) (-690.530) * (-692.322) (-689.810) (-686.836) [-696.105] -- 0:01:14
39000 -- (-687.174) [-690.208] (-691.021) (-691.011) * (-705.180) (-687.890) (-686.164) [-694.975] -- 0:01:13
39500 -- [-689.177] (-689.041) (-691.490) (-690.104) * [-697.088] (-689.285) (-687.742) (-697.950) -- 0:01:12
40000 -- [-689.177] (-690.161) (-689.348) (-690.639) * (-702.613) (-686.390) (-686.416) [-692.237] -- 0:01:12
Average standard deviation of split frequencies: 0.036708
40500 -- [-688.090] (-689.369) (-689.221) (-689.262) * (-691.569) (-689.563) (-688.698) [-690.864] -- 0:01:11
41000 -- (-689.872) [-689.232] (-688.767) (-688.099) * (-702.127) (-686.987) (-688.884) [-699.414] -- 0:01:10
41500 -- (-687.880) [-689.027] (-689.801) (-687.051) * (-693.839) (-686.909) (-688.198) [-695.354] -- 0:01:09
42000 -- (-689.960) [-688.295] (-691.567) (-688.111) * (-700.435) [-686.792] (-687.766) (-695.602) -- 0:01:08
42500 -- (-688.548) [-687.520] (-689.414) (-687.841) * (-708.663) (-688.554) [-686.901] (-693.245) -- 0:01:07
43000 -- (-690.599) (-687.468) (-688.467) [-687.652] * (-697.785) [-688.711] (-688.445) (-702.136) -- 0:01:06
43500 -- (-690.370) [-690.991] (-687.579) (-687.362) * [-704.104] (-688.037) (-687.935) (-698.597) -- 0:01:05
44000 -- (-688.057) (-692.064) (-693.206) [-687.069] * (-693.664) [-690.165] (-687.159) (-697.840) -- 0:01:05
44500 -- [-689.257] (-687.387) (-694.029) (-687.166) * (-699.201) [-687.805] (-686.665) (-700.039) -- 0:01:04
45000 -- (-690.811) (-688.057) (-689.195) [-690.550] * (-698.345) [-686.904] (-689.633) (-702.569) -- 0:01:03
Average standard deviation of split frequencies: 0.036600
45500 -- (-687.703) (-689.511) (-691.176) [-688.308] * [-698.211] (-688.393) (-686.256) (-692.041) -- 0:01:02
46000 -- (-689.996) (-689.890) (-688.900) [-687.455] * (-694.452) (-689.847) [-686.086] (-692.110) -- 0:01:02
46500 -- (-692.984) (-692.842) [-689.535] (-687.040) * (-703.954) (-689.046) [-690.161] (-696.095) -- 0:01:01
47000 -- (-695.020) (-688.705) [-688.676] (-690.379) * (-696.896) (-689.023) [-686.896] (-696.781) -- 0:01:00
47500 -- (-687.769) (-687.908) [-689.135] (-686.936) * (-692.628) (-686.515) [-689.437] (-703.996) -- 0:01:00
48000 -- (-688.664) (-690.256) [-686.522] (-686.951) * (-696.132) (-687.440) (-688.681) [-694.430] -- 0:01:19
48500 -- (-688.604) [-690.269] (-686.618) (-689.878) * (-697.624) (-691.018) [-689.307] (-686.559) -- 0:01:18
49000 -- (-692.123) (-694.734) (-687.069) [-688.061] * [-696.427] (-693.484) (-688.253) (-687.368) -- 0:01:17
49500 -- (-690.740) (-692.436) (-689.175) [-687.422] * [-705.293] (-694.484) (-688.304) (-687.517) -- 0:01:16
50000 -- [-687.873] (-688.517) (-691.103) (-687.296) * [-697.200] (-690.320) (-686.522) (-686.893) -- 0:01:16
Average standard deviation of split frequencies: 0.035444
50500 -- (-687.100) (-687.993) (-689.652) [-690.052] * (-694.922) [-691.940] (-687.604) (-686.493) -- 0:01:15
51000 -- [-688.794] (-687.986) (-686.853) (-687.246) * [-690.770] (-686.949) (-686.831) (-686.233) -- 0:01:14
51500 -- (-689.857) [-691.136] (-688.044) (-689.387) * (-699.107) (-692.025) (-688.333) [-687.541] -- 0:01:13
52000 -- (-688.320) (-692.520) [-687.033] (-687.949) * (-699.080) (-686.144) [-687.015] (-687.057) -- 0:01:12
52500 -- (-687.892) [-689.406] (-687.263) (-687.502) * [-692.174] (-687.535) (-688.119) (-686.772) -- 0:01:12
53000 -- [-688.017] (-688.373) (-689.148) (-688.260) * [-696.970] (-686.146) (-687.902) (-687.007) -- 0:01:11
53500 -- [-686.961] (-690.586) (-687.126) (-688.641) * (-696.327) [-686.235] (-687.188) (-688.647) -- 0:01:10
54000 -- (-688.403) (-689.007) (-687.822) [-690.804] * [-691.568] (-687.408) (-687.084) (-686.219) -- 0:01:10
54500 -- (-688.490) [-687.755] (-690.119) (-686.893) * (-696.172) (-686.477) (-687.358) [-687.296] -- 0:01:09
55000 -- (-693.400) (-687.286) (-691.022) [-689.625] * (-698.249) (-687.146) (-686.402) [-688.791] -- 0:01:08
Average standard deviation of split frequencies: 0.028461
55500 -- [-691.053] (-691.038) (-688.278) (-687.243) * [-695.444] (-687.626) (-689.232) (-686.287) -- 0:01:08
56000 -- (-688.922) (-692.033) [-688.283] (-689.360) * (-705.502) (-687.270) [-689.567] (-690.499) -- 0:01:07
56500 -- (-688.671) [-686.996] (-688.209) (-686.953) * (-714.229) (-692.384) [-687.644] (-687.557) -- 0:01:06
57000 -- (-687.913) (-688.315) (-687.790) [-689.978] * [-692.563] (-688.917) (-686.607) (-690.493) -- 0:01:06
57500 -- (-689.113) (-686.853) (-688.298) [-687.669] * (-688.955) (-691.532) (-686.096) [-687.776] -- 0:01:05
58000 -- (-687.670) (-687.008) [-688.745] (-690.901) * (-691.773) [-687.872] (-687.942) (-692.999) -- 0:01:04
58500 -- (-689.029) [-688.005] (-688.524) (-686.866) * (-687.307) (-686.725) [-688.577] (-686.629) -- 0:01:04
59000 -- (-689.183) (-689.507) [-689.056] (-690.963) * [-686.536] (-690.554) (-690.040) (-686.963) -- 0:01:03
59500 -- (-687.264) (-691.118) [-687.551] (-690.915) * (-687.940) [-688.497] (-693.128) (-686.990) -- 0:01:03
60000 -- (-688.344) [-686.025] (-687.127) (-689.790) * (-688.278) (-687.842) [-690.656] (-689.645) -- 0:01:02
Average standard deviation of split frequencies: 0.020448
60500 -- (-690.569) (-690.402) (-688.287) [-687.116] * (-690.190) (-689.120) (-688.514) [-687.125] -- 0:01:02
61000 -- [-689.493] (-690.332) (-689.448) (-687.213) * (-688.612) (-690.886) [-686.324] (-686.660) -- 0:01:01
61500 -- (-688.779) (-688.161) (-690.008) [-687.257] * (-688.110) (-689.700) (-688.003) [-687.597] -- 0:01:01
62000 -- (-687.285) (-687.976) (-689.477) [-688.235] * (-687.115) [-689.593] (-694.939) (-691.221) -- 0:01:00
62500 -- [-687.692] (-690.171) (-687.225) (-686.912) * (-686.695) (-687.161) (-693.040) [-688.247] -- 0:01:00
63000 -- (-688.037) [-689.659] (-687.003) (-688.829) * (-686.753) (-688.837) (-688.459) [-689.114] -- 0:00:59
63500 -- (-689.983) (-690.535) (-686.620) [-687.604] * (-686.330) [-689.361] (-686.373) (-690.116) -- 0:00:58
64000 -- (-687.759) (-687.209) [-691.539] (-687.331) * (-687.681) (-688.702) (-688.330) [-687.602] -- 0:00:58
64500 -- (-686.620) (-687.415) (-689.029) [-687.156] * (-690.014) (-686.960) (-688.567) [-691.405] -- 0:01:12
65000 -- (-689.505) (-689.378) (-688.242) [-687.103] * (-688.253) [-688.093] (-688.640) (-690.634) -- 0:01:11
Average standard deviation of split frequencies: 0.020747
65500 -- (-688.073) (-688.992) (-686.957) [-687.249] * (-688.151) (-688.141) (-690.194) [-691.471] -- 0:01:11
66000 -- (-689.260) (-691.433) [-688.113] (-690.835) * (-687.132) (-688.077) [-687.253] (-695.204) -- 0:01:10
66500 -- (-686.962) (-687.427) (-688.353) [-687.870] * [-689.333] (-689.133) (-693.913) (-692.170) -- 0:01:10
67000 -- (-692.418) [-691.568] (-688.999) (-687.583) * [-688.780] (-688.156) (-687.220) (-687.155) -- 0:01:09
67500 -- (-689.787) (-693.737) (-686.306) [-689.425] * [-688.574] (-688.546) (-686.903) (-688.767) -- 0:01:09
68000 -- (-688.262) [-687.585] (-688.351) (-690.548) * [-686.974] (-688.678) (-688.583) (-692.222) -- 0:01:08
68500 -- (-688.872) (-688.085) (-687.146) [-690.249] * (-687.567) (-688.456) (-686.629) [-687.397] -- 0:01:07
69000 -- (-688.096) [-686.778] (-686.667) (-688.589) * (-688.901) (-694.169) (-690.582) [-689.116] -- 0:01:07
69500 -- (-690.443) (-686.270) [-688.890] (-690.049) * (-689.281) (-687.934) [-688.581] (-691.147) -- 0:01:06
70000 -- (-691.431) (-689.688) (-689.745) [-689.106] * (-690.479) [-687.898] (-690.184) (-688.288) -- 0:01:06
Average standard deviation of split frequencies: 0.017471
70500 -- (-690.070) (-689.508) (-687.958) [-688.669] * (-688.680) (-686.933) [-687.362] (-688.148) -- 0:01:05
71000 -- [-690.606] (-687.678) (-687.179) (-689.914) * [-686.995] (-687.010) (-687.676) (-688.246) -- 0:01:05
71500 -- (-688.904) (-689.187) (-689.875) [-687.659] * (-687.153) (-687.002) (-686.215) [-686.608] -- 0:01:04
72000 -- [-688.092] (-687.271) (-688.849) (-688.054) * [-686.650] (-687.207) (-687.212) (-688.787) -- 0:01:04
72500 -- (-686.346) [-687.908] (-686.912) (-689.967) * (-687.647) (-689.221) [-688.379] (-687.758) -- 0:01:03
73000 -- (-691.344) (-686.723) (-690.825) [-686.553] * [-691.088] (-692.486) (-688.426) (-689.588) -- 0:01:03
73500 -- (-687.497) [-686.947] (-687.760) (-686.586) * (-687.931) (-693.046) [-691.503] (-686.943) -- 0:01:03
74000 -- (-686.899) (-688.442) [-688.386] (-689.857) * (-691.248) [-686.835] (-690.792) (-686.872) -- 0:01:02
74500 -- (-687.145) (-689.400) (-688.397) [-687.810] * [-687.287] (-689.599) (-687.478) (-687.222) -- 0:01:02
75000 -- (-686.833) (-689.787) (-688.435) [-689.056] * (-686.958) (-689.390) (-687.293) [-686.818] -- 0:01:01
Average standard deviation of split frequencies: 0.015817
75500 -- (-687.423) (-686.719) [-690.154] (-686.659) * (-692.790) [-691.183] (-687.508) (-686.571) -- 0:01:01
76000 -- (-689.714) [-687.942] (-686.775) (-688.684) * (-688.614) (-691.170) (-689.533) [-688.001] -- 0:01:00
76500 -- (-690.215) (-688.022) (-686.643) [-687.463] * [-687.074] (-690.017) (-687.632) (-690.407) -- 0:01:00
77000 -- (-688.072) (-686.258) (-690.062) [-687.125] * (-687.507) (-692.261) [-686.461] (-688.500) -- 0:00:59
77500 -- (-686.875) (-691.061) [-687.712] (-689.369) * (-687.265) (-692.102) [-690.914] (-692.560) -- 0:00:59
78000 -- (-686.546) [-689.861] (-687.258) (-693.050) * (-689.421) [-687.848] (-687.584) (-691.264) -- 0:00:59
78500 -- [-688.185] (-687.687) (-690.589) (-686.612) * (-691.175) (-686.736) [-687.466] (-689.582) -- 0:00:58
79000 -- (-690.677) (-686.698) (-688.513) [-689.175] * (-688.383) (-686.582) [-686.548] (-688.022) -- 0:00:58
79500 -- (-688.632) [-687.089] (-693.478) (-687.653) * (-688.654) (-686.965) (-687.270) [-688.211] -- 0:00:57
80000 -- (-690.020) [-686.507] (-687.801) (-686.692) * (-689.216) (-690.599) [-688.839] (-689.583) -- 0:00:57
Average standard deviation of split frequencies: 0.020300
80500 -- (-689.496) (-686.862) [-689.152] (-688.382) * [-692.884] (-686.452) (-688.379) (-691.171) -- 0:01:08
81000 -- (-690.259) (-689.481) [-691.314] (-687.583) * (-690.713) (-689.622) [-687.921] (-688.451) -- 0:01:08
81500 -- (-689.118) [-689.099] (-689.270) (-688.755) * [-687.743] (-691.419) (-688.106) (-687.556) -- 0:01:07
82000 -- (-690.633) [-686.575] (-691.725) (-687.029) * (-686.792) (-686.839) [-686.744] (-691.771) -- 0:01:07
82500 -- [-689.396] (-689.229) (-688.273) (-689.180) * (-687.209) (-693.545) (-687.519) [-688.198] -- 0:01:06
83000 -- (-688.087) [-691.127] (-689.521) (-688.124) * (-686.950) [-687.724] (-689.275) (-689.050) -- 0:01:06
83500 -- (-687.406) (-687.586) (-687.816) [-686.947] * [-686.436] (-687.180) (-687.991) (-688.057) -- 0:01:05
84000 -- (-690.534) [-688.440] (-687.531) (-688.700) * (-687.003) [-687.302] (-689.085) (-692.508) -- 0:01:05
84500 -- (-688.949) (-687.633) (-687.799) [-688.244] * (-686.457) (-691.058) [-686.359] (-688.835) -- 0:01:05
85000 -- (-689.078) [-686.874] (-691.520) (-688.679) * (-688.331) (-689.167) (-687.609) [-688.899] -- 0:01:04
Average standard deviation of split frequencies: 0.019459
85500 -- [-687.689] (-689.428) (-689.473) (-687.937) * (-688.662) [-688.393] (-686.278) (-687.819) -- 0:01:04
86000 -- (-686.911) [-691.087] (-687.613) (-689.091) * (-687.035) (-688.234) [-687.179] (-688.043) -- 0:01:03
86500 -- [-686.865] (-689.655) (-690.335) (-688.307) * (-687.242) (-688.628) [-687.902] (-689.490) -- 0:01:03
87000 -- (-688.722) [-686.253] (-690.412) (-689.979) * (-688.788) (-689.007) (-688.985) [-686.892] -- 0:01:02
87500 -- [-690.427] (-686.368) (-689.775) (-690.820) * [-687.199] (-688.024) (-688.268) (-687.966) -- 0:01:02
88000 -- [-690.620] (-687.443) (-692.710) (-690.960) * (-686.720) (-692.336) (-692.404) [-686.546] -- 0:01:02
88500 -- (-690.269) [-686.154] (-691.245) (-689.915) * [-687.411] (-688.260) (-688.912) (-687.932) -- 0:01:01
89000 -- (-686.108) (-686.538) (-688.090) [-687.621] * (-686.477) [-688.671] (-691.724) (-690.180) -- 0:01:01
89500 -- (-687.891) [-690.059] (-691.551) (-686.517) * [-686.566] (-688.604) (-693.304) (-687.305) -- 0:01:01
90000 -- (-690.843) (-689.657) [-690.102] (-690.530) * [-688.523] (-688.094) (-690.886) (-687.940) -- 0:01:00
Average standard deviation of split frequencies: 0.021953
90500 -- [-687.966] (-688.174) (-689.282) (-687.517) * (-690.181) (-687.669) (-687.304) [-689.252] -- 0:01:00
91000 -- (-688.391) [-689.410] (-690.761) (-687.724) * (-691.575) (-689.394) (-688.046) [-687.834] -- 0:00:59
91500 -- (-686.699) (-687.777) (-690.065) [-690.597] * [-688.374] (-687.402) (-687.675) (-694.163) -- 0:00:59
92000 -- [-687.536] (-686.785) (-689.376) (-686.862) * (-690.071) (-687.457) (-687.745) [-686.102] -- 0:00:59
92500 -- [-689.861] (-687.267) (-687.497) (-687.166) * [-689.865] (-688.873) (-689.516) (-691.246) -- 0:00:58
93000 -- (-687.912) (-688.397) (-686.764) [-688.442] * (-689.556) (-690.062) (-687.621) [-686.469] -- 0:00:58
93500 -- (-688.557) (-693.310) (-687.521) [-687.651] * (-690.761) (-691.719) (-690.500) [-688.734] -- 0:00:58
94000 -- (-686.983) (-691.197) (-687.929) [-687.111] * (-688.400) (-693.158) [-687.225] (-687.530) -- 0:00:57
94500 -- (-688.430) (-687.973) [-689.213] (-687.141) * (-688.924) [-686.900] (-687.747) (-687.063) -- 0:00:57
95000 -- (-687.967) (-688.746) [-686.568] (-689.109) * [-686.822] (-687.523) (-688.026) (-687.389) -- 0:00:57
Average standard deviation of split frequencies: 0.021953
95500 -- [-688.198] (-690.930) (-686.148) (-688.563) * (-688.926) (-688.688) [-687.339] (-687.289) -- 0:00:56
96000 -- [-689.960] (-692.026) (-694.166) (-691.768) * (-689.840) [-687.379] (-688.648) (-689.582) -- 0:00:56
96500 -- [-687.454] (-688.401) (-689.491) (-691.230) * (-686.198) [-687.385] (-687.071) (-687.480) -- 0:00:56
97000 -- (-688.475) (-689.606) (-689.957) [-689.445] * (-686.653) (-687.630) (-687.104) [-687.439] -- 0:01:05
97500 -- (-688.626) [-687.722] (-688.035) (-688.104) * [-686.441] (-689.810) (-688.427) (-687.004) -- 0:01:04
98000 -- (-689.513) (-689.136) (-687.480) [-687.252] * (-688.813) (-690.717) [-689.769] (-688.315) -- 0:01:04
98500 -- (-687.953) (-687.978) (-688.050) [-688.564] * [-688.625] (-687.700) (-687.137) (-688.073) -- 0:01:04
99000 -- (-688.185) (-686.993) [-687.134] (-688.228) * (-692.615) (-687.440) [-687.177] (-687.914) -- 0:01:03
99500 -- (-694.568) (-687.564) [-686.931] (-687.431) * (-692.368) [-688.952] (-688.717) (-689.695) -- 0:01:03
100000 -- (-689.620) [-687.578] (-688.453) (-687.326) * (-695.699) [-689.489] (-689.438) (-689.710) -- 0:01:02
Average standard deviation of split frequencies: 0.025618
100500 -- (-692.009) (-689.205) [-688.818] (-688.677) * [-691.621] (-686.025) (-690.521) (-689.117) -- 0:01:02
101000 -- [-689.997] (-687.191) (-687.365) (-690.411) * (-688.174) (-689.317) (-692.361) [-689.389] -- 0:01:02
101500 -- (-691.758) (-686.798) (-687.264) [-686.951] * (-688.057) (-686.525) (-691.551) [-687.366] -- 0:01:01
102000 -- (-689.934) (-686.623) [-688.090] (-687.696) * (-688.010) (-687.025) [-687.457] (-686.351) -- 0:01:01
102500 -- (-691.530) (-688.379) [-688.322] (-690.001) * [-687.148] (-688.806) (-688.745) (-686.392) -- 0:01:01
103000 -- (-687.701) (-689.396) [-686.887] (-687.650) * (-687.916) (-688.754) [-689.269] (-689.464) -- 0:01:00
103500 -- (-688.331) (-688.014) [-686.777] (-691.234) * (-687.947) (-688.742) (-691.351) [-686.830] -- 0:01:00
104000 -- (-688.669) [-688.425] (-690.107) (-689.852) * (-688.351) (-690.066) [-690.251] (-687.033) -- 0:01:00
104500 -- (-687.367) [-688.416] (-688.568) (-687.096) * [-688.972] (-690.283) (-689.300) (-687.360) -- 0:00:59
105000 -- (-689.818) (-689.454) (-688.132) [-691.831] * [-688.132] (-688.840) (-689.983) (-687.497) -- 0:00:59
Average standard deviation of split frequencies: 0.021534
105500 -- (-689.764) (-689.404) (-688.864) [-688.489] * (-686.023) (-687.657) [-688.252] (-688.695) -- 0:00:59
106000 -- (-688.740) [-687.512] (-691.544) (-688.354) * (-687.469) [-688.970] (-688.000) (-690.040) -- 0:00:59
106500 -- (-690.416) (-692.325) [-692.474] (-688.246) * (-690.738) [-690.398] (-688.761) (-693.630) -- 0:00:58
107000 -- (-693.219) (-691.513) (-686.471) [-688.215] * (-689.359) (-687.617) (-690.343) [-687.817] -- 0:00:58
107500 -- (-690.726) (-690.687) (-686.632) [-688.550] * (-690.159) (-686.992) (-687.434) [-687.405] -- 0:00:58
108000 -- (-688.599) [-687.375] (-688.769) (-691.795) * (-686.476) (-686.153) (-687.104) [-687.155] -- 0:00:57
108500 -- (-687.730) (-687.817) (-688.316) [-690.572] * (-689.092) [-686.622] (-686.270) (-686.405) -- 0:00:57
109000 -- (-688.012) (-694.040) [-686.923] (-689.083) * (-687.526) [-686.934] (-687.557) (-686.800) -- 0:00:57
109500 -- [-687.862] (-689.268) (-689.881) (-692.709) * [-687.490] (-686.768) (-687.241) (-688.737) -- 0:00:56
110000 -- (-687.163) [-689.229] (-689.072) (-692.168) * (-690.086) (-689.997) (-689.749) [-690.438] -- 0:00:56
Average standard deviation of split frequencies: 0.019056
110500 -- (-693.415) (-686.833) [-687.992] (-688.640) * [-689.770] (-687.287) (-687.078) (-688.464) -- 0:00:56
111000 -- (-686.486) [-687.164] (-688.461) (-689.581) * (-689.000) (-687.882) [-688.071] (-688.195) -- 0:00:56
111500 -- (-687.754) (-687.042) (-689.008) [-687.947] * (-690.850) [-687.104] (-689.526) (-688.011) -- 0:00:55
112000 -- (-686.521) (-688.127) (-688.030) [-689.292] * (-694.088) [-687.776] (-688.484) (-687.420) -- 0:00:55
112500 -- (-686.783) (-689.660) (-687.889) [-690.295] * (-692.579) (-690.414) (-687.998) [-689.766] -- 0:00:55
113000 -- (-690.448) (-691.870) (-690.335) [-687.534] * (-691.621) (-691.018) (-690.122) [-688.143] -- 0:01:02
113500 -- (-693.478) (-686.941) (-691.706) [-688.834] * (-690.217) (-692.290) (-693.753) [-690.505] -- 0:01:02
114000 -- (-688.824) [-690.083] (-687.832) (-686.830) * [-686.812] (-686.098) (-691.982) (-688.745) -- 0:01:02
114500 -- [-687.024] (-688.498) (-687.520) (-690.821) * (-690.543) [-686.813] (-690.196) (-689.542) -- 0:01:01
115000 -- [-686.223] (-686.835) (-686.782) (-687.699) * (-688.662) (-688.964) [-690.386] (-688.565) -- 0:01:01
Average standard deviation of split frequencies: 0.019464
115500 -- [-687.060] (-687.335) (-688.169) (-688.515) * (-687.739) (-689.820) (-689.270) [-687.712] -- 0:01:01
116000 -- (-692.174) (-688.260) [-687.207] (-689.743) * [-687.203] (-688.392) (-690.249) (-687.571) -- 0:01:00
116500 -- (-696.500) [-686.686] (-690.289) (-689.418) * [-687.516] (-689.336) (-689.123) (-687.887) -- 0:01:00
117000 -- (-690.183) (-689.543) (-687.643) [-688.341] * (-689.453) [-686.378] (-689.347) (-688.404) -- 0:01:00
117500 -- [-686.499] (-687.392) (-690.928) (-686.507) * [-688.632] (-691.536) (-688.842) (-687.811) -- 0:01:00
118000 -- [-688.927] (-692.280) (-687.152) (-690.794) * (-687.209) [-690.964] (-689.251) (-687.402) -- 0:00:59
118500 -- (-687.514) [-690.992] (-689.847) (-689.973) * (-690.827) (-691.777) [-686.629] (-687.568) -- 0:00:59
119000 -- [-693.717] (-689.200) (-689.185) (-690.420) * (-688.054) [-691.192] (-686.122) (-686.819) -- 0:00:59
119500 -- (-689.577) (-694.607) [-687.249] (-687.366) * (-689.699) (-689.052) [-688.174] (-687.593) -- 0:00:58
120000 -- [-687.243] (-687.753) (-693.450) (-687.441) * [-688.687] (-691.177) (-687.186) (-687.352) -- 0:00:58
Average standard deviation of split frequencies: 0.017695
120500 -- (-687.649) (-688.106) (-690.747) [-687.782] * (-686.573) [-686.965] (-687.816) (-687.266) -- 0:00:58
121000 -- (-691.612) [-687.578] (-688.575) (-686.702) * (-689.117) (-687.990) [-687.438] (-687.124) -- 0:00:58
121500 -- (-688.591) [-687.599] (-687.763) (-688.727) * [-689.268] (-687.942) (-686.995) (-689.385) -- 0:00:57
122000 -- [-688.710] (-688.228) (-689.173) (-693.139) * [-690.402] (-687.387) (-689.165) (-694.213) -- 0:00:57
122500 -- (-689.185) (-688.536) [-688.011] (-693.698) * (-689.823) [-688.796] (-690.048) (-686.915) -- 0:00:57
123000 -- (-687.713) (-693.127) (-688.856) [-688.567] * [-689.330] (-692.073) (-687.305) (-687.630) -- 0:00:57
123500 -- (-688.519) [-690.213] (-688.146) (-687.819) * (-687.370) (-688.811) [-686.412] (-686.409) -- 0:00:56
124000 -- (-689.110) (-689.586) [-688.519] (-688.348) * [-690.244] (-690.424) (-688.542) (-689.517) -- 0:00:56
124500 -- (-690.224) (-688.401) (-690.575) [-687.871] * (-689.321) (-689.843) (-688.811) [-690.364] -- 0:00:56
125000 -- (-686.783) (-690.977) (-686.782) [-686.635] * (-690.687) (-688.985) [-688.484] (-688.545) -- 0:00:56
Average standard deviation of split frequencies: 0.018885
125500 -- [-688.463] (-686.600) (-688.067) (-687.412) * (-690.639) [-686.079] (-689.907) (-691.101) -- 0:00:55
126000 -- (-689.836) [-689.983] (-686.681) (-688.456) * [-686.361] (-686.848) (-689.730) (-688.085) -- 0:00:55
126500 -- (-691.673) (-690.298) (-687.111) [-692.383] * (-694.805) (-686.970) (-688.019) [-692.531] -- 0:00:55
127000 -- (-689.504) [-688.304] (-686.514) (-691.504) * (-688.751) (-687.204) [-688.970] (-692.487) -- 0:00:54
127500 -- (-692.441) [-687.515] (-688.982) (-688.377) * [-686.668] (-690.182) (-688.609) (-688.961) -- 0:00:54
128000 -- (-686.634) (-689.420) (-688.097) [-688.631] * (-687.970) [-693.171] (-687.209) (-691.279) -- 0:00:54
128500 -- [-687.058] (-692.824) (-687.540) (-686.582) * (-688.756) (-692.362) [-686.996] (-689.037) -- 0:00:54
129000 -- [-686.612] (-689.951) (-687.364) (-689.018) * (-688.395) [-689.223] (-689.161) (-686.680) -- 0:00:54
129500 -- (-686.904) (-686.774) [-688.556] (-689.428) * [-688.873] (-687.759) (-689.062) (-690.343) -- 0:01:00
130000 -- (-689.048) (-694.792) [-689.089] (-693.643) * [-690.978] (-692.336) (-688.800) (-689.457) -- 0:01:00
Average standard deviation of split frequencies: 0.018418
130500 -- [-686.751] (-688.850) (-687.722) (-687.980) * (-688.306) [-691.345] (-686.865) (-687.918) -- 0:00:59
131000 -- [-687.966] (-695.215) (-689.412) (-688.993) * (-687.081) (-688.201) [-690.241] (-691.829) -- 0:00:59
131500 -- [-687.805] (-692.255) (-687.311) (-688.333) * [-686.425] (-687.876) (-687.413) (-693.417) -- 0:00:59
132000 -- [-687.865] (-687.121) (-687.171) (-688.388) * (-688.338) [-687.525] (-686.477) (-691.981) -- 0:00:59
132500 -- [-688.387] (-686.512) (-687.126) (-687.540) * (-690.512) [-689.140] (-687.997) (-689.796) -- 0:00:58
133000 -- (-687.388) (-690.839) [-688.783] (-689.102) * [-688.809] (-687.726) (-690.223) (-692.500) -- 0:00:58
133500 -- [-686.485] (-687.881) (-688.806) (-690.100) * (-689.401) [-689.098] (-690.427) (-693.250) -- 0:00:58
134000 -- (-687.138) (-690.802) [-687.754] (-686.417) * [-688.763] (-690.467) (-686.963) (-687.331) -- 0:00:58
134500 -- (-687.617) [-687.012] (-688.425) (-688.335) * (-689.439) (-694.061) (-689.693) [-688.006] -- 0:00:57
135000 -- (-688.410) (-686.871) [-687.006] (-688.611) * (-691.129) (-689.381) [-688.302] (-688.225) -- 0:00:57
Average standard deviation of split frequencies: 0.017878
135500 -- [-689.334] (-688.688) (-686.977) (-686.764) * (-687.459) (-687.673) [-689.288] (-689.084) -- 0:00:57
136000 -- [-688.082] (-690.143) (-688.528) (-689.847) * [-688.916] (-690.522) (-688.283) (-690.067) -- 0:00:57
136500 -- (-693.545) (-687.171) [-690.174] (-694.565) * (-692.629) (-689.194) [-687.114] (-691.148) -- 0:00:56
137000 -- [-686.701] (-689.469) (-689.126) (-690.046) * (-686.468) (-686.881) [-688.319] (-688.227) -- 0:00:56
137500 -- (-687.839) [-689.921] (-688.482) (-686.745) * [-688.827] (-688.093) (-691.506) (-688.341) -- 0:00:56
138000 -- (-687.164) [-687.801] (-690.022) (-687.640) * (-688.779) [-686.366] (-688.747) (-687.382) -- 0:00:56
138500 -- [-688.330] (-688.186) (-688.111) (-688.071) * (-688.416) (-687.954) [-688.632] (-688.928) -- 0:00:55
139000 -- (-687.569) (-688.162) (-687.987) [-689.963] * (-687.644) (-688.796) (-691.474) [-686.655] -- 0:00:55
139500 -- (-686.544) (-686.526) [-687.878] (-688.091) * (-687.044) [-688.145] (-687.542) (-687.898) -- 0:00:55
140000 -- (-687.515) (-687.984) (-690.305) [-688.848] * (-687.250) (-688.167) [-688.327] (-687.166) -- 0:00:55
Average standard deviation of split frequencies: 0.017150
140500 -- (-687.987) [-688.671] (-687.601) (-690.164) * (-689.387) (-689.625) [-688.138] (-687.624) -- 0:00:55
141000 -- (-689.745) [-688.085] (-688.188) (-690.583) * (-688.403) (-688.199) [-688.872] (-690.595) -- 0:00:54
141500 -- [-689.566] (-687.296) (-692.536) (-690.303) * (-687.715) (-689.059) [-687.858] (-690.522) -- 0:00:54
142000 -- (-687.140) [-688.978] (-688.247) (-686.817) * [-687.377] (-689.323) (-687.358) (-687.144) -- 0:00:54
142500 -- (-687.379) (-687.209) (-687.427) [-686.576] * (-692.671) [-688.708] (-693.114) (-687.510) -- 0:00:54
143000 -- (-687.111) (-687.630) (-689.219) [-688.453] * (-688.555) [-687.378] (-692.311) (-690.620) -- 0:00:53
143500 -- (-687.721) [-687.696] (-688.563) (-688.027) * (-687.266) [-689.423] (-691.136) (-693.574) -- 0:00:53
144000 -- (-691.715) (-686.367) (-687.178) [-687.343] * [-686.250] (-686.966) (-689.118) (-690.185) -- 0:00:53
144500 -- (-691.461) [-686.829] (-688.321) (-688.792) * (-686.583) (-687.344) (-687.413) [-688.212] -- 0:00:53
145000 -- (-689.930) (-686.566) [-688.849] (-687.731) * (-686.736) (-686.290) (-690.373) [-688.157] -- 0:00:53
Average standard deviation of split frequencies: 0.017220
145500 -- (-692.118) [-687.235] (-686.746) (-688.612) * (-686.413) [-686.956] (-690.395) (-690.659) -- 0:00:52
146000 -- [-688.362] (-687.778) (-695.580) (-689.909) * (-689.029) [-688.550] (-692.921) (-687.070) -- 0:00:58
146500 -- (-689.374) [-687.352] (-695.260) (-688.497) * (-693.558) (-687.363) [-687.490] (-686.849) -- 0:00:58
147000 -- [-688.760] (-689.132) (-695.062) (-689.868) * [-688.137] (-687.812) (-687.358) (-687.304) -- 0:00:58
147500 -- (-687.953) [-689.257] (-695.731) (-688.667) * (-687.891) (-688.098) [-687.648] (-687.640) -- 0:00:57
148000 -- [-687.677] (-689.906) (-691.134) (-687.342) * (-691.390) (-693.232) [-688.822] (-687.013) -- 0:00:57
148500 -- (-689.096) (-687.535) [-688.345] (-686.730) * [-688.619] (-687.950) (-688.925) (-690.350) -- 0:00:57
149000 -- (-688.205) (-688.171) (-688.410) [-686.947] * (-688.440) (-692.175) [-689.772] (-687.666) -- 0:00:57
149500 -- (-686.861) (-686.958) (-689.262) [-686.638] * (-689.219) (-689.556) [-687.208] (-689.252) -- 0:00:56
150000 -- (-688.145) (-687.241) (-694.452) [-687.025] * (-688.427) (-688.884) [-687.413] (-686.995) -- 0:00:56
Average standard deviation of split frequencies: 0.016932
150500 -- [-687.753] (-688.900) (-692.383) (-686.511) * (-692.418) (-687.911) (-686.432) [-688.946] -- 0:00:56
151000 -- (-688.286) (-687.052) (-687.245) [-689.540] * (-690.841) (-687.511) [-686.454] (-687.361) -- 0:00:56
151500 -- [-690.030] (-690.338) (-689.420) (-690.846) * (-688.955) (-691.140) [-687.185] (-690.879) -- 0:00:56
152000 -- (-687.654) (-688.915) (-687.102) [-687.025] * [-691.476] (-688.618) (-687.933) (-690.294) -- 0:00:55
152500 -- (-688.795) (-687.452) [-690.237] (-687.620) * (-691.210) (-687.952) [-690.990] (-690.172) -- 0:00:55
153000 -- (-686.420) (-686.197) (-688.710) [-687.634] * (-686.599) [-687.851] (-688.036) (-690.576) -- 0:00:55
153500 -- (-686.624) [-688.265] (-687.927) (-693.445) * [-691.798] (-688.875) (-691.186) (-689.242) -- 0:00:55
154000 -- (-686.239) (-689.704) [-688.915] (-696.040) * (-689.559) [-688.223] (-686.743) (-686.342) -- 0:00:54
154500 -- (-688.403) (-692.786) [-689.933] (-689.158) * (-686.796) (-688.100) (-687.733) [-686.331] -- 0:00:54
155000 -- (-691.675) (-688.858) [-687.198] (-687.640) * [-687.485] (-690.411) (-689.290) (-686.521) -- 0:00:54
Average standard deviation of split frequencies: 0.018970
155500 -- (-688.972) (-691.070) [-686.147] (-687.553) * (-688.982) (-687.907) (-688.149) [-687.388] -- 0:00:54
156000 -- (-688.018) [-687.928] (-686.034) (-687.501) * (-691.858) [-687.951] (-687.296) (-687.078) -- 0:00:54
156500 -- (-688.058) (-688.534) [-687.790] (-687.140) * (-692.119) [-688.086] (-689.458) (-687.198) -- 0:00:53
157000 -- (-687.711) (-689.380) [-687.208] (-687.954) * (-689.708) (-686.665) (-687.679) [-687.590] -- 0:00:53
157500 -- [-691.338] (-689.608) (-686.427) (-687.184) * (-690.495) (-689.618) [-687.017] (-689.851) -- 0:00:53
158000 -- (-689.493) (-689.354) (-687.458) [-685.929] * (-688.891) (-696.430) [-688.688] (-690.462) -- 0:00:53
158500 -- [-686.812] (-688.716) (-692.301) (-686.669) * (-688.776) (-706.403) [-688.160] (-689.645) -- 0:00:53
159000 -- (-687.308) [-686.430] (-689.703) (-687.540) * [-687.930] (-705.857) (-688.491) (-688.332) -- 0:00:52
159500 -- (-689.476) [-688.618] (-689.017) (-687.334) * [-686.513] (-695.131) (-688.700) (-689.981) -- 0:00:52
160000 -- (-691.678) (-687.709) (-688.083) [-686.893] * (-688.705) (-687.280) [-688.381] (-690.407) -- 0:00:52
Average standard deviation of split frequencies: 0.016137
160500 -- (-693.813) (-689.203) (-687.923) [-687.178] * (-692.668) [-686.880] (-688.940) (-690.414) -- 0:00:52
161000 -- (-687.465) (-687.794) [-687.216] (-687.637) * [-687.752] (-688.057) (-692.339) (-689.178) -- 0:00:52
161500 -- [-689.432] (-687.037) (-687.344) (-687.913) * (-687.944) (-690.380) (-688.464) [-687.815] -- 0:00:51
162000 -- (-690.099) [-686.902] (-688.110) (-688.186) * (-690.566) (-690.002) (-688.413) [-687.977] -- 0:00:51
162500 -- (-687.671) (-686.007) [-686.630] (-689.229) * (-686.897) (-687.727) (-690.736) [-688.569] -- 0:00:56
163000 -- (-688.498) (-691.110) [-687.943] (-692.263) * [-686.052] (-687.636) (-692.553) (-689.461) -- 0:00:56
163500 -- [-688.460] (-691.136) (-687.210) (-690.434) * (-687.486) (-686.818) [-687.353] (-687.963) -- 0:00:56
164000 -- [-688.844] (-688.396) (-686.181) (-691.426) * (-691.481) (-689.435) (-689.756) [-687.498] -- 0:00:56
164500 -- [-688.009] (-687.531) (-686.377) (-688.936) * (-688.096) [-692.115] (-694.073) (-686.672) -- 0:00:55
165000 -- (-690.836) [-686.799] (-690.404) (-695.556) * (-688.353) (-688.995) (-687.559) [-687.260] -- 0:00:55
Average standard deviation of split frequencies: 0.015461
165500 -- [-686.607] (-687.159) (-687.751) (-688.183) * (-690.957) (-687.337) [-686.601] (-687.216) -- 0:00:55
166000 -- (-687.369) (-689.083) [-686.852] (-690.026) * (-689.486) [-688.019] (-687.131) (-687.317) -- 0:00:55
166500 -- (-686.123) (-688.218) (-688.459) [-687.841] * (-689.248) (-688.597) [-689.836] (-686.362) -- 0:00:55
167000 -- [-686.575] (-687.185) (-686.075) (-688.696) * (-688.394) (-687.170) [-687.236] (-687.421) -- 0:00:54
167500 -- (-687.848) (-687.214) [-687.033] (-686.340) * (-690.303) (-690.219) [-687.743] (-686.325) -- 0:00:54
168000 -- (-688.248) (-688.280) [-686.861] (-690.380) * (-689.213) (-687.403) [-689.533] (-687.496) -- 0:00:54
168500 -- (-688.367) (-686.376) [-686.216] (-688.791) * (-689.772) (-692.428) (-687.831) [-686.890] -- 0:00:54
169000 -- (-689.079) (-686.650) [-686.498] (-686.461) * (-687.196) (-687.431) (-687.029) [-686.283] -- 0:00:54
169500 -- (-687.661) (-690.846) (-689.425) [-690.958] * (-687.427) (-686.747) (-689.950) [-687.014] -- 0:00:53
170000 -- (-687.572) (-688.075) (-691.603) [-687.366] * (-689.566) [-688.076] (-686.921) (-692.234) -- 0:00:53
Average standard deviation of split frequencies: 0.015991
170500 -- (-690.938) (-687.131) (-691.707) [-689.797] * [-687.279] (-689.108) (-687.534) (-688.911) -- 0:00:53
171000 -- [-689.257] (-687.358) (-691.685) (-688.956) * (-687.241) (-691.448) (-686.568) [-688.064] -- 0:00:53
171500 -- (-688.840) [-687.741] (-689.543) (-690.457) * [-687.789] (-689.753) (-687.538) (-688.203) -- 0:00:53
172000 -- (-689.730) (-689.710) (-692.017) [-688.729] * [-686.327] (-689.283) (-689.882) (-686.184) -- 0:00:52
172500 -- (-687.589) (-688.548) (-687.387) [-687.905] * (-686.797) (-687.378) (-688.785) [-687.058] -- 0:00:52
173000 -- (-686.740) (-692.280) (-686.804) [-686.463] * [-686.930] (-689.312) (-688.415) (-691.305) -- 0:00:52
173500 -- [-689.376] (-688.428) (-691.019) (-686.560) * (-688.603) [-686.733] (-693.350) (-688.792) -- 0:00:52
174000 -- (-690.921) (-691.544) [-686.302] (-691.475) * (-686.918) (-686.960) (-689.144) [-689.414] -- 0:00:52
174500 -- [-689.502] (-691.050) (-689.658) (-687.357) * (-687.155) (-686.202) (-687.755) [-690.586] -- 0:00:52
175000 -- [-695.496] (-687.778) (-688.382) (-686.496) * (-689.513) (-687.001) (-692.545) [-688.528] -- 0:00:51
Average standard deviation of split frequencies: 0.016071
175500 -- (-690.922) [-687.365] (-690.106) (-687.086) * (-689.265) [-689.930] (-688.804) (-689.865) -- 0:00:51
176000 -- [-687.323] (-686.332) (-690.934) (-688.622) * (-687.560) (-692.862) (-687.383) [-688.229] -- 0:00:51
176500 -- (-689.040) (-686.530) [-687.433] (-691.308) * (-687.020) (-688.359) (-687.080) [-686.736] -- 0:00:51
177000 -- (-688.503) [-688.982] (-688.347) (-686.692) * (-686.758) (-688.975) [-687.371] (-686.603) -- 0:00:51
177500 -- (-689.493) (-688.245) (-689.054) [-686.756] * (-687.713) (-689.221) [-686.535] (-695.570) -- 0:00:50
178000 -- (-690.119) (-688.306) [-687.520] (-688.916) * [-687.889] (-687.410) (-688.085) (-690.689) -- 0:00:50
178500 -- (-689.794) (-689.217) (-689.240) [-690.768] * (-690.067) (-689.701) (-687.436) [-686.344] -- 0:00:50
179000 -- (-688.345) [-688.445] (-687.660) (-689.287) * (-687.337) (-687.689) (-687.267) [-686.877] -- 0:00:55
179500 -- [-689.342] (-687.520) (-688.829) (-687.584) * [-687.145] (-686.326) (-690.316) (-688.660) -- 0:00:54
180000 -- [-688.732] (-686.801) (-689.816) (-688.154) * (-687.661) (-688.512) (-688.328) [-687.978] -- 0:00:54
Average standard deviation of split frequencies: 0.015656
180500 -- (-690.547) (-686.668) [-689.306] (-687.133) * (-688.192) [-688.733] (-686.781) (-689.119) -- 0:00:54
181000 -- [-688.472] (-687.889) (-689.061) (-688.229) * (-690.688) (-687.656) (-686.760) [-686.756] -- 0:00:54
181500 -- (-688.733) (-689.020) [-686.149] (-691.775) * (-688.133) (-687.939) (-686.917) [-690.048] -- 0:00:54
182000 -- (-689.459) (-687.201) [-686.674] (-689.555) * [-690.041] (-687.173) (-688.157) (-695.009) -- 0:00:53
182500 -- (-691.051) (-686.854) (-686.828) [-688.597] * (-689.279) (-688.915) [-687.338] (-687.223) -- 0:00:53
183000 -- (-687.815) [-688.473] (-686.764) (-688.454) * (-686.283) (-688.249) [-689.366] (-686.855) -- 0:00:53
183500 -- (-686.333) (-687.359) (-687.008) [-686.605] * (-688.528) [-687.358] (-688.554) (-686.323) -- 0:00:53
184000 -- (-691.609) [-687.040] (-689.692) (-687.330) * (-688.535) [-688.042] (-687.633) (-686.094) -- 0:00:53
184500 -- (-688.741) [-688.248] (-688.197) (-693.612) * (-687.648) (-688.386) [-686.251] (-687.308) -- 0:00:53
185000 -- (-688.178) (-691.410) (-691.750) [-689.267] * [-689.143] (-688.900) (-688.868) (-687.137) -- 0:00:52
Average standard deviation of split frequencies: 0.012250
185500 -- (-686.383) [-689.409] (-690.024) (-689.071) * (-689.703) (-687.683) [-689.035] (-689.479) -- 0:00:52
186000 -- (-687.289) [-689.211] (-689.353) (-689.603) * (-689.451) (-687.290) [-687.270] (-690.775) -- 0:00:52
186500 -- (-686.548) (-686.775) [-688.905] (-687.489) * (-686.347) [-692.710] (-689.117) (-691.193) -- 0:00:52
187000 -- (-689.465) [-687.363] (-687.322) (-689.645) * (-686.107) [-688.437] (-694.346) (-687.250) -- 0:00:52
187500 -- (-687.345) [-687.828] (-688.645) (-689.979) * (-686.191) [-688.098] (-691.170) (-689.303) -- 0:00:52
188000 -- (-687.715) (-688.469) [-686.362] (-689.255) * (-687.136) [-688.392] (-695.391) (-686.841) -- 0:00:51
188500 -- (-688.572) [-687.912] (-688.400) (-687.368) * (-687.814) (-686.368) [-690.081] (-687.682) -- 0:00:51
189000 -- (-688.268) (-687.633) [-688.013] (-687.065) * (-686.756) (-689.682) (-687.142) [-686.678] -- 0:00:51
189500 -- (-687.223) [-690.737] (-687.414) (-687.126) * (-690.096) [-688.173] (-687.749) (-686.943) -- 0:00:51
190000 -- (-689.206) (-687.893) (-687.509) [-686.400] * (-693.029) [-689.652] (-687.883) (-688.470) -- 0:00:51
Average standard deviation of split frequencies: 0.013671
190500 -- (-687.941) (-687.631) (-692.877) [-690.927] * (-689.013) (-687.285) [-687.039] (-686.594) -- 0:00:50
191000 -- (-687.359) (-692.220) (-687.514) [-686.836] * [-690.707] (-688.322) (-689.633) (-686.218) -- 0:00:50
191500 -- (-689.664) [-687.563] (-687.780) (-690.955) * (-689.811) (-688.493) (-690.278) [-686.037] -- 0:00:50
192000 -- (-691.316) (-696.400) [-687.465] (-688.531) * (-688.512) [-688.288] (-687.580) (-691.532) -- 0:00:50
192500 -- [-690.127] (-694.052) (-688.330) (-688.002) * (-687.061) (-688.834) [-688.186] (-689.383) -- 0:00:50
193000 -- (-686.840) [-697.002] (-687.733) (-690.090) * (-688.043) [-687.989] (-686.879) (-687.036) -- 0:00:50
193500 -- (-690.200) [-695.218] (-689.051) (-687.704) * [-687.941] (-690.849) (-688.261) (-689.560) -- 0:00:50
194000 -- [-690.352] (-692.143) (-691.298) (-687.595) * (-686.821) (-693.823) [-687.916] (-687.073) -- 0:00:49
194500 -- (-691.061) (-690.314) (-688.142) [-689.800] * (-691.202) (-686.354) (-691.939) [-687.139] -- 0:00:49
195000 -- (-694.036) [-687.710] (-689.614) (-687.717) * (-690.300) [-687.836] (-691.811) (-687.347) -- 0:00:49
Average standard deviation of split frequencies: 0.012874
195500 -- (-693.680) [-687.239] (-687.163) (-691.397) * [-688.717] (-690.089) (-690.228) (-688.446) -- 0:00:53
196000 -- (-695.025) (-686.998) (-687.542) [-687.284] * (-690.801) (-687.003) (-695.475) [-688.554] -- 0:00:53
196500 -- [-691.297] (-688.912) (-687.278) (-687.913) * (-688.383) (-687.936) [-687.967] (-688.422) -- 0:00:53
197000 -- [-697.173] (-689.277) (-687.777) (-686.141) * (-689.037) [-687.756] (-689.739) (-687.846) -- 0:00:52
197500 -- (-692.144) (-687.877) (-687.655) [-687.152] * [-689.079] (-687.768) (-691.015) (-689.136) -- 0:00:52
198000 -- (-688.588) (-688.276) (-689.545) [-687.811] * [-687.820] (-689.567) (-688.813) (-688.786) -- 0:00:52
198500 -- [-687.178] (-687.120) (-695.906) (-686.713) * [-687.611] (-692.484) (-687.132) (-688.191) -- 0:00:52
199000 -- (-687.613) (-687.291) (-691.426) [-687.087] * (-688.179) (-692.639) [-688.612] (-688.403) -- 0:00:52
199500 -- (-686.675) [-686.849] (-687.769) (-689.733) * (-690.690) (-693.766) [-689.904] (-688.929) -- 0:00:52
200000 -- (-686.593) (-690.158) [-687.940] (-686.972) * [-687.355] (-689.910) (-686.591) (-689.031) -- 0:00:51
Average standard deviation of split frequencies: 0.013312
200500 -- (-688.345) (-689.386) [-687.799] (-687.975) * (-687.562) (-690.990) [-686.123] (-690.178) -- 0:00:51
201000 -- [-688.270] (-686.881) (-686.692) (-687.556) * [-686.923] (-691.741) (-687.694) (-687.629) -- 0:00:51
201500 -- [-691.870] (-689.472) (-686.712) (-690.344) * (-689.655) (-687.689) (-687.839) [-687.627] -- 0:00:51
202000 -- (-687.763) (-687.160) [-685.986] (-687.082) * [-688.622] (-686.837) (-689.343) (-688.545) -- 0:00:51
202500 -- (-686.226) [-689.514] (-688.823) (-688.726) * (-689.267) (-688.919) [-688.769] (-691.209) -- 0:00:51
203000 -- [-686.484] (-691.301) (-686.259) (-689.905) * [-688.579] (-687.197) (-690.790) (-689.318) -- 0:00:51
203500 -- [-689.019] (-687.522) (-688.079) (-690.540) * (-688.257) (-688.427) (-689.900) [-688.952] -- 0:00:50
204000 -- (-688.047) (-686.050) (-693.882) [-689.067] * (-688.886) (-687.468) [-688.535] (-687.705) -- 0:00:50
204500 -- (-689.463) (-686.844) (-691.583) [-687.148] * (-688.487) (-690.490) (-689.157) [-686.179] -- 0:00:50
205000 -- (-688.122) [-688.267] (-695.871) (-690.759) * (-687.100) (-693.460) (-689.510) [-686.896] -- 0:00:50
Average standard deviation of split frequencies: 0.012459
205500 -- (-686.725) (-686.505) [-689.712] (-687.700) * [-686.344] (-689.422) (-699.086) (-687.573) -- 0:00:50
206000 -- (-688.180) (-686.540) (-688.287) [-686.363] * (-686.471) (-688.166) (-690.527) [-690.021] -- 0:00:50
206500 -- (-689.517) (-689.604) (-686.606) [-687.882] * [-688.256] (-686.132) (-688.091) (-689.856) -- 0:00:49
207000 -- (-689.621) (-689.644) (-686.793) [-687.451] * (-691.350) (-689.240) [-686.063] (-689.046) -- 0:00:49
207500 -- [-687.626] (-690.133) (-686.868) (-689.961) * (-687.526) [-689.058] (-689.594) (-686.968) -- 0:00:49
208000 -- (-687.335) (-689.096) (-688.039) [-686.993] * (-687.431) (-688.948) (-688.155) [-687.096] -- 0:00:49
208500 -- (-688.669) (-690.831) [-689.654] (-687.830) * (-690.357) (-687.630) [-687.365] (-687.766) -- 0:00:49
209000 -- (-688.171) (-689.562) [-692.757] (-687.545) * (-691.740) (-687.115) (-687.714) [-687.135] -- 0:00:49
209500 -- (-689.049) [-686.427] (-696.491) (-688.651) * (-688.737) (-688.015) (-687.916) [-689.785] -- 0:00:49
210000 -- (-689.413) (-688.212) (-690.542) [-686.640] * (-687.642) [-688.381] (-689.429) (-690.597) -- 0:00:48
Average standard deviation of split frequencies: 0.013031
210500 -- (-692.956) [-688.133] (-690.637) (-686.858) * (-689.873) (-689.311) (-689.818) [-687.865] -- 0:00:48
211000 -- (-692.865) (-694.290) (-688.981) [-686.695] * [-689.861] (-687.241) (-688.619) (-687.116) -- 0:00:48
211500 -- (-693.035) (-689.104) (-697.185) [-687.732] * (-690.215) (-687.915) [-687.490] (-687.776) -- 0:00:52
212000 -- (-687.978) (-691.210) [-688.480] (-692.149) * (-687.173) (-689.195) [-690.786] (-687.713) -- 0:00:52
212500 -- [-686.159] (-689.476) (-690.448) (-686.793) * (-687.916) (-689.258) (-688.621) [-687.044] -- 0:00:51
213000 -- (-688.884) (-688.383) [-686.705] (-686.677) * (-691.839) (-687.022) (-689.135) [-688.097] -- 0:00:51
213500 -- (-688.891) (-694.055) [-686.269] (-686.267) * (-688.299) (-687.972) (-687.252) [-687.149] -- 0:00:51
214000 -- (-687.699) [-687.342] (-688.119) (-686.559) * (-692.341) (-691.478) [-686.351] (-692.838) -- 0:00:51
214500 -- (-686.772) [-686.614] (-688.790) (-688.209) * (-690.535) [-689.419] (-687.620) (-687.612) -- 0:00:51
215000 -- (-690.421) (-686.829) (-690.463) [-689.636] * (-688.036) (-692.141) (-687.384) [-686.920] -- 0:00:51
Average standard deviation of split frequencies: 0.013608
215500 -- (-690.142) [-690.888] (-691.230) (-692.363) * (-690.185) (-691.407) [-689.243] (-687.594) -- 0:00:50
216000 -- (-686.958) (-687.606) [-688.965] (-686.597) * (-689.610) [-688.988] (-686.397) (-687.325) -- 0:00:50
216500 -- (-687.579) [-690.393] (-689.394) (-689.150) * [-688.634] (-691.991) (-686.813) (-686.466) -- 0:00:50
217000 -- [-686.964] (-686.939) (-688.897) (-689.505) * [-688.838] (-693.793) (-686.518) (-686.699) -- 0:00:50
217500 -- [-689.803] (-687.291) (-690.630) (-688.804) * (-690.369) (-688.823) [-686.444] (-689.943) -- 0:00:50
218000 -- [-686.674] (-686.658) (-687.971) (-688.501) * (-695.256) (-688.566) [-686.169] (-687.141) -- 0:00:50
218500 -- [-688.291] (-687.882) (-689.711) (-687.659) * (-692.473) (-687.539) [-687.653] (-689.968) -- 0:00:50
219000 -- (-687.197) (-690.539) (-687.491) [-686.913] * [-688.454] (-692.394) (-694.534) (-690.799) -- 0:00:49
219500 -- (-689.169) (-688.052) [-686.403] (-690.024) * (-687.650) (-692.024) (-689.296) [-686.932] -- 0:00:49
220000 -- (-691.709) (-687.034) [-686.275] (-688.205) * (-686.772) [-690.729] (-686.379) (-688.705) -- 0:00:49
Average standard deviation of split frequencies: 0.013320
220500 -- (-687.698) (-691.461) [-686.538] (-691.845) * (-686.131) [-688.095] (-686.277) (-687.743) -- 0:00:49
221000 -- (-686.919) (-685.989) [-692.627] (-687.689) * [-686.764] (-690.668) (-686.481) (-686.643) -- 0:00:49
221500 -- (-687.718) (-686.738) (-687.334) [-688.864] * [-686.803] (-692.865) (-688.261) (-689.293) -- 0:00:49
222000 -- [-686.066] (-688.398) (-687.629) (-688.674) * (-692.729) (-687.425) (-689.264) [-687.861] -- 0:00:49
222500 -- (-687.950) [-686.175] (-688.453) (-690.081) * (-688.720) [-686.884] (-687.978) (-689.906) -- 0:00:48
223000 -- (-689.020) [-686.175] (-688.207) (-690.945) * (-688.655) (-686.862) [-687.861] (-690.704) -- 0:00:48
223500 -- (-690.251) (-687.429) [-686.311] (-688.382) * (-687.181) [-686.357] (-687.262) (-692.278) -- 0:00:48
224000 -- [-687.403] (-687.157) (-686.935) (-688.598) * (-687.772) (-689.612) [-691.146] (-688.053) -- 0:00:48
224500 -- (-687.656) (-686.463) [-690.303] (-687.707) * [-687.141] (-690.260) (-689.331) (-687.112) -- 0:00:48
225000 -- [-688.779] (-687.187) (-687.530) (-687.629) * [-688.002] (-688.821) (-689.095) (-687.265) -- 0:00:48
Average standard deviation of split frequencies: 0.012270
225500 -- (-688.642) (-687.443) [-686.783] (-691.931) * [-689.102] (-687.462) (-688.763) (-693.195) -- 0:00:48
226000 -- (-687.145) (-689.368) (-688.062) [-689.005] * (-688.600) (-687.359) (-688.743) [-687.907] -- 0:00:47
226500 -- (-686.787) (-689.130) (-690.299) [-689.350] * (-687.884) [-691.413] (-689.522) (-687.360) -- 0:00:47
227000 -- (-687.186) (-689.620) [-688.733] (-689.453) * (-691.486) [-688.566] (-687.350) (-691.175) -- 0:00:47
227500 -- (-686.276) [-688.109] (-689.921) (-690.236) * (-688.299) (-687.418) (-687.304) [-688.049] -- 0:00:47
228000 -- (-686.533) (-693.277) [-687.044] (-686.932) * (-688.207) [-687.271] (-687.524) (-686.914) -- 0:00:50
228500 -- (-686.935) [-689.969] (-688.921) (-690.858) * (-687.416) (-687.210) [-686.323] (-687.953) -- 0:00:50
229000 -- (-686.849) (-689.286) (-687.197) [-687.867] * (-688.301) (-688.166) [-686.829] (-687.883) -- 0:00:50
229500 -- (-690.102) (-690.039) [-686.469] (-690.433) * [-687.094] (-690.904) (-691.945) (-688.090) -- 0:00:50
230000 -- (-687.809) (-693.301) [-687.441] (-690.442) * (-689.964) (-688.426) [-687.456] (-688.623) -- 0:00:50
Average standard deviation of split frequencies: 0.012142
230500 -- (-689.215) (-690.902) (-686.930) [-688.200] * [-688.887] (-687.731) (-688.785) (-690.736) -- 0:00:50
231000 -- [-689.723] (-687.778) (-688.472) (-686.829) * [-687.978] (-688.488) (-686.328) (-688.800) -- 0:00:49
231500 -- [-691.044] (-688.013) (-687.293) (-686.424) * (-690.141) (-687.999) [-687.703] (-691.963) -- 0:00:49
232000 -- [-687.199] (-690.843) (-687.429) (-686.717) * (-688.414) [-692.384] (-687.111) (-692.456) -- 0:00:49
232500 -- (-687.215) (-690.214) [-686.697] (-687.740) * [-693.336] (-688.944) (-688.279) (-687.861) -- 0:00:49
233000 -- (-691.236) (-687.291) [-688.240] (-688.464) * (-689.011) (-686.733) (-692.114) [-687.826] -- 0:00:49
233500 -- (-695.659) (-687.238) [-689.257] (-691.520) * (-691.039) (-687.192) (-688.153) [-687.565] -- 0:00:49
234000 -- (-688.024) (-687.305) [-687.837] (-693.146) * (-692.200) (-688.180) (-688.902) [-687.639] -- 0:00:49
234500 -- (-687.686) (-689.686) [-687.110] (-689.165) * (-690.773) (-686.650) (-689.800) [-687.293] -- 0:00:48
235000 -- (-687.663) (-688.119) (-689.213) [-689.606] * (-688.083) (-687.678) [-689.103] (-687.268) -- 0:00:48
Average standard deviation of split frequencies: 0.012235
235500 -- [-689.681] (-686.164) (-688.574) (-687.792) * (-687.503) (-686.813) (-689.061) [-688.050] -- 0:00:48
236000 -- [-686.647] (-686.184) (-688.309) (-687.186) * (-690.346) (-697.599) (-687.548) [-688.174] -- 0:00:48
236500 -- (-685.972) (-691.315) [-688.634] (-686.499) * (-691.160) (-690.811) [-690.407] (-690.244) -- 0:00:48
237000 -- (-686.550) (-688.633) (-688.900) [-687.359] * (-688.754) (-692.575) (-691.978) [-690.152] -- 0:00:48
237500 -- (-691.595) [-687.897] (-687.809) (-687.910) * (-688.922) (-688.752) (-691.425) [-690.093] -- 0:00:48
238000 -- (-689.646) (-687.409) (-690.808) [-687.570] * [-687.818] (-688.499) (-689.783) (-689.730) -- 0:00:48
238500 -- [-688.237] (-686.523) (-686.906) (-686.513) * (-688.006) [-687.790] (-686.857) (-690.315) -- 0:00:47
239000 -- (-688.291) (-686.756) [-688.737] (-689.359) * (-687.090) [-691.744] (-689.002) (-687.217) -- 0:00:47
239500 -- (-693.473) (-687.536) [-689.909] (-696.209) * (-689.814) [-688.669] (-689.499) (-689.977) -- 0:00:47
240000 -- (-688.466) (-687.271) (-688.646) [-691.339] * (-692.717) (-690.245) [-687.570] (-688.164) -- 0:00:47
Average standard deviation of split frequencies: 0.014234
240500 -- [-687.212] (-686.456) (-688.690) (-690.534) * (-689.941) (-686.653) (-692.177) [-695.065] -- 0:00:47
241000 -- [-692.399] (-688.531) (-688.550) (-687.678) * (-692.980) [-689.979] (-690.082) (-689.077) -- 0:00:47
241500 -- [-691.289] (-692.470) (-688.038) (-687.191) * (-691.690) [-691.170] (-686.836) (-686.699) -- 0:00:47
242000 -- (-687.201) [-690.194] (-687.358) (-687.556) * [-691.160] (-689.986) (-692.012) (-686.147) -- 0:00:46
242500 -- [-687.610] (-689.632) (-691.505) (-687.235) * [-691.554] (-689.824) (-695.585) (-688.441) -- 0:00:46
243000 -- (-688.520) (-687.954) [-689.500] (-688.639) * [-687.281] (-690.265) (-688.435) (-690.825) -- 0:00:46
243500 -- (-687.845) (-687.632) [-689.195] (-687.084) * (-689.224) (-688.679) [-688.323] (-687.819) -- 0:00:46
244000 -- (-688.303) (-688.693) (-694.215) [-688.317] * (-690.609) (-687.877) (-687.386) [-686.959] -- 0:00:49
244500 -- [-686.646] (-690.065) (-687.794) (-688.795) * (-687.333) (-687.287) [-686.671] (-686.220) -- 0:00:49
245000 -- [-687.115] (-687.079) (-689.276) (-689.162) * (-692.352) (-688.827) [-688.396] (-686.676) -- 0:00:49
Average standard deviation of split frequencies: 0.012775
245500 -- (-687.124) (-687.126) [-689.432] (-687.815) * [-691.924] (-687.027) (-688.801) (-687.373) -- 0:00:49
246000 -- (-688.629) [-686.370] (-688.116) (-689.171) * (-691.965) [-689.456] (-687.787) (-689.063) -- 0:00:49
246500 -- (-688.834) (-687.748) [-686.688] (-689.181) * (-690.110) [-687.491] (-690.752) (-688.859) -- 0:00:48
247000 -- (-690.455) (-686.690) (-688.158) [-688.083] * (-688.625) (-687.161) [-687.335] (-688.530) -- 0:00:48
247500 -- (-692.519) (-686.865) (-687.945) [-688.385] * [-689.599] (-689.067) (-688.411) (-687.570) -- 0:00:48
248000 -- (-687.613) [-688.008] (-689.764) (-687.545) * (-688.723) (-691.922) [-686.869] (-686.296) -- 0:00:48
248500 -- (-688.315) (-686.205) [-689.764] (-688.563) * [-687.642] (-687.970) (-688.283) (-689.362) -- 0:00:48
249000 -- (-691.338) [-689.599] (-687.677) (-692.595) * (-691.484) (-688.205) (-687.250) [-687.954] -- 0:00:48
249500 -- (-689.367) [-689.847] (-688.088) (-689.792) * (-691.792) [-687.929] (-688.135) (-687.228) -- 0:00:48
250000 -- (-687.312) [-687.074] (-688.079) (-686.052) * [-692.073] (-687.435) (-688.802) (-687.741) -- 0:00:48
Average standard deviation of split frequencies: 0.012913
250500 -- [-687.484] (-689.502) (-687.531) (-686.019) * (-687.226) [-688.731] (-687.680) (-692.590) -- 0:00:47
251000 -- (-687.526) (-690.101) (-686.659) [-686.394] * (-689.311) (-688.905) [-689.395] (-695.690) -- 0:00:47
251500 -- (-694.601) (-686.591) [-688.214] (-687.811) * [-687.305] (-688.161) (-688.975) (-693.806) -- 0:00:47
252000 -- (-688.508) (-686.213) [-686.471] (-687.582) * [-687.722] (-690.704) (-689.848) (-690.422) -- 0:00:47
252500 -- (-687.787) [-687.907] (-689.341) (-688.355) * [-687.784] (-689.958) (-690.983) (-690.529) -- 0:00:47
253000 -- (-688.037) (-686.320) (-687.064) [-688.706] * (-686.336) (-689.670) [-687.892] (-687.672) -- 0:00:47
253500 -- (-688.354) [-685.862] (-691.516) (-690.844) * (-688.653) (-687.442) [-690.610] (-692.655) -- 0:00:47
254000 -- [-687.094] (-686.175) (-687.612) (-691.330) * (-690.637) (-688.656) [-686.998] (-689.298) -- 0:00:46
254500 -- (-688.170) (-686.656) (-689.044) [-687.920] * (-692.672) [-687.881] (-688.610) (-689.327) -- 0:00:46
255000 -- (-691.360) (-691.031) (-688.995) [-688.054] * (-689.209) (-689.982) [-689.632] (-690.796) -- 0:00:46
Average standard deviation of split frequencies: 0.012644
255500 -- (-687.106) (-687.898) (-692.882) [-690.763] * [-688.891] (-686.963) (-688.905) (-698.698) -- 0:00:46
256000 -- [-688.029] (-687.635) (-690.802) (-695.798) * (-691.023) [-688.689] (-691.258) (-690.261) -- 0:00:46
256500 -- [-687.718] (-689.021) (-689.339) (-690.132) * (-694.625) (-689.853) [-687.216] (-689.913) -- 0:00:46
257000 -- (-688.278) (-691.493) (-690.932) [-686.683] * (-689.476) (-686.104) [-686.842] (-689.121) -- 0:00:46
257500 -- [-688.356] (-689.510) (-687.829) (-689.337) * (-687.356) (-687.776) (-687.343) [-688.791] -- 0:00:46
258000 -- (-687.798) [-688.163] (-688.471) (-686.779) * (-689.341) [-690.263] (-689.033) (-687.465) -- 0:00:46
258500 -- (-687.267) [-688.739] (-687.271) (-688.779) * (-689.551) (-687.594) (-688.846) [-686.906] -- 0:00:45
259000 -- [-686.623] (-687.547) (-687.278) (-690.354) * (-689.966) (-687.926) (-689.646) [-687.571] -- 0:00:45
259500 -- (-690.932) [-686.982] (-689.617) (-688.315) * (-690.119) [-687.044] (-690.509) (-687.717) -- 0:00:45
260000 -- (-687.514) [-687.409] (-687.039) (-691.444) * (-688.372) [-687.281] (-688.009) (-689.821) -- 0:00:45
Average standard deviation of split frequencies: 0.012094
260500 -- (-688.028) (-687.374) [-687.472] (-687.361) * [-687.041] (-688.742) (-688.868) (-686.420) -- 0:00:48
261000 -- [-689.188] (-689.524) (-687.386) (-687.952) * (-686.476) [-687.689] (-689.445) (-688.894) -- 0:00:48
261500 -- (-691.045) (-686.761) [-689.860] (-687.138) * (-686.445) (-687.129) [-689.371] (-688.019) -- 0:00:48
262000 -- (-687.032) [-687.088] (-688.143) (-688.706) * (-689.219) (-687.182) [-687.666] (-689.615) -- 0:00:47
262500 -- [-687.196] (-686.513) (-688.953) (-690.901) * (-690.130) (-687.329) [-690.558] (-688.554) -- 0:00:47
263000 -- (-687.008) (-687.950) [-686.930] (-687.763) * (-695.713) (-688.675) (-688.033) [-686.661] -- 0:00:47
263500 -- [-686.309] (-687.652) (-687.863) (-689.334) * (-691.534) (-689.446) [-687.214] (-687.934) -- 0:00:47
264000 -- [-687.616] (-688.377) (-691.182) (-689.213) * [-686.798] (-687.674) (-688.324) (-687.046) -- 0:00:47
264500 -- (-688.344) (-689.153) (-688.479) [-688.531] * (-689.841) (-686.692) [-687.886] (-688.788) -- 0:00:47
265000 -- (-686.944) (-690.761) [-688.535] (-688.390) * (-689.300) (-687.117) [-689.601] (-688.287) -- 0:00:47
Average standard deviation of split frequencies: 0.011741
265500 -- [-687.054] (-690.871) (-689.553) (-689.269) * (-686.695) [-687.486] (-688.557) (-687.463) -- 0:00:47
266000 -- (-688.415) (-691.254) [-687.174] (-688.368) * [-689.362] (-688.926) (-688.202) (-688.618) -- 0:00:46
266500 -- (-689.089) (-691.526) (-691.530) [-688.414] * [-688.388] (-691.412) (-686.583) (-691.115) -- 0:00:46
267000 -- (-686.625) [-687.002] (-689.425) (-686.460) * [-687.446] (-689.681) (-689.163) (-691.079) -- 0:00:46
267500 -- (-687.446) [-686.330] (-689.934) (-688.003) * (-688.253) [-694.374] (-686.803) (-687.568) -- 0:00:46
268000 -- [-688.197] (-689.167) (-689.135) (-692.146) * [-688.195] (-694.945) (-686.625) (-687.316) -- 0:00:46
268500 -- (-688.158) (-692.203) (-690.693) [-686.152] * (-690.793) (-693.373) (-689.073) [-687.782] -- 0:00:46
269000 -- [-687.648] (-690.767) (-688.981) (-695.159) * [-690.323] (-690.644) (-686.615) (-686.501) -- 0:00:46
269500 -- [-688.284] (-688.613) (-688.467) (-691.671) * (-688.682) (-690.035) (-686.943) [-690.296] -- 0:00:46
270000 -- (-689.106) [-688.782] (-689.977) (-693.053) * (-690.515) (-692.104) (-688.753) [-687.713] -- 0:00:45
Average standard deviation of split frequencies: 0.011379
270500 -- (-686.488) (-688.316) [-687.454] (-693.842) * (-690.576) (-688.904) [-686.854] (-689.926) -- 0:00:45
271000 -- (-686.611) (-686.804) [-686.338] (-692.166) * (-688.239) [-690.323] (-686.623) (-688.695) -- 0:00:45
271500 -- (-686.516) (-687.580) (-690.455) [-689.516] * (-687.519) [-692.749] (-686.674) (-687.614) -- 0:00:45
272000 -- (-686.879) (-689.956) [-687.027] (-688.389) * (-687.139) (-693.468) [-687.369] (-688.971) -- 0:00:45
272500 -- [-686.443] (-690.857) (-688.792) (-688.863) * (-687.589) (-689.912) [-687.886] (-688.189) -- 0:00:45
273000 -- (-687.736) (-687.466) [-686.795] (-688.511) * [-691.019] (-687.194) (-688.416) (-687.107) -- 0:00:45
273500 -- [-687.492] (-688.304) (-690.021) (-688.860) * [-687.324] (-688.164) (-687.528) (-690.532) -- 0:00:45
274000 -- [-686.901] (-688.896) (-689.572) (-687.935) * (-686.630) (-689.861) [-688.847] (-689.500) -- 0:00:45
274500 -- [-687.307] (-692.764) (-687.948) (-692.720) * (-690.517) (-687.980) [-687.528] (-685.917) -- 0:00:44
275000 -- (-686.579) [-691.635] (-687.885) (-688.623) * (-695.090) [-689.305] (-687.181) (-687.625) -- 0:00:44
Average standard deviation of split frequencies: 0.011728
275500 -- (-686.803) (-688.108) (-688.134) [-686.668] * (-689.704) (-692.461) [-687.377] (-686.388) -- 0:00:44
276000 -- (-687.941) [-688.357] (-686.749) (-687.206) * (-687.122) [-693.239] (-692.313) (-689.258) -- 0:00:44
276500 -- (-688.035) (-690.457) [-688.168] (-687.130) * [-686.779] (-686.799) (-688.535) (-690.866) -- 0:00:44
277000 -- (-688.925) (-686.821) (-690.812) [-686.278] * (-686.852) (-686.531) [-688.763] (-690.278) -- 0:00:46
277500 -- [-686.960] (-690.769) (-687.808) (-691.711) * (-687.393) (-689.104) (-688.907) [-690.145] -- 0:00:46
278000 -- (-686.522) (-694.194) [-687.904] (-686.003) * (-689.341) (-689.107) (-688.302) [-689.365] -- 0:00:46
278500 -- (-687.595) (-692.111) (-689.173) [-687.805] * [-688.650] (-686.164) (-688.054) (-688.496) -- 0:00:46
279000 -- (-687.091) (-686.301) (-688.746) [-686.939] * [-687.944] (-688.298) (-689.460) (-689.086) -- 0:00:46
279500 -- (-687.807) (-687.755) (-686.178) [-688.030] * (-688.959) (-690.815) (-690.452) [-686.762] -- 0:00:46
280000 -- (-686.910) [-686.436] (-688.987) (-688.016) * (-687.246) (-686.616) [-688.676] (-687.588) -- 0:00:46
Average standard deviation of split frequencies: 0.011533
280500 -- [-691.037] (-688.067) (-687.097) (-686.993) * (-689.730) (-690.647) [-689.713] (-688.164) -- 0:00:46
281000 -- (-693.323) (-687.630) [-689.696] (-689.213) * (-687.910) [-687.727] (-688.350) (-689.495) -- 0:00:46
281500 -- (-687.676) [-687.269] (-687.590) (-686.567) * (-686.684) [-689.515] (-687.880) (-688.433) -- 0:00:45
282000 -- (-688.276) [-688.794] (-689.911) (-689.004) * (-688.048) [-688.803] (-687.641) (-692.388) -- 0:00:45
282500 -- (-691.808) (-687.775) [-688.068] (-690.604) * [-688.234] (-686.581) (-688.223) (-689.366) -- 0:00:45
283000 -- [-688.551] (-690.645) (-692.919) (-688.546) * (-687.210) (-687.808) (-688.663) [-688.540] -- 0:00:45
283500 -- [-686.369] (-693.204) (-692.279) (-688.146) * (-687.260) (-687.066) (-686.475) [-690.249] -- 0:00:45
284000 -- [-689.831] (-688.766) (-688.583) (-690.315) * [-686.915] (-689.082) (-687.006) (-689.002) -- 0:00:45
284500 -- (-687.474) [-686.902] (-689.119) (-690.228) * (-687.673) (-688.845) [-687.260] (-689.286) -- 0:00:45
285000 -- (-693.795) (-688.894) [-687.279] (-691.733) * (-687.174) (-691.996) [-687.693] (-690.029) -- 0:00:45
Average standard deviation of split frequencies: 0.010611
285500 -- (-689.192) (-688.527) (-690.119) [-692.608] * (-688.712) [-686.198] (-688.427) (-687.703) -- 0:00:45
286000 -- [-687.991] (-687.275) (-688.973) (-689.289) * [-688.236] (-688.417) (-688.107) (-687.905) -- 0:00:44
286500 -- (-687.047) (-687.272) [-687.703] (-688.233) * (-688.936) (-687.849) [-686.755] (-686.972) -- 0:00:44
287000 -- [-687.340] (-692.214) (-687.810) (-687.355) * (-695.302) (-687.498) (-687.535) [-687.044] -- 0:00:44
287500 -- [-687.723] (-687.999) (-695.311) (-689.699) * [-687.248] (-688.980) (-688.874) (-688.765) -- 0:00:44
288000 -- (-688.061) (-687.834) (-692.165) [-692.382] * (-688.095) (-687.258) (-688.624) [-691.593] -- 0:00:44
288500 -- (-690.068) (-688.177) (-690.543) [-687.156] * (-686.705) (-688.184) (-688.577) [-689.313] -- 0:00:44
289000 -- (-688.085) (-696.767) [-687.161] (-688.945) * (-690.463) (-690.963) [-689.012] (-689.876) -- 0:00:44
289500 -- (-689.957) [-688.633] (-687.361) (-690.911) * [-690.561] (-688.141) (-688.843) (-688.652) -- 0:00:44
290000 -- [-689.730] (-688.008) (-688.649) (-690.385) * (-691.558) (-689.251) (-687.069) [-687.045] -- 0:00:44
Average standard deviation of split frequencies: 0.010589
290500 -- (-690.612) (-687.297) (-693.567) [-688.141] * (-689.940) (-689.639) (-687.155) [-687.393] -- 0:00:43
291000 -- (-688.619) (-686.566) (-687.253) [-686.858] * (-688.920) (-689.096) [-686.289] (-686.580) -- 0:00:43
291500 -- (-690.574) (-687.203) (-689.943) [-691.619] * (-690.059) (-689.430) (-686.937) [-689.638] -- 0:00:43
292000 -- (-686.714) [-687.670] (-689.486) (-688.334) * (-689.235) (-690.858) [-689.886] (-688.793) -- 0:00:43
292500 -- (-688.569) (-690.005) [-688.868] (-687.264) * (-689.962) (-690.405) (-688.607) [-689.737] -- 0:00:43
293000 -- (-692.690) (-688.396) [-687.478] (-688.795) * (-687.410) (-689.134) (-692.322) [-687.808] -- 0:00:45
293500 -- (-687.243) (-689.132) (-688.218) [-689.044] * (-688.555) (-690.999) [-687.554] (-690.144) -- 0:00:45
294000 -- (-686.695) (-689.734) [-688.921] (-688.169) * [-686.778] (-692.943) (-690.507) (-687.951) -- 0:00:45
294500 -- (-686.952) [-686.839] (-690.001) (-688.655) * (-690.214) [-686.669] (-691.633) (-688.259) -- 0:00:45
295000 -- [-690.191] (-687.852) (-686.890) (-687.741) * (-689.412) [-686.929] (-686.457) (-689.341) -- 0:00:45
Average standard deviation of split frequencies: 0.010551
295500 -- (-688.209) (-689.159) [-686.498] (-686.970) * (-687.955) (-688.721) [-687.548] (-694.168) -- 0:00:45
296000 -- (-688.289) [-688.318] (-688.202) (-687.824) * [-688.724] (-688.372) (-690.554) (-687.940) -- 0:00:45
296500 -- (-687.965) [-687.985] (-687.881) (-689.486) * (-689.119) (-686.356) [-688.354] (-686.658) -- 0:00:45
297000 -- (-690.008) [-686.995] (-687.856) (-688.229) * (-688.181) [-689.782] (-687.017) (-686.778) -- 0:00:44
297500 -- (-690.945) (-689.858) (-690.192) [-688.268] * [-687.717] (-688.827) (-686.834) (-688.790) -- 0:00:44
298000 -- [-686.068] (-688.741) (-689.681) (-687.410) * [-687.237] (-687.805) (-688.985) (-687.373) -- 0:00:44
298500 -- (-688.112) (-686.154) [-686.700] (-687.997) * [-689.673] (-689.140) (-687.721) (-687.036) -- 0:00:44
299000 -- (-688.739) [-687.816] (-687.260) (-686.126) * (-687.837) (-688.449) (-686.737) [-687.132] -- 0:00:44
299500 -- [-695.090] (-687.243) (-692.191) (-686.221) * (-687.517) (-688.409) (-688.245) [-690.365] -- 0:00:44
300000 -- (-692.851) (-686.950) [-688.018] (-686.191) * (-691.621) (-687.927) [-691.201] (-688.195) -- 0:00:44
Average standard deviation of split frequencies: 0.010093
300500 -- (-687.396) [-687.184] (-689.779) (-686.388) * (-692.028) [-686.249] (-687.613) (-689.071) -- 0:00:44
301000 -- (-686.963) (-688.949) [-688.972] (-687.711) * [-687.458] (-687.800) (-691.005) (-688.144) -- 0:00:44
301500 -- (-688.153) [-687.741] (-688.685) (-688.623) * (-687.272) [-686.474] (-692.223) (-690.512) -- 0:00:44
302000 -- [-688.593] (-688.614) (-689.502) (-688.158) * [-687.776] (-688.122) (-696.391) (-688.781) -- 0:00:43
302500 -- [-690.345] (-691.083) (-688.508) (-690.948) * (-688.122) (-687.656) (-689.674) [-689.853] -- 0:00:43
303000 -- (-688.317) (-688.024) (-690.176) [-686.178] * [-686.649] (-689.329) (-687.822) (-687.623) -- 0:00:43
303500 -- [-690.323] (-691.405) (-687.527) (-688.884) * (-688.339) [-690.226] (-688.434) (-689.197) -- 0:00:43
304000 -- (-689.658) (-687.594) [-688.310] (-689.316) * (-687.787) (-688.111) (-687.738) [-687.561] -- 0:00:43
304500 -- (-687.924) (-689.053) (-688.857) [-686.572] * (-687.030) (-687.582) [-686.195] (-686.503) -- 0:00:43
305000 -- (-688.780) (-688.182) (-688.305) [-687.189] * (-686.886) (-689.723) [-688.093] (-688.009) -- 0:00:43
Average standard deviation of split frequencies: 0.010302
305500 -- (-688.451) [-687.376] (-692.659) (-689.708) * (-687.685) (-688.531) (-686.546) [-686.652] -- 0:00:43
306000 -- [-693.252] (-686.119) (-691.830) (-693.082) * (-689.008) (-691.419) (-687.660) [-687.921] -- 0:00:43
306500 -- (-690.160) (-686.129) (-689.917) [-687.921] * (-690.930) (-687.176) [-687.300] (-690.757) -- 0:00:42
307000 -- [-691.269] (-688.180) (-689.340) (-690.886) * (-691.857) (-686.617) (-687.067) [-690.630] -- 0:00:42
307500 -- (-691.897) (-688.543) [-686.972] (-690.780) * (-690.499) (-690.276) [-686.935] (-688.996) -- 0:00:42
308000 -- (-686.723) (-689.089) [-687.272] (-689.283) * [-692.420] (-689.573) (-690.959) (-694.359) -- 0:00:42
308500 -- [-689.975] (-692.437) (-688.326) (-689.282) * (-690.890) (-693.079) (-687.907) [-693.579] -- 0:00:42
309000 -- (-688.521) (-693.652) (-687.521) [-687.129] * (-686.554) [-689.087] (-688.003) (-695.231) -- 0:00:42
309500 -- (-687.762) (-686.925) (-687.405) [-686.585] * (-686.919) [-688.925] (-690.157) (-688.955) -- 0:00:44
310000 -- (-688.975) [-686.630] (-688.721) (-687.156) * (-686.384) [-687.527] (-687.787) (-686.959) -- 0:00:44
Average standard deviation of split frequencies: 0.010242
310500 -- (-687.169) (-686.750) (-687.835) [-686.953] * [-686.591] (-690.417) (-686.247) (-690.991) -- 0:00:44
311000 -- (-688.385) (-688.702) (-687.979) [-688.046] * (-687.427) [-686.946] (-687.669) (-688.623) -- 0:00:44
311500 -- [-688.266] (-694.270) (-687.643) (-689.364) * (-688.544) (-687.570) [-689.892] (-689.715) -- 0:00:44
312000 -- (-686.925) (-691.769) (-691.161) [-686.718] * [-687.169] (-687.519) (-691.405) (-688.208) -- 0:00:44
312500 -- [-688.124] (-689.959) (-690.039) (-688.023) * (-689.714) (-689.295) (-693.670) [-688.570] -- 0:00:44
313000 -- (-688.576) [-689.555] (-690.831) (-687.076) * (-687.503) (-688.975) [-696.620] (-687.937) -- 0:00:43
313500 -- (-687.933) (-689.464) [-693.139] (-689.621) * [-687.847] (-687.378) (-687.725) (-689.102) -- 0:00:43
314000 -- (-687.428) (-688.207) [-687.557] (-688.628) * [-686.013] (-688.657) (-690.568) (-687.879) -- 0:00:43
314500 -- (-687.480) (-688.329) [-687.468] (-689.316) * [-688.870] (-688.670) (-686.969) (-690.539) -- 0:00:43
315000 -- (-687.287) (-689.668) (-687.400) [-688.175] * (-688.884) (-691.661) (-687.518) [-687.668] -- 0:00:43
Average standard deviation of split frequencies: 0.010629
315500 -- [-687.359] (-688.937) (-686.557) (-690.164) * (-690.699) (-694.115) [-688.888] (-687.994) -- 0:00:43
316000 -- [-688.178] (-689.900) (-691.005) (-689.752) * (-689.080) (-688.021) (-686.748) [-687.343] -- 0:00:43
316500 -- (-687.291) (-687.039) [-689.171] (-687.456) * [-689.734] (-688.101) (-686.326) (-688.479) -- 0:00:43
317000 -- [-687.291] (-688.067) (-686.773) (-687.702) * [-687.445] (-686.982) (-686.366) (-687.413) -- 0:00:43
317500 -- [-686.868] (-691.640) (-687.059) (-689.054) * [-689.440] (-692.653) (-691.726) (-689.424) -- 0:00:42
318000 -- (-689.514) (-687.901) (-687.748) [-687.272] * (-687.907) [-689.080] (-689.257) (-689.909) -- 0:00:42
318500 -- (-690.060) (-687.048) (-687.335) [-689.330] * (-691.768) [-687.488] (-687.954) (-692.305) -- 0:00:42
319000 -- (-689.433) (-688.119) (-687.420) [-687.044] * [-689.600] (-687.803) (-687.199) (-688.119) -- 0:00:42
319500 -- [-686.396] (-690.778) (-692.115) (-687.314) * [-688.511] (-688.982) (-688.406) (-689.553) -- 0:00:42
320000 -- (-687.974) (-689.389) [-687.560] (-688.341) * (-690.026) [-688.867] (-689.487) (-691.493) -- 0:00:42
Average standard deviation of split frequencies: 0.009555
320500 -- [-690.247] (-688.699) (-691.996) (-688.928) * (-687.207) [-689.776] (-689.712) (-691.325) -- 0:00:42
321000 -- (-696.516) [-687.152] (-688.409) (-690.606) * (-687.142) (-687.327) [-688.861] (-686.456) -- 0:00:42
321500 -- (-689.396) [-688.980] (-688.269) (-690.779) * (-688.238) (-687.386) [-686.855] (-687.217) -- 0:00:42
322000 -- [-687.913] (-689.118) (-686.546) (-689.538) * (-687.607) (-687.726) (-692.000) [-687.564] -- 0:00:42
322500 -- (-688.574) (-688.218) (-689.226) [-687.728] * (-689.944) (-691.034) (-688.639) [-688.356] -- 0:00:42
323000 -- (-689.700) (-686.649) (-687.433) [-687.978] * (-691.797) [-687.818] (-689.346) (-687.600) -- 0:00:41
323500 -- (-687.159) [-686.602] (-693.046) (-686.388) * [-687.302] (-686.903) (-689.963) (-692.146) -- 0:00:41
324000 -- (-687.997) (-690.701) [-689.010] (-690.221) * [-687.798] (-689.096) (-687.581) (-689.517) -- 0:00:41
324500 -- (-689.511) [-690.013] (-686.514) (-689.611) * (-687.572) [-687.643] (-688.138) (-687.430) -- 0:00:41
325000 -- (-687.177) (-689.205) [-689.794] (-692.889) * (-687.318) [-688.410] (-692.711) (-689.203) -- 0:00:41
Average standard deviation of split frequencies: 0.009490
325500 -- (-687.149) (-689.609) [-688.486] (-686.934) * (-688.254) (-687.929) (-689.499) [-686.433] -- 0:00:43
326000 -- (-693.007) (-686.415) (-689.849) [-686.680] * (-687.656) (-689.610) (-692.046) [-686.127] -- 0:00:43
326500 -- (-692.010) [-686.991] (-688.175) (-691.237) * (-689.470) (-691.308) (-691.954) [-686.623] -- 0:00:43
327000 -- [-687.031] (-690.159) (-688.831) (-690.553) * (-687.693) [-688.347] (-690.140) (-687.418) -- 0:00:43
327500 -- [-686.814] (-686.534) (-689.591) (-692.082) * (-688.989) (-690.705) (-689.346) [-687.280] -- 0:00:43
328000 -- [-687.299] (-691.091) (-687.540) (-691.823) * (-686.439) [-686.467] (-688.030) (-688.701) -- 0:00:43
328500 -- [-688.082] (-688.300) (-691.141) (-687.099) * [-686.778] (-686.244) (-688.916) (-687.779) -- 0:00:42
329000 -- [-691.264] (-688.168) (-690.428) (-687.922) * (-686.211) (-687.282) [-686.652] (-689.470) -- 0:00:42
329500 -- (-688.275) (-687.666) (-688.580) [-688.458] * [-689.476] (-688.118) (-687.898) (-689.430) -- 0:00:42
330000 -- (-695.775) (-688.491) (-687.779) [-688.593] * (-689.195) [-686.389] (-687.572) (-686.987) -- 0:00:42
Average standard deviation of split frequencies: 0.010930
330500 -- [-690.113] (-689.854) (-689.519) (-687.801) * (-691.760) [-686.219] (-687.552) (-688.007) -- 0:00:42
331000 -- (-686.199) [-692.314] (-689.186) (-690.135) * [-691.604] (-686.401) (-688.126) (-689.530) -- 0:00:42
331500 -- (-686.967) (-686.926) [-689.538] (-687.794) * (-689.627) [-690.473] (-687.315) (-687.831) -- 0:00:42
332000 -- (-686.609) (-688.287) (-689.033) [-687.439] * (-686.877) (-688.399) [-688.867] (-687.922) -- 0:00:42
332500 -- (-687.728) (-686.736) (-691.626) [-686.893] * (-686.792) [-691.567] (-687.250) (-688.377) -- 0:00:42
333000 -- (-688.934) (-689.684) [-688.820] (-692.654) * (-687.690) (-688.275) (-692.651) [-686.093] -- 0:00:42
333500 -- [-687.308] (-690.651) (-687.486) (-687.247) * (-687.309) (-687.756) [-687.007] (-688.168) -- 0:00:41
334000 -- (-687.837) [-687.585] (-688.417) (-687.839) * [-687.215] (-690.641) (-689.066) (-688.748) -- 0:00:41
334500 -- [-690.406] (-690.175) (-692.862) (-687.226) * (-688.033) [-687.174] (-688.419) (-690.415) -- 0:00:41
335000 -- (-690.682) [-687.133] (-689.541) (-686.386) * [-691.168] (-686.407) (-687.853) (-688.973) -- 0:00:41
Average standard deviation of split frequencies: 0.010347
335500 -- [-692.351] (-687.790) (-688.810) (-688.515) * (-691.982) (-687.752) [-687.618] (-688.422) -- 0:00:41
336000 -- (-688.770) (-689.240) (-687.359) [-688.037] * (-688.406) [-692.083] (-687.235) (-688.172) -- 0:00:41
336500 -- (-689.440) (-688.783) [-692.042] (-687.537) * (-693.608) (-692.408) (-688.255) [-686.581] -- 0:00:41
337000 -- [-687.966] (-689.441) (-695.142) (-687.907) * (-688.896) (-689.742) (-692.558) [-686.120] -- 0:00:41
337500 -- (-688.789) [-689.025] (-687.423) (-687.579) * (-690.026) (-689.178) (-687.360) [-686.461] -- 0:00:41
338000 -- (-687.512) [-687.584] (-686.939) (-689.613) * [-690.045] (-689.873) (-691.463) (-689.906) -- 0:00:41
338500 -- [-688.744] (-690.047) (-692.678) (-688.567) * (-690.663) (-688.396) [-688.541] (-694.628) -- 0:00:41
339000 -- (-690.398) [-687.995] (-686.096) (-687.806) * [-690.242] (-688.545) (-690.505) (-691.553) -- 0:00:40
339500 -- (-689.541) (-687.569) [-687.099] (-687.972) * (-692.274) [-687.867] (-687.518) (-687.768) -- 0:00:40
340000 -- (-690.820) (-689.748) (-686.181) [-688.217] * (-688.928) [-687.291] (-688.628) (-690.041) -- 0:00:40
Average standard deviation of split frequencies: 0.010897
340500 -- (-688.942) (-688.992) [-686.826] (-691.272) * (-690.930) (-686.805) (-690.739) [-688.534] -- 0:00:40
341000 -- (-691.830) (-694.933) [-690.276] (-690.590) * (-690.668) (-689.306) (-686.836) [-690.060] -- 0:00:40
341500 -- [-690.657] (-688.007) (-686.985) (-687.097) * [-688.777] (-693.050) (-687.068) (-689.429) -- 0:00:40
342000 -- (-689.626) [-688.958] (-686.712) (-687.105) * (-687.287) (-694.132) [-687.212] (-689.987) -- 0:00:42
342500 -- (-690.315) (-688.301) (-686.170) [-687.851] * (-687.485) (-692.018) (-689.237) [-687.070] -- 0:00:42
343000 -- [-688.220] (-687.141) (-692.817) (-690.721) * [-687.422] (-686.632) (-687.253) (-689.088) -- 0:00:42
343500 -- (-687.694) [-687.038] (-688.011) (-691.574) * (-687.246) (-689.246) [-687.644] (-689.062) -- 0:00:42
344000 -- (-689.322) [-686.788] (-689.692) (-686.924) * (-689.129) (-687.334) [-686.072] (-690.248) -- 0:00:41
344500 -- (-691.423) [-687.904] (-691.479) (-694.389) * (-689.559) (-686.642) [-687.453] (-688.238) -- 0:00:41
345000 -- (-689.515) (-687.348) (-686.998) [-686.855] * (-686.149) [-689.151] (-690.481) (-687.899) -- 0:00:41
Average standard deviation of split frequencies: 0.010559
345500 -- (-688.553) (-687.223) (-687.562) [-687.171] * [-686.337] (-689.918) (-690.952) (-690.176) -- 0:00:41
346000 -- [-687.837] (-689.551) (-688.104) (-688.620) * (-689.591) (-688.806) (-689.682) [-688.861] -- 0:00:41
346500 -- (-690.397) [-688.552] (-687.013) (-688.735) * (-691.505) (-687.087) (-691.926) [-688.375] -- 0:00:41
347000 -- (-686.812) (-691.097) [-689.746] (-688.712) * (-687.051) (-690.141) (-690.532) [-686.576] -- 0:00:41
347500 -- (-687.330) (-688.525) (-687.867) [-688.259] * [-690.357] (-687.924) (-695.172) (-690.419) -- 0:00:41
348000 -- (-688.504) (-687.146) (-686.842) [-691.422] * (-687.216) (-686.601) [-689.493] (-690.576) -- 0:00:41
348500 -- (-687.658) (-687.139) [-689.704] (-689.644) * [-690.507] (-690.395) (-691.502) (-689.633) -- 0:00:41
349000 -- (-692.913) (-689.204) [-689.107] (-693.158) * (-689.538) [-686.773] (-688.927) (-688.878) -- 0:00:41
349500 -- (-687.412) (-689.657) [-688.476] (-690.809) * (-691.280) [-689.358] (-687.284) (-688.735) -- 0:00:40
350000 -- [-689.383] (-693.641) (-688.422) (-688.495) * [-694.009] (-689.548) (-688.740) (-687.098) -- 0:00:40
Average standard deviation of split frequencies: 0.009589
350500 -- (-690.243) (-692.233) (-689.087) [-690.448] * (-692.412) (-690.137) (-688.977) [-689.808] -- 0:00:40
351000 -- (-691.029) [-686.417] (-688.001) (-691.479) * (-687.713) (-689.328) (-687.446) [-688.959] -- 0:00:40
351500 -- (-703.696) [-689.032] (-688.897) (-693.913) * (-686.564) (-687.728) [-687.540] (-688.093) -- 0:00:40
352000 -- [-690.579] (-689.185) (-686.558) (-694.284) * (-686.636) [-687.304] (-687.363) (-688.143) -- 0:00:40
352500 -- (-688.882) (-688.570) (-689.055) [-689.831] * (-687.840) [-687.801] (-688.786) (-686.468) -- 0:00:40
353000 -- (-688.082) (-688.066) (-686.724) [-687.412] * (-691.694) (-690.657) (-687.662) [-686.634] -- 0:00:40
353500 -- (-687.977) (-689.093) (-686.093) [-687.098] * (-690.216) [-687.689] (-686.735) (-686.795) -- 0:00:40
354000 -- (-689.208) (-689.841) (-688.850) [-687.725] * (-687.750) (-689.413) [-686.270] (-687.988) -- 0:00:40
354500 -- (-688.728) [-687.041] (-689.142) (-689.964) * (-686.484) [-686.614] (-689.908) (-688.910) -- 0:00:40
355000 -- (-687.560) [-687.525] (-686.650) (-689.280) * (-686.737) (-691.028) (-686.816) [-689.222] -- 0:00:39
Average standard deviation of split frequencies: 0.009799
355500 -- (-688.853) [-687.541] (-686.575) (-687.996) * (-688.295) [-688.080] (-686.309) (-689.418) -- 0:00:39
356000 -- (-688.420) (-687.503) (-692.658) [-688.554] * [-688.175] (-690.108) (-689.560) (-690.036) -- 0:00:39
356500 -- (-688.223) (-687.682) [-686.872] (-688.107) * (-689.011) (-689.662) (-687.690) [-689.055] -- 0:00:39
357000 -- (-687.519) (-689.122) (-690.275) [-687.567] * (-691.281) [-689.071] (-686.352) (-690.078) -- 0:00:39
357500 -- [-687.221] (-690.601) (-690.900) (-688.545) * (-689.234) (-688.606) [-687.126] (-686.456) -- 0:00:39
358000 -- [-687.864] (-688.476) (-687.452) (-686.995) * (-692.768) (-687.394) (-688.905) [-690.062] -- 0:00:39
358500 -- (-690.600) [-690.614] (-688.075) (-688.956) * (-687.892) [-688.105] (-690.672) (-690.964) -- 0:00:41
359000 -- (-690.184) (-689.182) [-690.869] (-687.597) * (-689.769) (-690.934) [-686.497] (-690.357) -- 0:00:41
359500 -- (-689.481) (-692.141) [-687.146] (-687.404) * (-687.592) (-689.173) [-686.968] (-689.036) -- 0:00:40
360000 -- (-690.122) (-690.217) (-687.663) [-686.674] * (-687.174) [-689.970] (-686.151) (-689.037) -- 0:00:40
Average standard deviation of split frequencies: 0.010979
360500 -- (-690.959) [-686.411] (-687.358) (-689.803) * [-687.141] (-687.635) (-687.028) (-688.676) -- 0:00:40
361000 -- [-688.638] (-688.506) (-689.086) (-689.364) * (-689.657) (-686.479) [-687.845] (-688.448) -- 0:00:40
361500 -- [-690.608] (-690.292) (-688.853) (-690.453) * [-686.889] (-687.240) (-687.139) (-689.315) -- 0:00:40
362000 -- (-687.105) (-689.464) (-688.239) [-688.226] * (-690.221) (-687.798) [-688.226] (-688.843) -- 0:00:40
362500 -- (-687.042) (-687.514) [-688.571] (-688.287) * [-687.200] (-688.910) (-692.227) (-688.116) -- 0:00:40
363000 -- (-691.114) (-686.550) (-686.607) [-688.331] * (-687.634) (-688.089) [-688.031] (-688.373) -- 0:00:40
363500 -- [-688.475] (-686.654) (-688.732) (-688.851) * (-686.816) (-688.582) [-691.422] (-692.919) -- 0:00:40
364000 -- (-688.239) (-687.475) [-690.072] (-688.235) * (-687.627) (-686.930) [-688.261] (-690.338) -- 0:00:40
364500 -- (-690.385) (-688.323) (-689.838) [-689.697] * (-688.600) [-690.919] (-687.942) (-691.691) -- 0:00:40
365000 -- (-691.256) (-691.117) (-693.147) [-688.215] * (-688.523) [-690.421] (-687.215) (-689.590) -- 0:00:40
Average standard deviation of split frequencies: 0.010062
365500 -- [-687.729] (-687.047) (-688.340) (-688.037) * [-692.327] (-689.305) (-690.766) (-688.905) -- 0:00:39
366000 -- (-691.489) (-692.641) (-687.776) [-690.234] * (-692.090) [-686.950] (-687.546) (-688.765) -- 0:00:39
366500 -- (-687.162) (-691.087) [-687.424] (-688.910) * (-688.086) [-688.628] (-688.094) (-688.802) -- 0:00:39
367000 -- [-689.127] (-690.984) (-691.967) (-689.541) * (-692.251) (-688.276) (-689.516) [-690.000] -- 0:00:39
367500 -- (-687.833) [-689.048] (-691.608) (-689.247) * (-687.208) (-687.189) (-691.838) [-686.402] -- 0:00:39
368000 -- [-687.491] (-687.995) (-687.635) (-686.943) * (-690.173) (-688.302) (-688.853) [-687.791] -- 0:00:39
368500 -- (-686.564) [-689.955] (-688.121) (-687.989) * (-689.966) (-686.966) [-687.859] (-690.194) -- 0:00:39
369000 -- (-687.257) [-686.773] (-690.490) (-688.038) * (-689.509) [-689.300] (-687.731) (-687.875) -- 0:00:39
369500 -- (-688.381) (-689.602) (-686.921) [-687.201] * (-687.781) (-691.056) (-688.780) [-687.370] -- 0:00:39
370000 -- (-688.770) [-688.361] (-687.772) (-687.637) * [-687.468] (-691.171) (-687.483) (-686.287) -- 0:00:39
Average standard deviation of split frequencies: 0.009538
370500 -- (-688.841) (-689.645) [-687.458] (-686.105) * (-688.923) (-689.232) (-690.475) [-687.806] -- 0:00:39
371000 -- (-687.428) (-687.879) (-687.679) [-686.126] * (-691.989) (-688.444) [-687.550] (-688.840) -- 0:00:38
371500 -- [-688.658] (-688.926) (-687.423) (-688.565) * (-688.272) (-687.564) [-687.223] (-688.540) -- 0:00:38
372000 -- (-687.702) [-686.905] (-689.475) (-687.378) * (-690.167) (-686.617) (-688.757) [-686.399] -- 0:00:38
372500 -- [-687.687] (-690.166) (-691.201) (-686.420) * (-688.355) [-686.566] (-686.699) (-687.962) -- 0:00:38
373000 -- (-687.822) (-690.284) [-689.584] (-689.209) * (-690.182) (-687.679) (-687.631) [-687.835] -- 0:00:38
373500 -- [-688.868] (-686.623) (-691.812) (-691.519) * (-689.651) (-687.817) (-688.154) [-687.499] -- 0:00:38
374000 -- [-689.007] (-685.889) (-689.182) (-690.264) * (-688.070) (-687.748) [-690.962] (-688.007) -- 0:00:38
374500 -- (-686.967) (-689.840) (-687.540) [-689.309] * [-686.728] (-688.750) (-693.149) (-687.277) -- 0:00:38
375000 -- (-686.199) (-688.040) (-688.327) [-687.848] * (-688.184) (-686.385) (-687.768) [-688.528] -- 0:00:40
Average standard deviation of split frequencies: 0.008609
375500 -- (-686.819) [-686.302] (-689.469) (-686.183) * (-689.943) (-686.751) (-690.466) [-687.481] -- 0:00:39
376000 -- (-688.102) (-687.906) (-688.326) [-688.219] * (-687.076) (-691.750) (-690.545) [-692.168] -- 0:00:39
376500 -- [-687.521] (-686.061) (-688.291) (-688.631) * (-689.424) [-690.994] (-687.803) (-688.654) -- 0:00:39
377000 -- (-688.678) [-690.312] (-688.288) (-691.499) * (-687.816) (-690.632) (-687.566) [-688.122] -- 0:00:39
377500 -- (-686.316) [-686.650] (-686.390) (-688.989) * (-687.682) [-689.705] (-686.957) (-691.865) -- 0:00:39
378000 -- (-688.480) (-688.549) [-688.155] (-691.513) * (-690.034) [-688.716] (-689.432) (-695.507) -- 0:00:39
378500 -- (-686.879) (-686.106) [-690.839] (-687.867) * (-687.509) (-689.076) (-690.195) [-692.232] -- 0:00:39
379000 -- (-688.450) (-687.039) (-688.090) [-686.802] * [-688.601] (-688.848) (-689.773) (-686.723) -- 0:00:39
379500 -- (-691.909) (-690.737) [-686.812] (-688.140) * (-687.985) (-688.645) (-695.012) [-690.964] -- 0:00:39
380000 -- (-689.025) [-688.812] (-691.091) (-686.741) * (-689.917) (-688.693) (-691.315) [-689.715] -- 0:00:39
Average standard deviation of split frequencies: 0.007760
380500 -- [-690.706] (-689.365) (-693.165) (-688.304) * (-690.725) (-689.297) [-689.544] (-688.307) -- 0:00:39
381000 -- (-694.259) [-688.898] (-687.283) (-688.470) * (-689.041) (-689.035) [-687.417] (-689.165) -- 0:00:38
381500 -- (-687.730) (-689.601) (-692.597) [-689.400] * (-689.628) (-695.056) (-693.640) [-686.760] -- 0:00:38
382000 -- (-691.585) (-688.813) (-692.713) [-686.553] * [-688.925] (-689.939) (-694.745) (-688.218) -- 0:00:38
382500 -- (-688.732) (-687.669) (-690.130) [-686.764] * (-687.267) (-687.524) (-689.263) [-687.503] -- 0:00:38
383000 -- (-688.133) [-689.286] (-693.040) (-686.307) * (-687.158) (-686.732) (-687.040) [-688.037] -- 0:00:38
383500 -- (-687.716) (-688.011) [-688.248] (-689.685) * (-687.119) (-688.533) (-689.737) [-688.578] -- 0:00:38
384000 -- (-686.789) (-688.749) (-689.971) [-687.161] * [-686.695] (-688.514) (-689.953) (-689.411) -- 0:00:38
384500 -- (-687.634) (-691.763) [-689.954] (-688.815) * (-688.215) (-692.864) (-688.901) [-687.566] -- 0:00:38
385000 -- (-690.055) (-687.211) [-693.276] (-688.316) * (-688.308) [-694.516] (-688.371) (-686.861) -- 0:00:38
Average standard deviation of split frequencies: 0.008467
385500 -- (-688.789) (-687.088) (-690.700) [-686.951] * (-688.050) [-691.851] (-688.864) (-689.298) -- 0:00:38
386000 -- (-689.267) [-687.575] (-689.122) (-686.525) * (-688.545) [-686.835] (-689.587) (-688.206) -- 0:00:38
386500 -- (-688.704) (-686.237) (-689.885) [-686.855] * (-691.462) (-687.230) [-688.339] (-687.511) -- 0:00:38
387000 -- [-686.246] (-688.695) (-688.256) (-687.179) * (-687.653) (-690.907) [-686.320] (-691.031) -- 0:00:38
387500 -- (-687.319) (-687.358) [-688.025] (-688.764) * [-686.716] (-687.945) (-688.168) (-693.552) -- 0:00:37
388000 -- [-687.256] (-687.055) (-691.679) (-690.392) * (-688.297) [-687.879] (-686.913) (-687.257) -- 0:00:37
388500 -- [-686.555] (-691.098) (-689.859) (-686.991) * (-688.319) (-688.854) [-688.287] (-687.663) -- 0:00:37
389000 -- (-687.215) (-690.330) [-690.156] (-687.412) * (-689.257) (-688.796) (-689.496) [-687.355] -- 0:00:37
389500 -- [-689.106] (-691.106) (-687.397) (-686.648) * (-687.067) [-687.121] (-687.886) (-688.903) -- 0:00:37
390000 -- (-688.928) (-689.299) [-687.102] (-686.428) * (-688.810) (-686.548) (-688.109) [-689.692] -- 0:00:37
Average standard deviation of split frequencies: 0.008598
390500 -- [-688.765] (-687.940) (-689.659) (-688.351) * [-686.666] (-691.368) (-686.096) (-689.557) -- 0:00:37
391000 -- (-688.719) (-690.981) (-689.950) [-688.643] * (-689.212) (-688.396) [-688.854] (-688.734) -- 0:00:37
391500 -- (-687.440) (-691.903) (-689.155) [-686.026] * [-689.322] (-691.172) (-691.916) (-687.986) -- 0:00:38
392000 -- (-691.754) (-693.088) [-688.116] (-687.930) * (-687.137) (-689.893) (-691.044) [-686.553] -- 0:00:38
392500 -- (-686.551) [-689.895] (-688.286) (-686.537) * [-689.788] (-691.036) (-687.704) (-688.288) -- 0:00:38
393000 -- [-686.929] (-688.747) (-690.283) (-690.990) * (-688.521) [-687.526] (-688.023) (-687.095) -- 0:00:38
393500 -- (-687.720) [-688.536] (-687.457) (-691.132) * (-686.760) [-687.104] (-689.346) (-686.509) -- 0:00:38
394000 -- (-690.036) (-688.076) (-689.149) [-686.893] * [-688.488] (-692.618) (-687.940) (-689.492) -- 0:00:38
394500 -- (-688.108) (-687.672) [-688.220] (-688.309) * [-691.963] (-688.522) (-688.061) (-694.621) -- 0:00:38
395000 -- (-690.599) [-688.921] (-692.381) (-689.581) * (-689.857) [-686.542] (-688.177) (-689.915) -- 0:00:38
Average standard deviation of split frequencies: 0.008110
395500 -- (-688.992) (-688.413) [-692.392] (-690.695) * (-691.811) (-688.599) [-687.808] (-691.751) -- 0:00:38
396000 -- (-687.737) (-687.864) [-687.980] (-686.861) * [-686.281] (-687.444) (-687.389) (-688.722) -- 0:00:38
396500 -- (-686.971) [-687.678] (-694.042) (-686.860) * (-686.990) (-687.642) (-686.852) [-690.894] -- 0:00:38
397000 -- [-687.981] (-691.266) (-690.190) (-686.019) * [-686.887] (-690.750) (-693.474) (-689.000) -- 0:00:37
397500 -- (-689.204) (-694.011) (-689.711) [-686.795] * [-686.310] (-687.205) (-686.896) (-688.072) -- 0:00:37
398000 -- [-691.043] (-689.362) (-693.034) (-688.718) * (-688.110) [-686.983] (-688.199) (-687.761) -- 0:00:37
398500 -- (-689.037) [-687.437] (-688.451) (-687.412) * (-687.474) (-688.689) (-686.781) [-686.966] -- 0:00:37
399000 -- (-687.029) [-689.102] (-686.696) (-688.250) * (-690.951) [-692.735] (-687.696) (-693.837) -- 0:00:37
399500 -- [-688.720] (-689.359) (-685.967) (-686.988) * (-689.080) [-690.361] (-688.175) (-688.806) -- 0:00:37
400000 -- (-689.220) [-689.230] (-687.264) (-687.532) * (-691.672) (-689.892) (-686.414) [-691.808] -- 0:00:37
Average standard deviation of split frequencies: 0.008824
400500 -- (-689.784) [-687.584] (-690.029) (-687.661) * (-688.070) (-687.687) [-689.321] (-689.255) -- 0:00:37
401000 -- (-688.467) (-688.820) [-689.013] (-686.142) * (-687.714) (-687.089) (-686.391) [-686.776] -- 0:00:37
401500 -- (-691.863) [-686.777] (-692.869) (-688.837) * [-687.021] (-687.407) (-688.233) (-690.557) -- 0:00:37
402000 -- [-687.186] (-687.510) (-690.084) (-686.479) * (-686.880) (-690.219) [-687.637] (-692.032) -- 0:00:37
402500 -- (-689.025) (-689.341) (-686.912) [-686.263] * (-688.353) [-689.455] (-687.099) (-692.875) -- 0:00:37
403000 -- (-691.368) (-692.200) [-689.039] (-687.430) * (-690.101) [-688.569] (-688.283) (-686.536) -- 0:00:37
403500 -- [-686.979] (-691.494) (-687.141) (-687.430) * (-689.074) (-689.499) (-689.113) [-686.874] -- 0:00:36
404000 -- (-688.696) (-691.313) [-686.587] (-686.695) * (-693.198) (-689.038) [-686.154] (-686.422) -- 0:00:36
404500 -- (-687.819) [-688.842] (-687.531) (-687.629) * (-687.958) (-692.513) [-687.136] (-689.792) -- 0:00:36
405000 -- (-688.897) [-687.253] (-690.504) (-688.209) * [-687.594] (-690.856) (-686.942) (-686.403) -- 0:00:36
Average standard deviation of split frequencies: 0.008781
405500 -- (-691.135) (-686.579) (-688.236) [-691.158] * (-687.667) (-686.780) [-686.088] (-686.620) -- 0:00:36
406000 -- [-686.371] (-686.366) (-687.197) (-687.686) * [-688.838] (-687.155) (-688.884) (-687.228) -- 0:00:36
406500 -- [-689.467] (-686.521) (-686.840) (-692.967) * (-688.172) [-692.463] (-692.284) (-687.644) -- 0:00:36
407000 -- (-688.195) (-687.750) [-687.715] (-687.650) * [-686.897] (-686.414) (-687.375) (-690.034) -- 0:00:36
407500 -- [-691.535] (-690.112) (-686.600) (-686.825) * (-686.779) [-688.177] (-690.707) (-687.330) -- 0:00:37
408000 -- [-687.109] (-687.473) (-686.194) (-694.330) * (-686.315) (-686.805) [-689.146] (-689.386) -- 0:00:37
408500 -- (-688.557) [-687.331] (-687.722) (-689.101) * (-686.725) (-687.873) (-690.147) [-686.824] -- 0:00:37
409000 -- [-688.307] (-686.656) (-688.713) (-688.815) * (-687.162) (-687.440) (-688.488) [-687.728] -- 0:00:37
409500 -- (-690.192) (-687.234) (-689.815) [-688.132] * [-686.998] (-688.215) (-691.473) (-686.793) -- 0:00:37
410000 -- [-687.030] (-689.387) (-688.752) (-687.969) * (-689.283) (-689.069) (-687.947) [-687.519] -- 0:00:37
Average standard deviation of split frequencies: 0.009398
410500 -- (-686.283) [-687.111] (-687.548) (-686.342) * (-686.883) (-688.372) [-690.016] (-687.187) -- 0:00:37
411000 -- [-690.447] (-687.390) (-688.939) (-688.132) * [-689.018] (-690.503) (-690.700) (-687.776) -- 0:00:37
411500 -- (-694.267) (-687.930) [-688.437] (-688.143) * (-686.939) (-688.333) [-694.782] (-689.252) -- 0:00:37
412000 -- (-689.743) [-689.357] (-688.496) (-688.333) * [-689.168] (-689.937) (-692.682) (-689.734) -- 0:00:37
412500 -- (-689.639) (-688.974) [-688.438] (-689.032) * (-690.937) (-690.222) (-687.645) [-688.189] -- 0:00:37
413000 -- (-686.560) [-687.882] (-689.883) (-687.540) * [-688.050] (-692.983) (-688.803) (-686.172) -- 0:00:36
413500 -- (-691.561) (-688.699) (-689.831) [-688.439] * (-689.570) [-692.071] (-688.701) (-690.327) -- 0:00:36
414000 -- [-691.557] (-687.723) (-690.958) (-689.228) * (-689.960) (-689.938) [-689.305] (-687.548) -- 0:00:36
414500 -- (-687.436) (-686.329) [-688.167] (-689.205) * (-688.988) (-691.451) [-689.556] (-686.505) -- 0:00:36
415000 -- (-688.295) (-689.207) [-691.284] (-686.697) * [-687.800] (-688.514) (-689.946) (-687.820) -- 0:00:36
Average standard deviation of split frequencies: 0.010048
415500 -- (-686.444) (-686.708) (-687.647) [-687.735] * (-687.507) (-688.643) (-688.322) [-688.773] -- 0:00:36
416000 -- (-688.749) [-688.769] (-689.489) (-689.084) * (-687.799) [-687.364] (-691.849) (-691.486) -- 0:00:36
416500 -- (-688.200) (-688.059) (-689.546) [-687.076] * (-687.010) (-690.745) [-687.949] (-689.107) -- 0:00:36
417000 -- [-686.197] (-688.248) (-687.605) (-690.862) * [-687.385] (-691.364) (-687.382) (-688.796) -- 0:00:36
417500 -- (-688.681) (-688.158) [-689.112] (-688.170) * [-688.738] (-689.786) (-688.979) (-686.980) -- 0:00:36
418000 -- [-688.035] (-686.619) (-687.862) (-686.531) * (-687.180) [-688.629] (-686.778) (-688.506) -- 0:00:36
418500 -- (-699.210) (-686.309) [-687.902] (-689.770) * [-687.955] (-689.160) (-689.123) (-691.912) -- 0:00:36
419000 -- (-686.703) (-686.346) [-686.267] (-690.470) * (-689.426) (-687.883) [-688.932] (-689.739) -- 0:00:36
419500 -- [-686.516] (-686.327) (-690.424) (-689.190) * (-689.065) (-688.256) (-690.870) [-689.426] -- 0:00:35
420000 -- (-687.588) [-686.374] (-692.316) (-687.275) * (-688.336) [-687.573] (-687.338) (-687.957) -- 0:00:35
Average standard deviation of split frequencies: 0.009861
420500 -- (-688.499) (-686.406) [-688.770] (-688.131) * (-687.812) (-694.312) [-687.357] (-688.703) -- 0:00:35
421000 -- (-688.364) [-687.825] (-687.368) (-687.331) * (-687.553) (-687.302) [-686.652] (-689.010) -- 0:00:35
421500 -- (-687.371) [-686.446] (-687.374) (-687.562) * [-689.539] (-690.704) (-686.867) (-687.634) -- 0:00:35
422000 -- (-688.844) (-687.903) [-686.490] (-687.577) * (-691.241) (-690.147) (-690.825) [-687.313] -- 0:00:35
422500 -- (-687.589) (-689.254) [-686.490] (-691.833) * (-690.617) (-688.538) [-690.146] (-691.498) -- 0:00:35
423000 -- [-688.234] (-690.555) (-686.825) (-687.168) * (-690.613) (-689.256) (-690.284) [-687.255] -- 0:00:35
423500 -- (-688.956) (-689.740) (-687.164) [-688.150] * (-688.672) (-686.316) [-689.347] (-688.627) -- 0:00:35
424000 -- (-690.128) (-691.194) [-686.615] (-692.948) * (-690.203) [-687.169] (-697.614) (-688.842) -- 0:00:36
424500 -- (-687.157) [-689.453] (-688.075) (-693.960) * (-689.300) (-690.561) [-689.000] (-688.622) -- 0:00:36
425000 -- (-688.003) (-686.929) (-689.136) [-691.749] * (-687.808) [-689.445] (-690.077) (-688.098) -- 0:00:36
Average standard deviation of split frequencies: 0.009222
425500 -- [-688.912] (-689.148) (-687.922) (-689.706) * (-687.518) [-690.636] (-690.270) (-687.917) -- 0:00:36
426000 -- (-689.185) (-688.271) [-686.228] (-691.730) * (-689.787) [-688.341] (-689.006) (-686.704) -- 0:00:36
426500 -- (-689.569) [-687.113] (-687.618) (-686.609) * (-689.122) [-689.510] (-698.047) (-686.411) -- 0:00:36
427000 -- (-686.735) [-688.295] (-689.728) (-689.643) * [-688.405] (-692.607) (-688.311) (-692.072) -- 0:00:36
427500 -- [-688.383] (-687.391) (-688.667) (-686.912) * [-688.136] (-690.264) (-687.982) (-689.113) -- 0:00:36
428000 -- [-690.373] (-688.531) (-692.485) (-688.482) * (-691.398) (-690.745) (-690.962) [-688.147] -- 0:00:36
428500 -- (-692.082) [-687.181] (-691.575) (-687.055) * (-687.001) [-691.218] (-693.376) (-689.428) -- 0:00:36
429000 -- (-688.260) (-687.795) [-686.418] (-688.136) * (-687.153) (-688.623) (-687.803) [-687.244] -- 0:00:35
429500 -- (-688.478) (-690.654) [-686.670] (-687.304) * (-688.989) (-688.524) (-689.418) [-688.204] -- 0:00:35
430000 -- (-688.105) [-687.581] (-689.953) (-687.234) * (-688.348) (-688.287) (-693.223) [-690.436] -- 0:00:35
Average standard deviation of split frequencies: 0.009705
430500 -- (-688.899) (-690.122) (-688.272) [-688.271] * (-686.935) (-691.363) (-688.171) [-687.819] -- 0:00:35
431000 -- (-689.810) [-688.358] (-687.011) (-689.004) * [-687.031] (-695.161) (-686.377) (-687.276) -- 0:00:35
431500 -- (-692.522) [-689.873] (-689.493) (-686.375) * [-687.933] (-692.059) (-687.927) (-686.933) -- 0:00:35
432000 -- (-690.198) (-689.433) (-687.275) [-686.150] * (-692.072) [-690.495] (-686.692) (-689.165) -- 0:00:35
432500 -- (-691.027) (-687.738) [-691.375] (-687.070) * (-686.910) [-688.026] (-687.973) (-688.197) -- 0:00:35
433000 -- (-688.778) [-691.820] (-687.991) (-686.811) * (-687.090) (-687.043) [-688.815] (-690.029) -- 0:00:35
433500 -- (-690.531) [-688.678] (-687.998) (-687.787) * (-687.421) [-691.619] (-686.361) (-688.228) -- 0:00:35
434000 -- [-686.377] (-689.864) (-687.090) (-691.437) * (-690.585) [-689.206] (-688.285) (-688.042) -- 0:00:35
434500 -- [-686.962] (-689.193) (-689.294) (-688.525) * (-688.025) (-687.747) [-687.306] (-686.689) -- 0:00:35
435000 -- (-687.467) [-688.863] (-691.486) (-690.109) * [-686.877] (-687.751) (-693.042) (-687.262) -- 0:00:35
Average standard deviation of split frequencies: 0.010380
435500 -- (-686.724) [-688.166] (-688.972) (-688.993) * (-686.404) (-686.657) (-689.346) [-687.512] -- 0:00:34
436000 -- (-687.739) (-690.610) [-686.688] (-688.478) * (-687.214) (-688.271) (-689.365) [-687.502] -- 0:00:34
436500 -- [-689.390] (-691.199) (-687.551) (-689.811) * (-687.083) (-689.464) [-688.428] (-688.073) -- 0:00:34
437000 -- (-690.796) (-688.902) (-688.404) [-689.300] * (-687.766) [-686.340] (-688.851) (-687.031) -- 0:00:34
437500 -- (-691.241) (-687.376) [-687.504] (-689.696) * (-691.150) (-689.515) [-688.172] (-688.212) -- 0:00:34
438000 -- (-691.710) [-688.003] (-692.063) (-688.269) * (-692.757) (-692.294) [-687.237] (-686.403) -- 0:00:34
438500 -- (-686.908) (-690.170) [-688.378] (-689.241) * [-686.737] (-691.493) (-686.087) (-687.000) -- 0:00:34
439000 -- (-690.339) (-687.260) (-686.642) [-690.239] * [-686.518] (-686.472) (-688.191) (-687.207) -- 0:00:34
439500 -- (-687.906) (-686.838) (-687.582) [-687.968] * (-687.855) [-686.940] (-687.684) (-689.631) -- 0:00:34
440000 -- (-688.194) [-689.573] (-688.258) (-686.836) * (-692.900) (-692.674) [-687.254] (-690.407) -- 0:00:34
Average standard deviation of split frequencies: 0.010127
440500 -- (-688.650) [-687.790] (-687.091) (-687.927) * (-689.113) [-687.485] (-688.755) (-686.757) -- 0:00:35
441000 -- [-687.068] (-688.763) (-686.706) (-688.512) * [-687.131] (-686.094) (-687.618) (-686.572) -- 0:00:35
441500 -- (-689.140) [-687.463] (-690.095) (-688.208) * (-688.426) [-689.070] (-687.872) (-688.369) -- 0:00:35
442000 -- (-688.547) (-686.892) (-688.136) [-688.441] * (-686.480) (-689.720) [-688.114] (-691.925) -- 0:00:35
442500 -- (-689.018) (-688.135) (-688.376) [-690.115] * (-688.780) (-690.771) (-691.429) [-689.131] -- 0:00:35
443000 -- (-688.615) (-687.870) (-693.710) [-689.483] * (-690.629) [-688.709] (-687.800) (-691.681) -- 0:00:35
443500 -- (-686.621) (-689.376) [-689.512] (-688.654) * (-687.806) [-688.535] (-690.241) (-687.723) -- 0:00:35
444000 -- (-688.038) (-689.430) (-687.473) [-688.097] * (-690.995) [-691.916] (-694.887) (-687.896) -- 0:00:35
444500 -- [-686.454] (-689.394) (-688.520) (-688.029) * (-690.786) (-687.476) (-692.216) [-687.336] -- 0:00:34
445000 -- [-686.792] (-687.156) (-687.970) (-687.423) * (-689.220) [-686.691] (-691.054) (-688.524) -- 0:00:34
Average standard deviation of split frequencies: 0.009442
445500 -- [-689.710] (-688.361) (-689.479) (-688.448) * (-687.038) [-687.905] (-693.269) (-687.418) -- 0:00:34
446000 -- (-687.804) (-689.569) (-688.014) [-687.697] * (-686.398) (-693.252) [-686.590] (-686.816) -- 0:00:34
446500 -- (-686.175) (-692.305) [-687.778] (-687.796) * [-687.644] (-690.004) (-688.555) (-687.125) -- 0:00:34
447000 -- [-686.597] (-690.798) (-688.014) (-688.869) * (-687.922) (-687.736) (-691.275) [-686.376] -- 0:00:34
447500 -- (-687.825) (-690.346) [-690.999] (-691.469) * (-688.658) (-687.764) (-686.109) [-685.943] -- 0:00:34
448000 -- (-693.295) (-688.127) [-690.618] (-691.587) * (-687.299) (-690.529) [-686.917] (-685.960) -- 0:00:34
448500 -- [-686.832] (-689.775) (-687.960) (-691.998) * (-690.080) (-687.743) (-688.077) [-688.945] -- 0:00:34
449000 -- [-686.235] (-689.001) (-689.784) (-687.459) * (-692.753) (-688.913) (-687.564) [-687.851] -- 0:00:34
449500 -- (-685.967) [-686.856] (-689.440) (-688.836) * [-687.522] (-692.197) (-689.822) (-692.605) -- 0:00:34
450000 -- (-687.399) (-686.487) [-687.971] (-689.332) * (-686.875) [-688.949] (-689.705) (-687.735) -- 0:00:34
Average standard deviation of split frequencies: 0.009205
450500 -- (-687.937) (-686.755) [-689.053] (-686.944) * (-689.763) (-690.236) [-686.216] (-688.113) -- 0:00:34
451000 -- [-690.452] (-692.683) (-690.904) (-691.632) * (-687.204) [-688.411] (-687.658) (-686.475) -- 0:00:34
451500 -- (-690.384) (-693.050) (-691.710) [-687.364] * (-688.741) (-690.612) [-688.595] (-686.895) -- 0:00:34
452000 -- [-688.328] (-686.868) (-691.548) (-691.404) * [-686.569] (-690.917) (-687.670) (-693.204) -- 0:00:33
452500 -- [-686.201] (-688.792) (-691.318) (-696.721) * (-688.626) (-693.636) (-688.399) [-687.477] -- 0:00:33
453000 -- (-686.746) [-689.142] (-687.511) (-689.154) * (-689.764) [-690.234] (-686.946) (-687.903) -- 0:00:33
453500 -- (-687.089) [-687.836] (-687.735) (-688.195) * [-688.202] (-689.799) (-688.640) (-687.984) -- 0:00:33
454000 -- (-687.159) (-693.290) (-689.041) [-687.950] * (-689.607) [-690.202] (-686.242) (-691.084) -- 0:00:33
454500 -- (-687.375) [-691.943] (-689.070) (-686.908) * (-692.826) (-687.325) [-687.532] (-686.705) -- 0:00:33
455000 -- (-686.564) [-692.710] (-689.713) (-688.233) * (-686.703) (-687.335) (-687.856) [-690.485] -- 0:00:33
Average standard deviation of split frequencies: 0.008753
455500 -- (-688.321) [-689.494] (-688.807) (-686.762) * (-687.751) (-687.102) (-688.218) [-688.694] -- 0:00:33
456000 -- (-689.927) (-687.481) (-687.438) [-686.341] * (-686.440) (-690.433) (-687.833) [-688.432] -- 0:00:33
456500 -- [-687.990] (-687.061) (-688.688) (-687.136) * (-686.965) (-689.737) [-688.630] (-690.879) -- 0:00:33
457000 -- (-687.451) (-687.430) (-689.800) [-688.121] * [-687.150] (-688.936) (-689.086) (-687.085) -- 0:00:34
457500 -- [-688.023] (-689.277) (-688.690) (-687.580) * [-686.555] (-688.805) (-689.769) (-687.994) -- 0:00:34
458000 -- [-691.315] (-688.406) (-688.153) (-690.021) * (-688.814) (-687.254) (-689.557) [-689.576] -- 0:00:34
458500 -- [-688.351] (-689.788) (-688.069) (-688.094) * (-687.789) (-686.496) [-688.011] (-687.653) -- 0:00:34
459000 -- [-686.829] (-686.613) (-687.180) (-686.859) * (-686.966) [-687.410] (-687.771) (-690.581) -- 0:00:34
459500 -- [-686.987] (-687.199) (-691.330) (-687.205) * [-686.635] (-687.363) (-690.052) (-690.807) -- 0:00:34
460000 -- (-688.886) [-688.742] (-696.572) (-689.990) * [-687.521] (-686.366) (-689.181) (-689.048) -- 0:00:34
Average standard deviation of split frequencies: 0.009414
460500 -- [-687.228] (-689.978) (-687.882) (-689.686) * (-688.927) (-688.839) [-687.878] (-691.489) -- 0:00:33
461000 -- (-688.077) (-689.780) (-687.255) [-689.568] * (-689.455) [-688.332] (-687.061) (-686.111) -- 0:00:33
461500 -- (-687.125) [-692.793] (-687.539) (-686.213) * (-689.818) (-691.304) [-688.086] (-687.735) -- 0:00:33
462000 -- (-687.958) [-686.228] (-690.461) (-687.075) * (-689.093) (-689.343) [-689.285] (-686.211) -- 0:00:33
462500 -- (-688.253) (-687.445) (-696.729) [-687.533] * (-688.095) (-690.420) (-688.558) [-686.493] -- 0:00:33
463000 -- [-688.857] (-688.136) (-692.775) (-686.795) * (-690.159) [-688.465] (-690.096) (-687.181) -- 0:00:33
463500 -- (-690.725) (-689.055) [-687.383] (-686.437) * [-687.920] (-687.204) (-690.211) (-688.787) -- 0:00:33
464000 -- [-687.551] (-688.088) (-688.982) (-689.512) * [-687.420] (-688.774) (-691.235) (-687.313) -- 0:00:33
464500 -- [-687.943] (-686.652) (-686.791) (-690.540) * [-686.322] (-690.522) (-687.284) (-688.198) -- 0:00:33
465000 -- (-689.068) (-686.732) (-686.554) [-687.852] * (-687.119) (-686.813) [-686.047] (-687.464) -- 0:00:33
Average standard deviation of split frequencies: 0.009442
465500 -- (-688.260) [-687.668] (-686.487) (-687.231) * (-688.327) [-687.436] (-690.563) (-687.223) -- 0:00:33
466000 -- (-688.755) (-687.736) (-690.010) [-688.185] * (-686.791) (-689.088) [-686.425] (-686.683) -- 0:00:33
466500 -- (-688.952) [-688.265] (-688.902) (-688.028) * (-687.951) (-690.314) [-687.924] (-686.105) -- 0:00:33
467000 -- (-689.251) (-695.012) [-687.309] (-689.402) * [-687.001] (-689.307) (-686.295) (-686.590) -- 0:00:33
467500 -- (-686.227) (-687.859) [-690.877] (-690.382) * (-690.019) (-689.160) [-687.090] (-693.687) -- 0:00:33
468000 -- (-686.409) [-688.113] (-688.175) (-688.360) * [-689.583] (-688.976) (-687.605) (-686.263) -- 0:00:32
468500 -- (-687.027) [-688.151] (-692.248) (-691.151) * [-687.329] (-692.192) (-688.721) (-687.164) -- 0:00:32
469000 -- (-687.363) (-688.504) [-692.571] (-691.999) * (-688.363) [-688.535] (-687.061) (-690.198) -- 0:00:32
469500 -- [-689.020] (-688.070) (-687.369) (-689.055) * (-687.588) (-689.807) (-692.186) [-689.424] -- 0:00:32
470000 -- (-688.340) [-690.290] (-689.307) (-688.223) * (-688.367) [-689.569] (-690.255) (-686.394) -- 0:00:32
Average standard deviation of split frequencies: 0.009749
470500 -- (-687.862) (-688.742) (-688.521) [-687.223] * (-687.926) (-688.884) (-689.179) [-688.274] -- 0:00:32
471000 -- (-688.181) [-688.363] (-688.470) (-689.853) * (-689.076) (-688.376) [-691.623] (-686.235) -- 0:00:32
471500 -- [-690.652] (-689.994) (-687.548) (-686.347) * (-686.638) (-688.970) [-688.160] (-686.588) -- 0:00:32
472000 -- [-686.689] (-687.734) (-687.291) (-687.343) * (-687.688) (-688.255) [-688.442] (-691.917) -- 0:00:32
472500 -- (-686.518) (-686.515) (-688.743) [-687.735] * [-686.958] (-690.857) (-690.653) (-689.953) -- 0:00:32
473000 -- (-687.290) (-687.215) [-688.342] (-687.328) * [-686.896] (-695.615) (-688.962) (-690.630) -- 0:00:32
473500 -- (-690.029) [-688.685] (-692.562) (-697.415) * (-689.571) (-691.761) [-686.662] (-689.147) -- 0:00:33
474000 -- (-690.002) (-688.024) [-687.644] (-689.272) * (-688.696) [-690.122] (-688.952) (-691.824) -- 0:00:33
474500 -- [-688.843] (-687.608) (-693.102) (-690.738) * (-687.356) [-686.886] (-689.799) (-687.772) -- 0:00:33
475000 -- [-687.714] (-687.822) (-695.075) (-687.459) * [-687.677] (-686.540) (-688.094) (-688.918) -- 0:00:33
Average standard deviation of split frequencies: 0.009705
475500 -- [-686.671] (-687.708) (-692.004) (-688.433) * [-687.329] (-689.761) (-690.230) (-692.453) -- 0:00:33
476000 -- (-691.350) [-687.308] (-690.654) (-688.440) * (-688.814) (-687.607) (-688.626) [-686.988] -- 0:00:33
476500 -- (-693.565) (-687.800) [-691.834] (-688.367) * [-686.653] (-691.973) (-687.917) (-688.159) -- 0:00:32
477000 -- (-687.574) [-687.673] (-687.813) (-686.598) * (-687.215) (-688.171) [-688.471] (-689.465) -- 0:00:32
477500 -- (-688.692) (-687.761) (-687.096) [-688.342] * (-687.418) (-687.928) [-689.799] (-688.385) -- 0:00:32
478000 -- (-688.258) (-688.519) [-687.126] (-689.902) * (-686.330) (-689.415) [-691.268] (-693.243) -- 0:00:32
478500 -- [-688.230] (-687.698) (-687.475) (-688.850) * (-687.029) [-690.149] (-691.701) (-687.514) -- 0:00:32
479000 -- [-686.939] (-687.282) (-687.066) (-686.921) * (-687.295) (-686.592) (-692.471) [-686.019] -- 0:00:32
479500 -- (-690.185) [-686.992] (-687.449) (-687.580) * (-688.535) (-688.710) (-689.907) [-687.284] -- 0:00:32
480000 -- [-689.534] (-689.504) (-687.155) (-691.479) * (-686.806) (-688.530) (-688.791) [-687.778] -- 0:00:32
Average standard deviation of split frequencies: 0.009677
480500 -- (-688.990) (-686.594) (-687.560) [-691.248] * [-686.495] (-688.960) (-688.719) (-692.063) -- 0:00:32
481000 -- (-686.596) [-687.827] (-688.133) (-687.436) * (-688.250) (-690.321) [-688.434] (-688.101) -- 0:00:32
481500 -- (-689.888) (-690.973) [-687.093] (-687.952) * (-688.072) (-687.776) [-686.271] (-686.968) -- 0:00:32
482000 -- (-686.529) (-693.858) (-691.555) [-688.396] * (-688.044) (-691.434) (-688.114) [-688.204] -- 0:00:32
482500 -- [-687.014] (-689.810) (-687.192) (-687.174) * [-690.468] (-692.337) (-688.114) (-687.715) -- 0:00:32
483000 -- (-690.053) (-688.935) [-686.362] (-689.164) * (-691.566) (-690.480) [-688.411] (-686.221) -- 0:00:32
483500 -- (-693.197) (-687.584) [-688.680] (-689.320) * (-689.021) [-686.637] (-688.433) (-692.245) -- 0:00:32
484000 -- [-690.498] (-689.339) (-687.912) (-691.554) * (-687.928) [-686.740] (-689.551) (-688.326) -- 0:00:31
484500 -- (-686.636) (-688.291) [-687.984] (-687.303) * [-686.795] (-687.303) (-688.050) (-686.615) -- 0:00:31
485000 -- [-687.346] (-686.818) (-687.805) (-689.656) * (-689.458) [-686.445] (-686.689) (-689.483) -- 0:00:31
Average standard deviation of split frequencies: 0.009312
485500 -- (-689.574) (-687.410) [-687.141] (-687.660) * [-687.692] (-689.853) (-686.915) (-687.738) -- 0:00:31
486000 -- (-687.630) (-689.037) [-686.596] (-686.998) * (-687.595) [-690.044] (-686.640) (-690.621) -- 0:00:31
486500 -- (-687.629) [-689.806] (-689.048) (-688.224) * (-688.301) (-686.939) (-686.418) [-688.646] -- 0:00:31
487000 -- (-685.999) (-687.988) (-688.868) [-687.447] * (-688.492) (-686.897) (-686.438) [-688.417] -- 0:00:31
487500 -- (-690.107) [-686.282] (-689.594) (-688.717) * (-688.732) [-688.327] (-687.431) (-688.609) -- 0:00:31
488000 -- [-688.610] (-687.611) (-685.888) (-686.679) * [-686.416] (-689.099) (-686.024) (-687.609) -- 0:00:31
488500 -- (-687.298) (-689.063) [-686.706] (-689.377) * (-686.647) (-687.341) [-685.976] (-686.998) -- 0:00:31
489000 -- (-686.750) [-688.160] (-690.817) (-688.466) * (-686.617) (-688.375) [-686.167] (-686.939) -- 0:00:31
489500 -- (-689.232) (-688.411) (-691.605) [-687.432] * (-690.682) [-686.606] (-686.081) (-688.861) -- 0:00:31
490000 -- [-689.064] (-688.920) (-691.128) (-688.424) * (-688.402) (-687.012) (-689.214) [-686.935] -- 0:00:32
Average standard deviation of split frequencies: 0.009159
490500 -- (-687.834) (-686.618) [-687.598] (-688.690) * (-687.343) (-686.359) [-688.650] (-689.238) -- 0:00:32
491000 -- (-686.914) (-689.244) (-687.381) [-688.924] * (-688.337) (-694.183) [-690.079] (-688.660) -- 0:00:32
491500 -- (-691.808) (-690.790) (-687.894) [-687.502] * (-687.883) (-688.764) [-687.924] (-687.370) -- 0:00:32
492000 -- (-691.013) (-686.851) (-689.377) [-687.723] * (-688.039) (-689.796) (-686.436) [-689.352] -- 0:00:32
492500 -- (-689.964) [-689.922] (-687.625) (-687.051) * (-692.597) (-689.661) [-687.586] (-687.608) -- 0:00:31
493000 -- (-686.883) (-688.326) [-687.606] (-687.017) * (-691.329) (-689.150) [-687.247] (-693.143) -- 0:00:31
493500 -- [-690.911] (-697.142) (-686.492) (-687.488) * (-686.344) [-688.978] (-691.376) (-686.343) -- 0:00:31
494000 -- (-697.666) (-695.622) (-688.689) [-688.829] * (-687.322) (-689.744) (-689.510) [-686.924] -- 0:00:31
494500 -- (-690.108) (-691.120) [-687.027] (-687.579) * [-688.548] (-689.131) (-687.722) (-694.167) -- 0:00:31
495000 -- [-688.559] (-689.906) (-688.163) (-687.925) * (-686.604) (-691.052) [-690.246] (-689.434) -- 0:00:31
Average standard deviation of split frequencies: 0.009187
495500 -- (-689.666) [-687.111] (-689.288) (-688.037) * (-686.540) (-689.697) (-692.898) [-688.205] -- 0:00:31
496000 -- (-687.989) (-688.426) [-687.592] (-688.568) * [-687.724] (-688.230) (-687.962) (-688.325) -- 0:00:31
496500 -- (-687.765) (-692.416) (-696.596) [-688.285] * (-688.107) (-689.473) (-690.056) [-687.788] -- 0:00:31
497000 -- (-688.077) (-688.386) [-689.603] (-687.733) * (-689.151) (-690.573) (-688.284) [-687.288] -- 0:00:31
497500 -- (-693.450) (-687.293) [-687.245] (-689.814) * (-687.785) (-689.002) [-686.700] (-686.951) -- 0:00:31
498000 -- (-686.559) [-686.364] (-687.493) (-688.343) * (-689.464) (-687.121) [-690.655] (-688.889) -- 0:00:31
498500 -- (-687.823) (-689.102) [-686.776] (-687.635) * (-688.020) [-687.234] (-689.726) (-687.608) -- 0:00:31
499000 -- [-687.256] (-688.265) (-688.066) (-686.731) * (-688.901) (-687.337) [-687.923] (-686.173) -- 0:00:31
499500 -- (-688.876) (-689.388) (-687.739) [-688.444] * (-688.124) [-689.079] (-686.164) (-687.622) -- 0:00:31
500000 -- (-686.489) (-689.030) [-687.954] (-687.836) * [-690.015] (-686.915) (-688.328) (-691.572) -- 0:00:31
Average standard deviation of split frequencies: 0.008600
500500 -- (-686.199) (-686.593) [-690.140] (-686.870) * (-690.664) (-688.994) [-689.526] (-691.410) -- 0:00:30
501000 -- (-689.167) (-690.717) [-686.905] (-687.452) * [-688.434] (-688.120) (-686.572) (-685.875) -- 0:00:30
501500 -- (-687.175) (-686.255) [-688.335] (-688.083) * (-686.945) (-686.986) (-690.807) [-685.920] -- 0:00:30
502000 -- [-692.478] (-688.441) (-691.436) (-686.545) * (-688.463) (-686.406) (-688.350) [-688.709] -- 0:00:30
502500 -- (-687.743) (-688.443) (-688.333) [-687.925] * [-687.537] (-686.359) (-689.769) (-687.314) -- 0:00:30
503000 -- [-691.312] (-686.737) (-688.629) (-687.556) * (-687.992) (-686.214) (-690.010) [-687.184] -- 0:00:30
503500 -- (-691.983) (-686.869) [-687.507] (-688.557) * (-687.648) [-686.214] (-686.912) (-687.197) -- 0:00:30
504000 -- [-688.074] (-687.237) (-690.468) (-690.027) * (-690.179) (-689.953) [-686.271] (-687.797) -- 0:00:30
504500 -- (-689.137) (-689.526) (-686.852) [-687.216] * [-687.619] (-686.806) (-686.968) (-687.835) -- 0:00:30
505000 -- (-686.894) (-686.553) (-686.828) [-690.607] * (-686.255) (-686.943) (-694.322) [-687.294] -- 0:00:30
Average standard deviation of split frequencies: 0.008633
505500 -- (-686.951) [-687.944] (-691.898) (-688.727) * [-687.438] (-687.916) (-688.714) (-687.396) -- 0:00:30
506000 -- [-686.575] (-689.301) (-694.845) (-686.372) * [-689.903] (-692.221) (-686.559) (-687.164) -- 0:00:30
506500 -- (-687.441) [-687.340] (-692.085) (-686.938) * (-687.944) [-687.703] (-692.080) (-688.358) -- 0:00:31
507000 -- (-687.105) (-689.285) [-692.351] (-691.095) * [-688.907] (-687.571) (-690.638) (-689.687) -- 0:00:31
507500 -- (-688.001) (-688.627) (-690.702) [-686.264] * (-687.754) [-689.502] (-686.653) (-689.797) -- 0:00:31
508000 -- (-687.793) (-692.574) [-693.916] (-689.913) * [-685.951] (-686.984) (-687.076) (-687.410) -- 0:00:30
508500 -- (-688.294) [-693.887] (-688.118) (-687.507) * [-688.326] (-689.794) (-686.777) (-690.926) -- 0:00:30
509000 -- (-687.155) [-689.450] (-689.885) (-688.298) * (-687.184) (-690.524) (-690.232) [-687.854] -- 0:00:30
509500 -- (-687.228) [-687.094] (-693.121) (-691.175) * (-691.532) (-691.106) (-688.620) [-686.475] -- 0:00:30
510000 -- (-687.564) (-688.141) (-693.447) [-688.224] * [-687.371] (-689.183) (-687.330) (-687.923) -- 0:00:30
Average standard deviation of split frequencies: 0.008739
510500 -- (-687.227) (-686.412) (-689.260) [-688.244] * (-688.517) [-689.572] (-687.985) (-688.416) -- 0:00:30
511000 -- (-687.333) [-687.744] (-689.213) (-687.896) * (-686.651) (-689.617) [-686.313] (-686.839) -- 0:00:30
511500 -- (-690.147) (-691.087) [-688.488] (-687.512) * (-687.131) (-688.339) (-687.995) [-688.142] -- 0:00:30
512000 -- (-687.727) [-688.041] (-687.460) (-688.395) * (-690.296) [-687.534] (-691.002) (-687.035) -- 0:00:30
512500 -- (-690.080) [-687.533] (-689.209) (-690.595) * (-687.541) [-687.490] (-690.342) (-687.355) -- 0:00:30
513000 -- (-689.067) (-686.933) [-688.069] (-687.486) * [-690.378] (-687.563) (-690.742) (-686.423) -- 0:00:30
513500 -- (-687.931) (-686.522) [-686.826] (-687.528) * [-688.294] (-687.640) (-687.618) (-686.855) -- 0:00:30
514000 -- (-689.571) (-687.155) (-686.551) [-687.289] * (-688.376) [-686.967] (-692.359) (-689.117) -- 0:00:30
514500 -- [-688.582] (-688.324) (-689.007) (-687.081) * (-692.456) (-689.615) (-692.729) [-688.309] -- 0:00:30
515000 -- (-687.750) (-689.164) [-687.734] (-688.341) * (-688.889) (-688.627) [-687.780] (-687.887) -- 0:00:30
Average standard deviation of split frequencies: 0.008527
515500 -- (-686.703) [-690.145] (-688.389) (-686.677) * (-690.591) (-688.616) (-689.851) [-686.576] -- 0:00:30
516000 -- (-692.677) (-687.114) (-689.831) [-688.281] * (-688.814) (-687.200) (-688.639) [-688.524] -- 0:00:30
516500 -- (-691.958) [-689.241] (-686.414) (-688.724) * (-688.477) (-688.855) (-686.662) [-690.630] -- 0:00:29
517000 -- (-691.255) [-689.891] (-686.990) (-690.547) * (-687.268) [-687.129] (-686.768) (-690.436) -- 0:00:29
517500 -- (-690.613) (-686.338) [-688.626] (-687.772) * [-690.355] (-688.867) (-687.931) (-687.918) -- 0:00:29
518000 -- (-688.449) (-688.315) [-686.720] (-690.764) * (-689.346) (-689.965) (-687.199) [-688.672] -- 0:00:29
518500 -- (-689.172) [-688.185] (-687.696) (-687.269) * (-689.539) (-689.435) [-686.954] (-689.387) -- 0:00:29
519000 -- (-687.365) [-687.867] (-688.641) (-686.300) * [-689.253] (-688.618) (-686.973) (-692.893) -- 0:00:29
519500 -- (-689.967) [-687.876] (-689.714) (-688.433) * (-687.959) (-692.753) [-686.729] (-692.242) -- 0:00:29
520000 -- (-689.210) [-688.462] (-688.944) (-690.147) * [-689.478] (-691.790) (-688.584) (-689.472) -- 0:00:29
Average standard deviation of split frequencies: 0.008209
520500 -- (-689.753) (-686.287) (-686.691) [-689.825] * (-687.837) (-693.097) [-687.561] (-689.515) -- 0:00:29
521000 -- (-689.300) (-687.488) [-689.963] (-687.862) * (-695.601) [-688.415] (-689.249) (-688.936) -- 0:00:29
521500 -- (-687.505) (-687.540) [-686.402] (-690.001) * (-690.119) (-688.272) (-687.837) [-686.909] -- 0:00:29
522000 -- (-689.621) [-689.464] (-690.869) (-690.772) * (-688.719) (-688.383) [-686.229] (-687.065) -- 0:00:29
522500 -- (-687.314) [-686.465] (-692.232) (-689.705) * (-688.675) [-688.279] (-687.174) (-687.316) -- 0:00:29
523000 -- (-692.023) (-688.089) [-696.063] (-687.439) * (-686.286) (-687.966) [-688.599] (-691.194) -- 0:00:30
523500 -- (-687.274) (-692.216) (-687.323) [-688.396] * (-686.412) [-688.856] (-688.744) (-692.593) -- 0:00:30
524000 -- (-687.048) (-694.030) [-689.810] (-688.123) * (-690.384) (-690.295) (-688.643) [-689.609] -- 0:00:29
524500 -- (-687.170) [-688.476] (-696.516) (-688.222) * (-688.171) (-688.928) [-687.415] (-688.465) -- 0:00:29
525000 -- (-686.472) (-687.921) (-690.982) [-688.073] * (-688.776) [-687.148] (-691.255) (-688.226) -- 0:00:29
Average standard deviation of split frequencies: 0.008245
525500 -- (-689.947) (-690.932) (-690.617) [-693.949] * (-690.754) [-690.045] (-692.526) (-686.954) -- 0:00:29
526000 -- [-689.064] (-688.966) (-689.154) (-691.302) * (-689.668) (-687.345) (-692.148) [-686.617] -- 0:00:29
526500 -- (-692.915) [-686.558] (-688.930) (-689.780) * [-690.222] (-687.088) (-688.823) (-686.721) -- 0:00:29
527000 -- (-688.015) [-687.578] (-692.209) (-687.687) * (-686.878) (-687.354) [-689.053] (-687.156) -- 0:00:29
527500 -- (-687.114) (-687.862) (-689.205) [-687.833] * (-689.218) (-687.821) [-688.724] (-686.987) -- 0:00:29
528000 -- [-687.931] (-688.790) (-687.587) (-686.943) * (-688.911) (-689.685) (-687.585) [-688.032] -- 0:00:29
528500 -- (-686.893) (-687.197) [-687.483] (-686.420) * (-686.289) [-686.988] (-689.173) (-689.358) -- 0:00:29
529000 -- [-687.039] (-688.863) (-687.222) (-686.590) * (-687.289) (-689.417) (-689.696) [-693.511] -- 0:00:29
529500 -- [-687.199] (-692.108) (-690.782) (-689.281) * (-686.530) (-688.698) (-686.295) [-692.032] -- 0:00:29
530000 -- [-686.766] (-689.078) (-687.131) (-689.746) * [-688.513] (-688.326) (-686.299) (-689.188) -- 0:00:29
Average standard deviation of split frequencies: 0.008350
530500 -- [-687.530] (-689.117) (-691.130) (-687.702) * (-686.792) (-690.184) (-687.015) [-688.619] -- 0:00:29
531000 -- (-688.390) [-691.735] (-688.295) (-691.778) * (-691.687) [-692.534] (-688.700) (-688.332) -- 0:00:29
531500 -- (-688.110) (-687.289) [-686.308] (-688.670) * (-688.601) [-687.076] (-690.466) (-689.221) -- 0:00:29
532000 -- (-689.879) (-687.768) [-687.151] (-691.890) * [-688.955] (-691.653) (-687.577) (-690.399) -- 0:00:29
532500 -- (-686.115) [-688.407] (-686.763) (-688.538) * [-687.862] (-687.101) (-691.871) (-692.047) -- 0:00:28
533000 -- (-686.156) (-689.910) (-690.526) [-687.718] * (-687.942) (-688.292) [-686.789] (-687.708) -- 0:00:28
533500 -- (-687.176) (-687.610) (-689.280) [-691.946] * (-688.880) [-688.006] (-686.662) (-687.114) -- 0:00:28
534000 -- (-686.887) (-690.966) (-688.521) [-689.494] * (-691.052) (-687.672) [-688.876] (-687.705) -- 0:00:28
534500 -- (-689.887) (-687.383) [-689.830] (-689.461) * (-687.944) [-689.216] (-689.643) (-687.956) -- 0:00:28
535000 -- (-691.831) [-687.159] (-690.889) (-688.495) * (-688.546) (-688.300) [-687.207] (-687.790) -- 0:00:28
Average standard deviation of split frequencies: 0.008091
535500 -- (-691.658) [-687.838] (-689.447) (-688.968) * (-688.082) (-688.478) (-687.297) [-691.002] -- 0:00:28
536000 -- (-690.107) (-688.602) (-687.661) [-686.455] * (-687.851) (-686.584) [-690.327] (-687.192) -- 0:00:28
536500 -- [-687.127] (-688.957) (-688.130) (-689.476) * [-688.363] (-686.584) (-688.478) (-686.861) -- 0:00:28
537000 -- (-689.728) (-686.281) (-690.072) [-691.930] * (-687.493) (-689.702) [-687.215] (-687.636) -- 0:00:28
537500 -- (-686.789) (-687.146) [-688.064] (-688.427) * [-687.135] (-688.647) (-689.286) (-686.592) -- 0:00:28
538000 -- [-686.444] (-687.855) (-691.069) (-691.012) * [-688.156] (-689.407) (-687.616) (-686.635) -- 0:00:28
538500 -- (-688.071) (-692.059) [-693.570] (-688.848) * (-690.316) [-688.581] (-688.514) (-686.691) -- 0:00:28
539000 -- (-688.431) (-689.919) [-691.071] (-691.420) * (-688.359) [-693.091] (-686.489) (-687.961) -- 0:00:28
539500 -- (-689.264) [-686.012] (-688.638) (-687.540) * (-688.202) (-688.130) [-686.016] (-686.304) -- 0:00:29
540000 -- [-693.276] (-687.060) (-688.570) (-691.265) * (-687.659) [-687.831] (-686.447) (-687.175) -- 0:00:28
Average standard deviation of split frequencies: 0.008312
540500 -- (-688.488) (-687.246) [-688.578] (-687.539) * [-686.824] (-688.224) (-687.153) (-686.773) -- 0:00:28
541000 -- (-692.177) [-691.045] (-691.453) (-691.551) * [-693.038] (-691.007) (-688.565) (-689.737) -- 0:00:28
541500 -- (-689.136) (-687.561) (-688.036) [-689.972] * [-685.988] (-687.163) (-686.929) (-690.030) -- 0:00:28
542000 -- (-692.032) (-687.531) [-686.503] (-686.666) * (-688.666) [-686.579] (-688.503) (-693.515) -- 0:00:28
542500 -- (-686.737) (-687.641) (-687.696) [-688.129] * (-690.001) [-686.716] (-687.952) (-686.947) -- 0:00:28
543000 -- [-687.451] (-687.079) (-688.984) (-691.682) * (-689.861) (-688.747) (-686.814) [-686.181] -- 0:00:28
543500 -- [-687.556] (-690.472) (-689.512) (-691.477) * (-688.583) (-690.875) (-688.015) [-686.099] -- 0:00:28
544000 -- [-687.369] (-688.890) (-689.797) (-692.223) * (-686.664) (-687.814) [-686.502] (-687.932) -- 0:00:28
544500 -- (-688.373) (-690.283) [-687.938] (-687.737) * (-688.157) (-687.778) [-686.447] (-688.831) -- 0:00:28
545000 -- (-690.056) [-689.000] (-687.530) (-687.384) * (-689.623) [-687.679] (-692.164) (-687.101) -- 0:00:28
Average standard deviation of split frequencies: 0.008806
545500 -- (-689.467) [-690.439] (-686.912) (-688.293) * (-687.327) (-689.967) [-687.044] (-687.638) -- 0:00:28
546000 -- (-693.445) [-686.577] (-690.298) (-687.394) * (-694.169) (-686.554) [-688.135] (-688.472) -- 0:00:28
546500 -- [-688.255] (-688.761) (-688.233) (-687.100) * (-686.204) (-697.297) [-686.797] (-691.057) -- 0:00:28
547000 -- (-687.841) (-693.124) [-686.806] (-688.495) * (-687.867) (-690.101) (-687.714) [-692.977] -- 0:00:28
547500 -- [-686.592] (-688.318) (-688.441) (-688.072) * (-686.686) [-689.390] (-688.133) (-689.486) -- 0:00:28
548000 -- (-687.063) [-696.255] (-688.220) (-688.452) * (-686.765) [-687.196] (-688.733) (-691.627) -- 0:00:28
548500 -- (-686.170) (-688.267) [-687.596] (-694.961) * (-687.132) (-686.874) [-686.473] (-689.814) -- 0:00:27
549000 -- (-691.098) [-689.952] (-688.628) (-691.482) * (-689.197) (-686.619) [-686.134] (-689.145) -- 0:00:27
549500 -- (-688.380) (-688.814) (-687.340) [-687.880] * (-691.137) (-689.672) (-687.226) [-687.401] -- 0:00:27
550000 -- (-686.826) (-687.063) (-689.410) [-688.046] * (-689.704) (-691.229) [-689.404] (-689.138) -- 0:00:27
Average standard deviation of split frequencies: 0.008789
550500 -- (-689.455) [-686.752] (-692.578) (-688.403) * [-689.123] (-689.250) (-693.823) (-687.489) -- 0:00:27
551000 -- (-689.499) [-686.957] (-687.527) (-686.863) * (-686.815) (-687.511) (-687.711) [-686.405] -- 0:00:27
551500 -- (-688.427) [-686.832] (-688.269) (-690.675) * [-686.330] (-688.275) (-690.275) (-688.920) -- 0:00:27
552000 -- (-686.419) (-689.318) [-686.763] (-691.386) * [-689.704] (-686.957) (-689.941) (-693.719) -- 0:00:27
552500 -- (-688.122) (-686.901) (-690.981) [-687.588] * (-687.844) [-687.440] (-687.384) (-689.314) -- 0:00:27
553000 -- (-687.815) [-686.448] (-689.269) (-691.285) * (-688.664) (-688.178) (-687.740) [-687.690] -- 0:00:27
553500 -- (-690.340) [-687.069] (-690.175) (-691.301) * [-687.128] (-688.685) (-689.291) (-689.203) -- 0:00:27
554000 -- (-686.451) [-687.550] (-690.913) (-687.237) * (-687.130) (-688.830) (-686.963) [-687.503] -- 0:00:27
554500 -- (-687.069) (-691.110) (-687.445) [-688.382] * (-688.615) (-690.074) [-690.314] (-687.751) -- 0:00:27
555000 -- [-690.111] (-695.659) (-688.450) (-690.004) * (-688.231) (-687.584) [-686.367] (-689.621) -- 0:00:27
Average standard deviation of split frequencies: 0.008592
555500 -- (-688.258) (-691.385) (-690.797) [-687.687] * (-690.387) [-687.513] (-686.744) (-689.641) -- 0:00:27
556000 -- (-688.575) [-687.903] (-687.713) (-690.515) * [-688.161] (-691.293) (-687.987) (-688.388) -- 0:00:27
556500 -- [-693.478] (-686.865) (-687.488) (-689.723) * (-688.826) [-686.583] (-687.984) (-690.850) -- 0:00:27
557000 -- (-691.385) (-687.430) [-688.415] (-687.083) * (-690.212) (-688.543) (-687.574) [-688.334] -- 0:00:27
557500 -- [-687.784] (-687.892) (-689.890) (-688.941) * (-691.807) (-687.626) [-687.370] (-688.761) -- 0:00:27
558000 -- [-688.860] (-687.060) (-686.223) (-689.283) * (-687.576) (-686.501) [-687.824] (-688.275) -- 0:00:27
558500 -- (-689.149) (-686.231) (-688.553) [-687.398] * (-686.485) [-691.977] (-687.300) (-693.514) -- 0:00:27
559000 -- (-688.293) [-686.096] (-689.034) (-686.319) * (-689.737) (-687.859) (-688.782) [-689.851] -- 0:00:27
559500 -- [-689.624] (-686.614) (-692.631) (-688.148) * (-691.630) (-686.832) [-689.222] (-686.846) -- 0:00:27
560000 -- (-688.474) (-689.173) (-690.211) [-689.622] * [-690.443] (-686.382) (-689.179) (-688.139) -- 0:00:27
Average standard deviation of split frequencies: 0.008184
560500 -- (-689.084) (-687.991) (-692.089) [-688.641] * (-689.327) (-686.286) (-688.813) [-689.444] -- 0:00:27
561000 -- (-687.597) (-687.667) [-689.117] (-687.427) * (-689.899) [-687.732] (-689.148) (-687.439) -- 0:00:27
561500 -- [-687.491] (-691.286) (-693.247) (-688.192) * (-690.230) (-688.986) (-687.858) [-690.935] -- 0:00:27
562000 -- (-688.548) [-690.927] (-690.724) (-693.496) * [-694.494] (-695.669) (-687.611) (-689.893) -- 0:00:27
562500 -- [-687.254] (-689.406) (-687.859) (-689.509) * (-689.548) (-689.316) (-687.353) [-688.933] -- 0:00:27
563000 -- (-686.840) (-687.250) [-688.343] (-688.691) * (-687.551) [-687.792] (-686.763) (-689.821) -- 0:00:27
563500 -- (-686.351) (-686.151) (-688.199) [-687.926] * (-687.329) [-693.522] (-687.513) (-687.886) -- 0:00:27
564000 -- (-687.299) (-686.889) [-687.099] (-688.569) * [-691.313] (-688.372) (-686.972) (-689.445) -- 0:00:27
564500 -- (-687.788) (-687.718) [-690.613] (-689.206) * [-688.254] (-688.800) (-687.030) (-690.422) -- 0:00:27
565000 -- [-687.360] (-687.179) (-686.912) (-688.649) * (-688.306) [-688.802] (-686.900) (-689.159) -- 0:00:26
Average standard deviation of split frequencies: 0.008717
565500 -- (-687.122) [-691.914] (-690.005) (-688.920) * (-688.447) [-691.654] (-689.506) (-688.609) -- 0:00:26
566000 -- (-688.118) [-688.588] (-686.916) (-690.059) * (-689.432) (-688.243) [-686.534] (-686.455) -- 0:00:26
566500 -- (-693.653) [-689.138] (-687.377) (-688.873) * (-688.726) (-689.836) (-686.890) [-687.731] -- 0:00:26
567000 -- (-693.860) (-688.033) (-688.806) [-691.574] * (-688.816) (-688.204) [-687.559] (-688.715) -- 0:00:26
567500 -- (-686.268) [-687.421] (-687.996) (-687.530) * [-688.706] (-689.526) (-687.868) (-687.423) -- 0:00:26
568000 -- (-686.526) [-689.030] (-688.147) (-687.368) * (-688.832) [-690.499] (-689.762) (-686.335) -- 0:00:26
568500 -- (-687.987) (-691.619) [-687.214] (-686.954) * (-689.268) (-688.278) (-687.378) [-686.712] -- 0:00:26
569000 -- (-689.783) [-692.959] (-688.217) (-689.224) * (-689.075) [-687.802] (-692.676) (-686.538) -- 0:00:26
569500 -- (-686.643) (-691.099) [-689.569] (-691.532) * (-686.712) (-687.651) (-693.509) [-691.514] -- 0:00:26
570000 -- (-690.209) [-687.611] (-689.295) (-690.765) * [-687.802] (-687.765) (-688.819) (-692.706) -- 0:00:26
Average standard deviation of split frequencies: 0.008150
570500 -- (-689.553) [-688.443] (-689.736) (-692.252) * (-687.828) (-686.387) (-695.300) [-690.880] -- 0:00:26
571000 -- (-693.534) [-688.219] (-692.880) (-689.000) * (-688.038) (-686.391) (-694.289) [-689.973] -- 0:00:26
571500 -- (-693.554) (-688.396) [-688.576] (-689.557) * (-693.117) (-687.307) [-688.209] (-689.380) -- 0:00:26
572000 -- [-689.722] (-690.101) (-688.309) (-688.460) * (-689.960) [-689.134] (-687.681) (-689.466) -- 0:00:26
572500 -- (-688.944) [-687.848] (-690.815) (-687.191) * [-689.793] (-687.418) (-688.071) (-692.729) -- 0:00:26
573000 -- (-690.446) (-689.168) [-688.107] (-690.891) * [-687.292] (-688.434) (-688.310) (-689.964) -- 0:00:26
573500 -- (-688.685) (-690.783) (-690.622) [-688.165] * (-687.502) (-687.089) [-687.902] (-690.624) -- 0:00:26
574000 -- (-688.424) (-688.755) (-686.006) [-687.786] * (-688.224) [-686.305] (-687.743) (-690.707) -- 0:00:26
574500 -- (-688.977) (-689.129) (-688.854) [-691.111] * [-688.717] (-688.178) (-687.727) (-689.135) -- 0:00:26
575000 -- (-686.957) (-694.916) [-689.084] (-687.467) * (-689.557) (-687.270) (-688.797) [-688.033] -- 0:00:26
Average standard deviation of split frequencies: 0.007966
575500 -- (-688.905) (-687.268) [-689.060] (-688.547) * (-691.506) (-686.685) [-687.453] (-687.933) -- 0:00:26
576000 -- [-687.171] (-690.050) (-688.308) (-686.413) * (-690.425) (-687.388) [-686.727] (-688.230) -- 0:00:26
576500 -- (-687.692) (-696.119) [-686.615] (-688.523) * (-690.366) (-687.292) (-694.289) [-687.319] -- 0:00:26
577000 -- [-687.650] (-691.225) (-686.558) (-688.955) * (-687.056) (-687.056) (-688.515) [-687.352] -- 0:00:26
577500 -- (-687.418) (-686.938) [-687.097] (-692.340) * (-687.675) (-691.355) (-687.484) [-686.884] -- 0:00:26
578000 -- (-686.976) (-688.898) [-686.425] (-688.798) * (-688.994) (-691.509) (-688.139) [-686.783] -- 0:00:26
578500 -- [-691.340] (-691.663) (-688.024) (-686.737) * (-686.834) [-687.520] (-690.578) (-690.263) -- 0:00:26
579000 -- (-688.514) [-687.419] (-690.442) (-693.541) * [-689.610] (-687.652) (-689.279) (-686.617) -- 0:00:26
579500 -- [-689.140] (-687.199) (-688.953) (-690.841) * (-688.597) (-687.992) [-687.781] (-687.026) -- 0:00:26
580000 -- (-687.980) [-687.758] (-689.134) (-693.955) * [-686.379] (-690.769) (-688.406) (-686.264) -- 0:00:26
Average standard deviation of split frequencies: 0.007956
580500 -- (-686.610) (-688.004) [-687.173] (-690.228) * (-687.631) (-692.268) [-688.450] (-687.140) -- 0:00:26
581000 -- [-688.152] (-689.878) (-686.959) (-693.772) * (-689.114) [-687.659] (-691.502) (-686.610) -- 0:00:25
581500 -- (-688.539) (-689.455) [-687.603] (-686.947) * (-687.935) [-687.803] (-688.833) (-686.544) -- 0:00:25
582000 -- (-688.086) (-687.505) [-689.244] (-693.421) * (-688.812) (-689.061) (-686.911) [-687.630] -- 0:00:25
582500 -- (-691.455) [-690.752] (-686.863) (-691.276) * (-692.809) [-693.450] (-686.585) (-688.040) -- 0:00:25
583000 -- [-691.912] (-689.171) (-686.158) (-697.386) * (-686.946) [-689.898] (-687.094) (-687.857) -- 0:00:25
583500 -- (-689.189) (-688.132) (-686.623) [-689.192] * [-689.066] (-687.218) (-689.732) (-688.534) -- 0:00:25
584000 -- (-688.806) (-687.273) [-687.865] (-688.939) * (-687.467) (-687.561) (-693.711) [-687.372] -- 0:00:25
584500 -- (-687.557) [-687.122] (-686.854) (-689.572) * (-686.947) [-686.526] (-689.272) (-689.967) -- 0:00:25
585000 -- (-687.879) (-687.767) [-687.250] (-688.531) * (-686.579) (-686.402) [-687.679] (-689.692) -- 0:00:25
Average standard deviation of split frequencies: 0.007455
585500 -- [-687.400] (-687.128) (-690.901) (-687.792) * (-687.600) (-688.326) [-688.722] (-687.664) -- 0:00:25
586000 -- [-689.916] (-686.699) (-688.096) (-695.410) * [-687.582] (-691.651) (-690.437) (-688.530) -- 0:00:25
586500 -- [-686.377] (-690.641) (-687.641) (-693.460) * (-691.924) (-688.545) [-689.403] (-688.230) -- 0:00:25
587000 -- [-686.459] (-687.587) (-689.043) (-689.663) * [-690.487] (-690.863) (-688.022) (-689.324) -- 0:00:25
587500 -- (-686.990) (-690.414) (-691.824) [-688.766] * (-688.978) (-686.420) (-688.510) [-691.026] -- 0:00:25
588000 -- (-687.344) (-687.526) [-689.197] (-689.202) * (-688.433) [-688.785] (-686.967) (-686.523) -- 0:00:25
588500 -- (-688.367) [-686.536] (-691.885) (-690.058) * (-690.216) (-692.706) (-689.545) [-687.902] -- 0:00:25
589000 -- (-686.802) [-689.786] (-693.903) (-689.245) * [-688.293] (-686.806) (-689.610) (-690.596) -- 0:00:25
589500 -- [-687.981] (-689.928) (-691.686) (-689.527) * [-688.756] (-687.970) (-687.206) (-689.068) -- 0:00:25
590000 -- [-687.741] (-688.253) (-693.184) (-691.185) * [-686.926] (-688.076) (-687.531) (-689.042) -- 0:00:25
Average standard deviation of split frequencies: 0.007449
590500 -- (-687.348) [-687.284] (-690.406) (-690.693) * (-688.600) (-688.628) (-686.799) [-689.305] -- 0:00:25
591000 -- (-686.551) [-688.289] (-690.417) (-692.940) * (-688.905) [-688.762] (-690.425) (-688.647) -- 0:00:25
591500 -- (-687.913) (-688.725) (-688.822) [-690.101] * (-686.636) [-687.550] (-686.871) (-687.556) -- 0:00:25
592000 -- (-688.058) (-686.256) (-687.139) [-688.115] * (-687.508) (-689.008) [-686.748] (-689.687) -- 0:00:25
592500 -- (-688.404) [-692.722] (-687.333) (-688.100) * [-687.678] (-689.878) (-686.699) (-689.927) -- 0:00:25
593000 -- (-688.430) (-690.277) (-687.691) [-688.653] * (-688.932) (-687.950) (-687.531) [-686.428] -- 0:00:25
593500 -- (-688.239) (-688.538) [-687.675] (-687.490) * (-688.165) (-689.563) (-687.371) [-686.299] -- 0:00:25
594000 -- [-686.269] (-688.250) (-688.450) (-689.233) * [-686.746] (-688.421) (-688.976) (-690.966) -- 0:00:25
594500 -- (-688.206) (-689.046) [-688.526] (-687.811) * [-687.465] (-687.779) (-687.394) (-692.170) -- 0:00:25
595000 -- (-687.304) (-687.682) (-690.398) [-688.982] * (-690.412) (-686.987) [-688.196] (-690.774) -- 0:00:25
Average standard deviation of split frequencies: 0.007593
595500 -- (-687.507) [-686.788] (-687.889) (-690.602) * (-693.070) [-690.282] (-686.376) (-686.962) -- 0:00:25
596000 -- (-689.788) (-687.018) [-686.840] (-689.941) * (-689.599) (-689.450) (-689.626) [-686.874] -- 0:00:25
596500 -- (-688.165) [-686.571] (-691.627) (-691.063) * [-687.266] (-690.439) (-691.816) (-691.589) -- 0:00:25
597000 -- [-688.294] (-687.446) (-687.331) (-688.509) * (-687.199) (-688.994) [-689.541] (-686.749) -- 0:00:24
597500 -- [-687.917] (-687.479) (-686.389) (-688.690) * (-689.054) (-688.041) (-686.765) [-686.767] -- 0:00:24
598000 -- (-687.790) (-688.550) [-690.357] (-689.929) * (-688.670) (-691.616) [-688.099] (-687.801) -- 0:00:24
598500 -- (-686.938) [-688.268] (-687.588) (-689.279) * [-690.047] (-688.064) (-689.174) (-687.984) -- 0:00:24
599000 -- (-687.518) [-688.489] (-687.599) (-687.631) * [-687.348] (-690.513) (-688.450) (-688.931) -- 0:00:24
599500 -- [-687.507] (-687.377) (-687.599) (-686.538) * (-687.657) (-689.526) (-689.669) [-692.091] -- 0:00:24
600000 -- (-689.194) (-688.049) (-687.723) [-688.426] * [-688.615] (-690.612) (-688.596) (-690.207) -- 0:00:24
Average standard deviation of split frequencies: 0.007377
600500 -- (-687.654) (-687.267) (-687.695) [-690.207] * (-689.878) (-688.148) (-688.281) [-686.424] -- 0:00:24
601000 -- [-687.533] (-688.115) (-687.354) (-693.287) * (-688.819) (-687.957) (-687.541) [-687.510] -- 0:00:24
601500 -- (-691.140) (-686.497) (-688.438) [-694.615] * (-689.518) (-687.079) (-688.397) [-687.031] -- 0:00:24
602000 -- [-686.667] (-690.090) (-687.287) (-693.047) * [-688.233] (-688.974) (-686.810) (-688.387) -- 0:00:24
602500 -- (-687.047) (-691.856) [-686.318] (-693.162) * (-692.079) (-690.455) [-686.921] (-687.279) -- 0:00:24
603000 -- [-689.191] (-689.511) (-687.130) (-689.310) * (-693.249) (-691.881) (-687.271) [-690.043] -- 0:00:24
603500 -- (-687.337) (-686.769) [-686.803] (-688.971) * (-688.466) (-689.714) (-686.232) [-687.534] -- 0:00:24
604000 -- (-689.173) [-687.148] (-690.450) (-687.060) * (-687.937) (-688.778) (-687.398) [-690.803] -- 0:00:24
604500 -- (-690.783) (-688.782) (-688.520) [-687.662] * (-688.448) (-690.403) [-687.787] (-689.052) -- 0:00:24
605000 -- (-687.282) (-690.984) (-687.863) [-686.834] * (-686.637) (-686.339) [-688.225] (-688.414) -- 0:00:24
Average standard deviation of split frequencies: 0.007364
605500 -- (-688.984) (-688.232) [-687.870] (-687.633) * (-686.841) (-689.852) [-689.647] (-687.679) -- 0:00:24
606000 -- (-688.900) (-687.389) [-687.103] (-686.774) * (-686.677) (-687.223) (-688.542) [-687.434] -- 0:00:24
606500 -- (-687.360) [-691.287] (-689.314) (-687.303) * (-686.757) (-687.982) [-688.630] (-690.234) -- 0:00:24
607000 -- (-690.471) (-686.172) [-689.002] (-688.745) * (-686.769) (-687.637) [-688.907] (-691.674) -- 0:00:24
607500 -- (-690.540) (-687.529) [-688.888] (-689.321) * (-687.149) (-688.129) (-689.260) [-687.870] -- 0:00:24
608000 -- (-686.479) (-688.023) [-689.252] (-689.023) * (-687.350) (-689.906) [-686.797] (-687.903) -- 0:00:24
608500 -- [-687.106] (-692.864) (-686.946) (-686.861) * [-690.627] (-689.643) (-687.239) (-688.135) -- 0:00:24
609000 -- [-686.882] (-687.802) (-688.153) (-688.770) * [-686.939] (-688.395) (-687.810) (-688.449) -- 0:00:24
609500 -- [-688.686] (-687.219) (-689.193) (-687.984) * (-686.359) (-687.362) [-689.238] (-687.884) -- 0:00:24
610000 -- (-690.569) [-686.878] (-687.057) (-688.217) * (-690.855) [-686.953] (-687.294) (-688.097) -- 0:00:24
Average standard deviation of split frequencies: 0.006896
610500 -- (-688.431) (-687.048) (-691.772) [-690.532] * (-687.478) (-691.282) (-688.332) [-688.206] -- 0:00:24
611000 -- (-686.713) (-690.477) [-690.518] (-688.083) * (-689.043) (-686.172) (-688.878) [-687.868] -- 0:00:24
611500 -- (-687.607) [-690.020] (-689.573) (-687.995) * (-688.412) (-687.605) (-688.874) [-688.613] -- 0:00:24
612000 -- [-686.953] (-687.670) (-690.680) (-687.444) * [-687.816] (-687.639) (-687.096) (-688.156) -- 0:00:24
612500 -- (-688.419) [-687.911] (-692.774) (-688.301) * (-689.703) (-691.412) (-688.448) [-687.597] -- 0:00:24
613000 -- (-687.145) (-687.184) (-687.916) [-689.863] * [-686.648] (-688.586) (-686.859) (-688.592) -- 0:00:23
613500 -- (-689.036) (-686.123) [-687.656] (-687.700) * (-687.474) (-686.869) (-689.847) [-688.122] -- 0:00:23
614000 -- (-693.268) (-685.979) [-687.525] (-690.865) * [-688.498] (-688.816) (-688.851) (-689.984) -- 0:00:23
614500 -- (-689.687) [-687.532] (-691.062) (-692.443) * [-687.450] (-686.819) (-693.186) (-687.364) -- 0:00:23
615000 -- (-687.270) [-688.326] (-691.449) (-688.237) * (-687.513) (-686.488) (-691.408) [-687.227] -- 0:00:23
Average standard deviation of split frequencies: 0.006989
615500 -- (-689.530) (-689.905) [-691.386] (-686.782) * [-687.828] (-686.816) (-686.573) (-686.997) -- 0:00:23
616000 -- [-689.439] (-691.103) (-692.495) (-689.281) * [-688.025] (-687.932) (-687.703) (-688.766) -- 0:00:23
616500 -- (-689.483) (-689.267) [-693.099] (-693.149) * (-691.028) (-687.244) [-686.417] (-688.950) -- 0:00:23
617000 -- [-687.783] (-697.561) (-688.451) (-687.897) * (-688.279) [-687.152] (-687.755) (-687.809) -- 0:00:23
617500 -- (-688.919) [-688.594] (-686.876) (-687.280) * (-688.864) (-690.486) (-689.318) [-688.541] -- 0:00:23
618000 -- (-687.319) (-687.711) (-687.563) [-686.951] * (-689.174) (-692.460) (-688.144) [-686.833] -- 0:00:23
618500 -- [-689.106] (-692.513) (-687.697) (-687.426) * (-689.718) (-689.423) (-686.334) [-686.267] -- 0:00:23
619000 -- [-687.314] (-689.386) (-687.926) (-688.295) * (-690.626) (-690.906) [-687.367] (-686.118) -- 0:00:23
619500 -- (-687.866) (-687.882) (-691.063) [-688.367] * (-689.856) (-691.633) [-686.432] (-686.149) -- 0:00:23
620000 -- (-690.118) [-688.935] (-688.382) (-686.795) * (-688.479) (-688.968) (-690.082) [-687.569] -- 0:00:23
Average standard deviation of split frequencies: 0.007241
620500 -- (-689.229) (-691.863) (-687.817) [-688.331] * (-690.619) (-690.071) [-687.667] (-692.140) -- 0:00:23
621000 -- [-688.782] (-691.117) (-686.364) (-690.467) * (-691.682) (-690.064) [-690.512] (-692.123) -- 0:00:23
621500 -- [-689.628] (-687.898) (-689.501) (-690.931) * (-690.561) (-687.825) [-688.637] (-694.415) -- 0:00:23
622000 -- (-688.390) (-689.454) [-687.891] (-689.173) * [-687.078] (-687.231) (-687.650) (-687.364) -- 0:00:23
622500 -- [-686.541] (-691.468) (-687.781) (-686.662) * (-690.545) (-691.709) [-686.709] (-687.053) -- 0:00:23
623000 -- (-686.912) [-687.154] (-687.323) (-691.546) * (-687.749) [-690.497] (-687.391) (-686.232) -- 0:00:23
623500 -- [-686.492] (-689.827) (-686.545) (-688.186) * (-690.534) [-687.139] (-691.295) (-692.049) -- 0:00:23
624000 -- (-695.387) (-690.323) [-691.837] (-689.883) * (-689.013) (-689.417) [-690.179] (-689.875) -- 0:00:23
624500 -- (-687.307) (-689.670) [-686.920] (-690.246) * (-694.030) (-687.526) (-689.304) [-688.894] -- 0:00:23
625000 -- (-691.578) (-687.545) [-691.073] (-689.117) * (-689.933) (-688.565) (-692.144) [-686.764] -- 0:00:23
Average standard deviation of split frequencies: 0.007330
625500 -- [-694.668] (-687.203) (-688.212) (-689.675) * [-686.444] (-689.401) (-687.542) (-687.190) -- 0:00:23
626000 -- [-687.214] (-687.941) (-690.347) (-690.323) * (-686.714) (-687.697) [-688.507] (-688.027) -- 0:00:23
626500 -- [-686.432] (-690.649) (-688.478) (-692.373) * (-689.667) [-687.280] (-690.215) (-689.472) -- 0:00:23
627000 -- [-687.164] (-686.614) (-689.060) (-688.870) * (-688.445) (-686.389) (-688.136) [-686.073] -- 0:00:23
627500 -- (-686.351) (-687.737) [-687.709] (-688.636) * (-686.761) (-688.749) [-686.673] (-687.310) -- 0:00:23
628000 -- (-687.466) (-691.382) (-688.572) [-688.728] * (-687.741) (-687.582) (-689.244) [-690.126] -- 0:00:23
628500 -- [-690.186] (-686.807) (-687.545) (-687.887) * (-687.552) (-686.781) [-688.580] (-688.413) -- 0:00:23
629000 -- (-692.537) (-686.709) (-689.189) [-688.148] * [-686.996] (-688.173) (-691.771) (-687.623) -- 0:00:23
629500 -- [-688.504] (-686.490) (-689.632) (-687.658) * (-687.370) [-688.005] (-687.388) (-688.909) -- 0:00:22
630000 -- (-690.161) (-692.083) (-687.205) [-686.706] * (-686.904) [-688.055] (-689.894) (-688.086) -- 0:00:22
Average standard deviation of split frequencies: 0.007574
630500 -- (-691.029) (-692.772) (-687.443) [-686.310] * (-688.058) (-687.787) [-688.333] (-690.640) -- 0:00:22
631000 -- (-695.846) (-688.274) [-688.053] (-688.276) * (-688.283) (-689.002) [-686.688] (-687.751) -- 0:00:22
631500 -- [-690.705] (-688.685) (-686.282) (-688.527) * (-690.371) (-689.211) [-689.850] (-688.726) -- 0:00:22
632000 -- (-688.323) [-688.338] (-687.618) (-689.820) * [-688.038] (-687.820) (-688.682) (-692.764) -- 0:00:22
632500 -- (-688.498) (-696.269) (-693.362) [-690.028] * (-686.940) (-689.176) [-689.692] (-687.077) -- 0:00:22
633000 -- (-690.817) [-691.221] (-689.065) (-694.238) * [-687.016] (-688.868) (-688.701) (-691.411) -- 0:00:22
633500 -- (-691.084) (-690.488) (-686.284) [-687.438] * (-688.571) (-690.089) (-690.736) [-689.648] -- 0:00:22
634000 -- [-690.809] (-686.836) (-686.828) (-687.291) * (-687.789) (-693.327) (-686.801) [-688.110] -- 0:00:22
634500 -- [-687.560] (-687.571) (-687.419) (-688.885) * (-688.114) [-686.982] (-686.144) (-691.284) -- 0:00:22
635000 -- (-686.939) [-690.526] (-686.744) (-689.918) * (-691.381) (-691.045) [-686.694] (-686.490) -- 0:00:22
Average standard deviation of split frequencies: 0.007610
635500 -- (-686.926) (-692.355) [-688.420] (-691.093) * (-689.508) (-688.156) (-688.329) [-686.340] -- 0:00:22
636000 -- (-689.489) (-694.042) (-690.914) [-686.521] * (-686.690) (-687.998) [-688.081] (-688.219) -- 0:00:22
636500 -- (-687.602) (-692.731) [-687.491] (-686.458) * (-686.516) (-690.444) (-686.378) [-686.429] -- 0:00:22
637000 -- (-687.876) [-686.675] (-686.847) (-690.920) * (-687.689) (-689.324) [-688.563] (-686.413) -- 0:00:22
637500 -- [-690.382] (-688.856) (-686.813) (-689.319) * (-687.046) (-687.631) [-687.694] (-688.830) -- 0:00:22
638000 -- (-686.970) (-687.424) (-688.008) [-688.414] * [-688.916] (-687.731) (-691.183) (-688.916) -- 0:00:22
638500 -- (-687.131) (-689.245) [-687.406] (-687.628) * [-687.971] (-688.142) (-690.346) (-686.233) -- 0:00:22
639000 -- (-690.624) (-689.762) (-689.599) [-689.189] * (-689.230) (-688.348) (-689.850) [-686.197] -- 0:00:22
639500 -- (-686.835) (-691.852) [-688.782] (-691.337) * (-688.736) (-691.735) [-686.774] (-689.781) -- 0:00:22
640000 -- (-691.195) (-691.967) [-687.638] (-691.550) * (-688.241) [-692.610] (-687.127) (-687.230) -- 0:00:22
Average standard deviation of split frequencies: 0.008094
640500 -- (-688.227) [-687.938] (-688.481) (-690.106) * (-691.030) [-688.861] (-686.981) (-689.123) -- 0:00:22
641000 -- (-687.237) (-688.165) (-689.008) [-687.456] * [-686.244] (-687.361) (-689.231) (-688.018) -- 0:00:22
641500 -- (-687.179) [-687.695] (-689.887) (-686.628) * (-686.399) (-687.644) (-687.469) [-688.188] -- 0:00:22
642000 -- (-689.051) (-688.671) (-687.537) [-689.659] * (-686.773) (-687.671) [-687.511] (-687.394) -- 0:00:22
642500 -- (-687.948) (-687.607) (-689.167) [-689.796] * [-687.843] (-688.061) (-687.399) (-687.851) -- 0:00:22
643000 -- (-686.984) (-687.247) (-691.356) [-691.782] * (-687.571) [-688.643] (-688.584) (-688.388) -- 0:00:22
643500 -- [-688.412] (-690.047) (-689.812) (-693.455) * [-688.364] (-687.795) (-687.478) (-689.750) -- 0:00:22
644000 -- (-692.953) [-687.261] (-687.349) (-686.626) * (-688.377) (-687.277) [-688.106] (-686.593) -- 0:00:22
644500 -- (-693.809) (-687.055) [-687.667] (-692.218) * (-690.083) (-690.189) (-687.565) [-686.381] -- 0:00:22
645000 -- (-699.663) [-687.294] (-686.769) (-687.936) * (-686.555) (-686.403) (-689.347) [-686.342] -- 0:00:22
Average standard deviation of split frequencies: 0.007978
645500 -- (-692.460) (-686.627) (-689.530) [-686.356] * [-688.403] (-687.851) (-694.025) (-690.774) -- 0:00:21
646000 -- (-690.086) (-688.945) [-687.345] (-687.580) * (-687.533) (-690.106) (-693.699) [-689.398] -- 0:00:21
646500 -- [-689.380] (-691.101) (-688.461) (-685.844) * (-688.281) (-687.438) (-687.095) [-689.891] -- 0:00:21
647000 -- (-688.777) (-690.351) [-687.515] (-686.997) * (-689.328) (-687.389) [-687.547] (-687.210) -- 0:00:21
647500 -- [-688.524] (-688.510) (-687.225) (-690.048) * (-686.760) [-687.084] (-689.272) (-688.396) -- 0:00:21
648000 -- (-688.927) [-686.925] (-687.926) (-690.225) * (-690.176) (-687.053) (-687.672) [-688.017] -- 0:00:21
648500 -- [-689.928] (-686.771) (-686.042) (-688.226) * [-686.523] (-687.406) (-688.455) (-690.082) -- 0:00:21
649000 -- (-688.810) [-686.440] (-687.730) (-689.607) * [-687.714] (-686.852) (-689.115) (-686.994) -- 0:00:21
649500 -- [-689.126] (-687.309) (-686.635) (-687.411) * (-688.991) (-687.447) (-687.279) [-686.331] -- 0:00:21
650000 -- (-689.811) (-688.698) [-686.355] (-687.275) * (-687.574) (-688.183) [-688.881] (-688.345) -- 0:00:21
Average standard deviation of split frequencies: 0.008066
650500 -- [-687.386] (-692.379) (-686.928) (-689.390) * [-686.251] (-687.932) (-688.362) (-689.250) -- 0:00:21
651000 -- (-688.570) (-689.780) [-687.360] (-690.831) * (-688.757) (-686.841) (-687.376) [-695.016] -- 0:00:21
651500 -- (-687.163) (-688.036) [-689.751] (-686.947) * (-688.561) [-690.294] (-688.217) (-686.399) -- 0:00:21
652000 -- (-688.115) (-690.932) [-687.017] (-687.472) * (-687.848) [-689.615] (-686.560) (-689.578) -- 0:00:21
652500 -- (-688.280) (-686.243) (-692.806) [-689.460] * (-687.001) (-688.362) [-688.890] (-688.315) -- 0:00:21
653000 -- (-688.221) [-689.329] (-691.757) (-692.873) * (-690.135) [-687.343] (-687.128) (-689.114) -- 0:00:21
653500 -- (-690.002) (-689.193) [-688.484] (-686.487) * (-687.420) (-689.473) (-688.842) [-687.894] -- 0:00:21
654000 -- [-690.945] (-688.993) (-687.746) (-688.576) * [-688.897] (-690.975) (-688.842) (-689.793) -- 0:00:21
654500 -- [-686.466] (-688.469) (-686.959) (-687.424) * (-686.576) (-691.286) (-687.752) [-689.242] -- 0:00:21
655000 -- (-686.351) [-686.156] (-685.920) (-687.330) * (-688.466) (-687.270) (-696.514) [-687.962] -- 0:00:21
Average standard deviation of split frequencies: 0.008527
655500 -- (-689.439) [-687.422] (-688.045) (-689.579) * (-686.741) (-690.301) (-688.168) [-687.836] -- 0:00:21
656000 -- (-686.346) (-691.162) (-688.676) [-687.644] * (-686.776) [-687.398] (-686.487) (-688.511) -- 0:00:21
656500 -- [-686.901] (-687.163) (-687.248) (-687.579) * (-688.048) (-687.131) (-688.031) [-686.897] -- 0:00:21
657000 -- (-688.342) [-687.083] (-686.477) (-688.739) * (-692.850) (-687.804) (-686.935) [-688.401] -- 0:00:21
657500 -- (-687.919) (-687.270) (-687.582) [-688.159] * (-686.883) [-690.399] (-686.370) (-690.213) -- 0:00:21
658000 -- (-693.222) (-690.488) [-686.650] (-690.375) * (-688.025) (-688.141) (-686.684) [-688.315] -- 0:00:21
658500 -- (-690.563) [-688.678] (-688.546) (-688.025) * (-688.967) (-689.755) (-686.721) [-687.365] -- 0:00:21
659000 -- (-691.118) (-688.510) (-689.986) [-688.125] * (-688.346) (-688.257) [-687.613] (-688.792) -- 0:00:21
659500 -- (-689.623) [-686.988] (-691.101) (-689.781) * (-687.516) (-690.867) [-687.127] (-692.840) -- 0:00:21
660000 -- [-686.300] (-686.943) (-689.732) (-690.718) * [-686.573] (-688.510) (-687.029) (-687.204) -- 0:00:21
Average standard deviation of split frequencies: 0.008229
660500 -- (-687.577) (-688.052) (-688.611) [-688.316] * [-686.838] (-687.826) (-691.148) (-690.934) -- 0:00:21
661000 -- (-688.032) [-687.423] (-688.797) (-687.846) * (-688.532) [-687.158] (-690.359) (-691.123) -- 0:00:21
661500 -- [-688.562] (-688.668) (-690.239) (-693.166) * [-688.273] (-696.556) (-687.707) (-687.162) -- 0:00:20
662000 -- (-688.403) [-688.275] (-687.788) (-690.551) * (-690.414) (-690.604) [-688.750] (-686.766) -- 0:00:20
662500 -- (-689.870) [-690.398] (-689.088) (-689.299) * [-689.917] (-687.163) (-686.977) (-687.200) -- 0:00:20
663000 -- [-688.676] (-689.497) (-687.151) (-687.068) * (-689.455) (-687.196) [-686.669] (-687.697) -- 0:00:20
663500 -- (-688.967) (-687.220) [-687.463] (-686.993) * (-687.584) (-687.217) (-688.071) [-692.244] -- 0:00:20
664000 -- (-688.045) (-690.925) [-687.094] (-687.128) * (-690.581) [-689.754] (-687.452) (-690.452) -- 0:00:20
664500 -- [-687.422] (-690.408) (-689.396) (-686.931) * (-687.923) (-690.019) (-686.605) [-689.806] -- 0:00:20
665000 -- (-687.844) (-687.361) (-687.430) [-688.274] * [-686.701] (-689.229) (-692.004) (-687.957) -- 0:00:20
Average standard deviation of split frequencies: 0.008494
665500 -- (-687.362) (-687.740) (-687.058) [-687.291] * (-689.923) (-687.586) [-690.319] (-688.771) -- 0:00:20
666000 -- (-687.426) (-689.211) [-687.882] (-688.955) * (-688.591) [-689.883] (-688.456) (-688.712) -- 0:00:20
666500 -- [-687.844] (-687.237) (-687.268) (-686.093) * (-691.376) (-689.407) [-686.413] (-689.356) -- 0:00:20
667000 -- (-689.041) [-688.280] (-687.308) (-688.006) * (-689.252) [-688.480] (-687.204) (-690.631) -- 0:00:20
667500 -- [-688.603] (-686.691) (-686.258) (-686.635) * (-689.035) (-688.072) (-687.096) [-687.749] -- 0:00:20
668000 -- (-688.114) (-688.216) [-686.659] (-688.002) * [-687.312] (-688.974) (-691.377) (-686.901) -- 0:00:20
668500 -- [-687.247] (-688.496) (-689.418) (-692.869) * [-689.192] (-690.310) (-687.887) (-686.227) -- 0:00:20
669000 -- (-686.218) (-686.818) (-693.204) [-688.042] * (-690.834) (-688.742) [-687.680] (-691.620) -- 0:00:20
669500 -- [-686.808] (-687.769) (-688.015) (-694.159) * (-687.286) [-688.338] (-687.282) (-689.404) -- 0:00:20
670000 -- (-688.738) [-687.611] (-692.872) (-686.859) * (-687.286) (-691.604) [-688.133] (-687.963) -- 0:00:20
Average standard deviation of split frequencies: 0.008669
670500 -- [-688.473] (-687.807) (-691.620) (-689.800) * (-688.531) (-690.331) (-688.490) [-688.615] -- 0:00:20
671000 -- (-688.306) (-689.701) [-688.315] (-689.563) * (-686.519) (-689.486) (-687.891) [-688.492] -- 0:00:20
671500 -- [-686.369] (-688.568) (-697.994) (-689.688) * [-686.566] (-688.283) (-688.755) (-687.423) -- 0:00:20
672000 -- (-687.508) (-686.712) [-686.336] (-690.202) * (-686.137) [-690.631] (-689.600) (-687.074) -- 0:00:20
672500 -- (-688.404) (-685.996) (-689.200) [-687.682] * [-686.224] (-687.687) (-688.714) (-688.780) -- 0:00:20
673000 -- (-686.820) [-690.216] (-686.848) (-688.720) * (-686.224) [-693.176] (-686.908) (-687.749) -- 0:00:20
673500 -- [-687.494] (-691.578) (-687.086) (-686.981) * [-687.030] (-691.064) (-686.721) (-692.020) -- 0:00:20
674000 -- (-689.499) (-690.880) (-689.319) [-687.054] * (-688.497) (-687.937) (-689.507) [-693.015] -- 0:00:20
674500 -- (-694.155) (-687.907) (-688.826) [-687.629] * (-690.906) (-692.695) (-686.694) [-689.893] -- 0:00:20
675000 -- [-686.636] (-688.264) (-688.490) (-688.071) * (-691.243) [-686.992] (-687.814) (-688.013) -- 0:00:20
Average standard deviation of split frequencies: 0.008833
675500 -- (-686.714) (-687.621) (-689.929) [-689.003] * (-691.429) (-686.819) (-687.896) [-688.687] -- 0:00:20
676000 -- (-687.325) (-688.384) [-687.549] (-687.223) * (-687.482) (-686.959) [-689.230] (-688.398) -- 0:00:20
676500 -- [-686.497] (-688.478) (-687.459) (-688.178) * (-688.030) [-689.245] (-686.455) (-689.446) -- 0:00:20
677000 -- [-688.831] (-688.448) (-690.213) (-687.957) * (-687.055) [-688.655] (-688.748) (-687.877) -- 0:00:20
677500 -- (-688.288) (-695.396) (-689.025) [-687.259] * (-687.467) (-690.218) (-689.393) [-687.612] -- 0:00:19
678000 -- (-690.224) (-689.953) [-686.707] (-686.900) * (-686.822) (-690.301) [-688.705] (-687.927) -- 0:00:19
678500 -- (-690.912) (-689.227) (-688.696) [-686.859] * (-691.285) (-689.269) [-687.506] (-687.913) -- 0:00:19
679000 -- (-687.440) (-690.571) [-689.558] (-688.328) * [-689.057] (-686.927) (-692.723) (-688.626) -- 0:00:19
679500 -- (-687.864) [-689.800] (-693.505) (-687.353) * [-688.590] (-688.657) (-691.195) (-688.818) -- 0:00:19
680000 -- (-691.813) [-686.750] (-694.073) (-687.585) * (-687.799) [-688.850] (-690.751) (-688.681) -- 0:00:19
Average standard deviation of split frequencies: 0.009142
680500 -- (-690.016) (-688.213) [-688.738] (-692.716) * (-693.444) (-688.338) [-686.422] (-693.258) -- 0:00:19
681000 -- (-686.144) (-690.637) (-686.260) [-687.733] * (-686.391) (-687.012) (-691.822) [-688.735] -- 0:00:19
681500 -- (-688.440) (-688.732) [-686.555] (-691.031) * [-686.638] (-687.789) (-689.050) (-690.165) -- 0:00:19
682000 -- [-688.434] (-686.641) (-686.711) (-690.403) * [-688.684] (-686.237) (-689.705) (-692.919) -- 0:00:19
682500 -- (-688.230) (-687.278) [-691.971] (-689.226) * (-688.438) (-688.707) (-689.804) [-688.202] -- 0:00:19
683000 -- [-687.208] (-687.914) (-686.689) (-688.586) * (-688.512) (-686.513) (-689.596) [-689.464] -- 0:00:19
683500 -- (-686.760) [-690.854] (-690.111) (-689.984) * (-690.442) [-686.919] (-687.590) (-687.148) -- 0:00:19
684000 -- [-688.644] (-686.227) (-689.404) (-689.236) * (-687.826) [-689.277] (-688.068) (-688.873) -- 0:00:19
684500 -- [-686.590] (-693.864) (-688.021) (-689.514) * (-688.410) (-690.849) [-687.301] (-688.561) -- 0:00:19
685000 -- (-687.149) [-686.727] (-691.321) (-690.083) * (-688.259) (-691.218) (-686.642) [-689.465] -- 0:00:19
Average standard deviation of split frequencies: 0.009025
685500 -- [-686.876] (-686.956) (-689.464) (-688.167) * [-688.359] (-686.779) (-689.491) (-689.082) -- 0:00:19
686000 -- [-688.237] (-687.032) (-690.553) (-688.655) * (-688.060) (-687.565) [-687.733] (-689.419) -- 0:00:19
686500 -- (-695.113) [-687.885] (-690.226) (-687.101) * (-686.097) [-688.023] (-687.703) (-691.051) -- 0:00:19
687000 -- (-689.655) [-688.244] (-687.193) (-686.247) * (-686.709) (-687.119) (-687.586) [-690.118] -- 0:00:19
687500 -- (-692.500) [-689.015] (-693.852) (-686.673) * [-686.837] (-687.386) (-689.149) (-687.089) -- 0:00:19
688000 -- (-690.061) [-688.125] (-690.803) (-687.698) * (-686.776) [-687.142] (-689.269) (-690.249) -- 0:00:19
688500 -- (-690.448) [-686.650] (-686.938) (-687.528) * (-689.630) [-686.648] (-688.467) (-688.528) -- 0:00:19
689000 -- (-690.880) (-690.793) [-691.701] (-689.400) * (-686.608) (-689.574) (-688.824) [-688.624] -- 0:00:19
689500 -- (-689.963) [-687.396] (-690.850) (-688.399) * (-688.335) [-687.177] (-691.995) (-689.458) -- 0:00:19
690000 -- (-689.013) (-686.044) [-687.967] (-688.391) * (-687.454) (-686.619) [-687.448] (-688.709) -- 0:00:19
Average standard deviation of split frequencies: 0.008691
690500 -- (-689.120) (-686.152) [-686.997] (-689.444) * (-695.639) (-687.778) [-687.388] (-688.495) -- 0:00:19
691000 -- [-687.507] (-690.861) (-687.777) (-687.455) * [-693.230] (-688.934) (-688.372) (-689.763) -- 0:00:19
691500 -- (-686.627) (-688.929) [-686.447] (-688.981) * (-689.657) (-688.493) [-686.729] (-691.410) -- 0:00:19
692000 -- [-689.264] (-691.187) (-688.294) (-689.089) * (-689.873) (-689.328) [-687.260] (-687.982) -- 0:00:19
692500 -- [-686.906] (-687.914) (-690.425) (-689.591) * (-688.658) (-688.121) [-687.221] (-688.522) -- 0:00:19
693000 -- [-688.181] (-688.151) (-689.332) (-689.245) * [-687.929] (-690.690) (-688.423) (-688.259) -- 0:00:19
693500 -- [-687.182] (-688.723) (-687.276) (-687.239) * (-687.077) (-687.009) (-687.306) [-686.348] -- 0:00:19
694000 -- [-689.075] (-686.833) (-686.970) (-687.624) * (-687.062) [-686.611] (-688.228) (-687.063) -- 0:00:18
694500 -- (-691.137) (-686.492) [-688.021] (-686.928) * (-687.996) (-686.307) (-686.122) [-687.602] -- 0:00:18
695000 -- (-688.976) (-688.650) [-686.787] (-691.257) * [-688.110] (-686.598) (-686.121) (-690.997) -- 0:00:18
Average standard deviation of split frequencies: 0.008670
695500 -- (-687.898) [-690.206] (-688.518) (-690.485) * [-688.004] (-690.319) (-687.286) (-692.425) -- 0:00:18
696000 -- (-687.004) (-687.969) [-690.178] (-689.313) * [-690.385] (-691.982) (-689.350) (-692.545) -- 0:00:18
696500 -- (-686.753) [-687.645] (-689.548) (-690.121) * (-687.936) [-691.256] (-689.691) (-689.964) -- 0:00:18
697000 -- (-687.730) (-688.408) [-688.366] (-689.094) * (-688.113) (-690.508) [-688.281] (-690.513) -- 0:00:18
697500 -- (-686.786) [-688.790] (-688.365) (-687.656) * (-687.684) (-687.810) [-688.578] (-690.108) -- 0:00:18
698000 -- [-686.653] (-687.970) (-687.938) (-687.490) * (-688.504) [-687.765] (-688.539) (-689.419) -- 0:00:18
698500 -- [-688.918] (-689.779) (-687.950) (-688.551) * (-690.039) [-687.914] (-688.793) (-690.198) -- 0:00:18
699000 -- (-688.907) [-695.435] (-690.735) (-686.091) * (-687.929) (-686.441) [-686.447] (-687.963) -- 0:00:18
699500 -- [-689.782] (-688.934) (-691.779) (-685.851) * (-690.895) [-686.324] (-688.231) (-687.082) -- 0:00:18
700000 -- (-687.941) [-691.270] (-689.534) (-686.215) * (-689.782) [-687.738] (-689.372) (-688.071) -- 0:00:18
Average standard deviation of split frequencies: 0.009105
700500 -- (-690.005) (-687.794) (-688.422) [-686.524] * [-690.087] (-688.302) (-687.841) (-687.803) -- 0:00:18
701000 -- [-688.514] (-688.183) (-687.214) (-688.408) * (-689.241) (-688.412) [-686.770] (-692.745) -- 0:00:18
701500 -- [-689.140] (-689.091) (-686.571) (-686.631) * [-687.446] (-688.823) (-688.208) (-692.452) -- 0:00:18
702000 -- [-688.862] (-689.958) (-687.552) (-688.923) * (-686.915) [-686.491] (-687.129) (-688.103) -- 0:00:18
702500 -- [-689.491] (-686.495) (-688.317) (-688.544) * (-687.995) [-686.974] (-687.133) (-687.820) -- 0:00:18
703000 -- (-689.970) (-689.384) [-687.326] (-690.234) * [-690.601] (-686.226) (-686.672) (-687.669) -- 0:00:18
703500 -- (-688.218) (-690.926) [-687.265] (-692.905) * (-687.283) (-686.959) [-686.119] (-689.445) -- 0:00:18
704000 -- (-687.584) (-687.696) [-688.831] (-688.716) * (-690.810) [-688.255] (-687.281) (-687.311) -- 0:00:18
704500 -- [-687.564] (-690.429) (-686.263) (-692.731) * [-689.621] (-690.469) (-688.291) (-687.000) -- 0:00:18
705000 -- (-690.125) [-688.319] (-688.202) (-693.092) * (-687.881) (-686.449) [-687.558] (-691.327) -- 0:00:18
Average standard deviation of split frequencies: 0.008458
705500 -- (-687.093) (-689.480) [-686.176] (-693.926) * (-693.030) (-688.667) [-686.835] (-688.883) -- 0:00:18
706000 -- (-688.296) [-688.968] (-688.500) (-687.167) * (-694.109) (-687.580) [-685.908] (-687.840) -- 0:00:18
706500 -- (-690.553) [-687.037] (-688.237) (-687.363) * (-689.285) [-688.025] (-689.839) (-688.268) -- 0:00:18
707000 -- [-689.404] (-687.655) (-690.870) (-689.901) * (-689.180) [-688.358] (-688.890) (-689.327) -- 0:00:18
707500 -- (-689.074) (-686.903) (-686.385) [-687.906] * [-691.570] (-687.894) (-689.472) (-687.223) -- 0:00:18
708000 -- (-687.105) (-686.728) [-686.092] (-689.470) * [-689.789] (-685.983) (-690.496) (-688.085) -- 0:00:18
708500 -- (-688.290) (-686.999) [-686.990] (-689.330) * (-688.048) (-687.794) [-690.211] (-688.289) -- 0:00:18
709000 -- (-691.086) (-688.648) (-687.284) [-688.834] * [-687.957] (-687.635) (-687.677) (-689.411) -- 0:00:18
709500 -- (-689.048) [-690.488] (-689.663) (-687.546) * [-687.360] (-687.101) (-687.299) (-689.604) -- 0:00:18
710000 -- [-686.356] (-689.154) (-692.283) (-687.374) * (-686.602) (-688.004) (-687.554) [-691.829] -- 0:00:17
Average standard deviation of split frequencies: 0.008137
710500 -- [-688.229] (-690.585) (-691.599) (-690.843) * (-687.670) (-689.384) [-687.968] (-688.470) -- 0:00:17
711000 -- [-688.785] (-697.556) (-690.437) (-688.913) * [-686.634] (-692.462) (-689.804) (-691.314) -- 0:00:17
711500 -- (-690.941) (-692.804) [-688.097] (-686.299) * [-688.517] (-691.647) (-690.281) (-690.784) -- 0:00:17
712000 -- [-689.411] (-688.646) (-691.630) (-687.148) * (-687.833) (-690.949) [-693.410] (-688.879) -- 0:00:17
712500 -- [-689.879] (-688.537) (-689.529) (-687.368) * [-687.751] (-691.465) (-691.156) (-689.539) -- 0:00:17
713000 -- [-689.643] (-688.208) (-688.802) (-692.246) * [-686.741] (-689.073) (-689.451) (-688.202) -- 0:00:17
713500 -- (-693.272) (-687.084) (-690.333) [-689.924] * (-688.684) (-688.589) [-690.993] (-687.207) -- 0:00:17
714000 -- [-686.995] (-691.107) (-689.595) (-688.810) * [-688.012] (-689.497) (-692.208) (-688.240) -- 0:00:17
714500 -- [-687.479] (-687.406) (-689.000) (-687.128) * (-690.221) (-686.881) [-688.799] (-687.415) -- 0:00:17
715000 -- (-689.894) (-691.699) [-687.221] (-687.865) * (-687.074) (-691.412) (-689.941) [-688.443] -- 0:00:17
Average standard deviation of split frequencies: 0.008296
715500 -- (-687.322) [-688.988] (-688.480) (-687.716) * [-687.791] (-687.522) (-688.647) (-686.333) -- 0:00:17
716000 -- (-686.188) (-690.762) (-689.909) [-687.471] * (-688.968) (-686.425) [-691.237] (-687.274) -- 0:00:17
716500 -- (-690.019) [-687.408] (-688.958) (-689.869) * (-688.510) (-691.067) [-690.802] (-688.549) -- 0:00:17
717000 -- [-690.334] (-686.031) (-689.280) (-689.469) * [-688.684] (-687.781) (-688.196) (-689.603) -- 0:00:17
717500 -- (-694.730) (-687.547) (-687.679) [-688.131] * (-689.255) (-688.277) [-691.315] (-688.700) -- 0:00:17
718000 -- (-687.860) (-689.033) [-687.463] (-686.828) * (-687.539) (-688.158) [-688.132] (-686.632) -- 0:00:17
718500 -- (-687.488) (-690.247) (-688.541) [-687.408] * [-687.115] (-687.472) (-690.602) (-688.322) -- 0:00:17
719000 -- (-689.701) [-690.503] (-690.107) (-686.501) * [-688.216] (-687.180) (-687.855) (-692.643) -- 0:00:17
719500 -- (-688.559) (-690.717) [-686.133] (-686.390) * [-687.700] (-688.753) (-687.872) (-689.877) -- 0:00:17
720000 -- (-689.051) (-688.956) (-688.940) [-686.783] * (-688.247) [-689.293] (-691.289) (-688.325) -- 0:00:17
Average standard deviation of split frequencies: 0.007675
720500 -- [-688.246] (-688.403) (-687.341) (-686.928) * (-686.591) (-691.038) (-690.217) [-689.390] -- 0:00:17
721000 -- (-687.130) (-693.595) (-687.217) [-686.087] * (-687.393) (-691.867) (-687.427) [-687.358] -- 0:00:17
721500 -- (-687.579) (-688.675) (-688.131) [-686.091] * (-687.619) (-691.333) [-687.985] (-690.229) -- 0:00:17
722000 -- (-686.077) (-689.940) (-689.622) [-688.428] * [-686.617] (-691.867) (-687.910) (-694.378) -- 0:00:17
722500 -- (-692.332) [-689.118] (-688.294) (-688.407) * [-687.966] (-689.203) (-687.350) (-690.623) -- 0:00:17
723000 -- (-688.127) [-686.868] (-687.248) (-689.229) * [-688.531] (-687.548) (-686.943) (-688.269) -- 0:00:17
723500 -- (-687.450) (-687.835) [-688.431] (-690.085) * (-688.196) [-687.711] (-686.550) (-689.666) -- 0:00:17
724000 -- (-686.881) (-691.155) [-687.092] (-689.145) * (-688.135) (-688.671) (-693.351) [-687.556] -- 0:00:17
724500 -- [-689.050] (-690.450) (-688.590) (-688.868) * [-689.353] (-687.913) (-688.396) (-688.927) -- 0:00:17
725000 -- (-686.660) (-687.908) (-687.602) [-686.383] * (-691.042) [-687.117] (-688.949) (-689.226) -- 0:00:17
Average standard deviation of split frequencies: 0.007489
725500 -- (-686.754) [-688.061] (-687.918) (-687.495) * (-688.909) [-691.539] (-690.246) (-687.144) -- 0:00:17
726000 -- (-688.746) (-687.094) (-686.940) [-686.971] * (-688.374) [-689.063] (-686.700) (-686.858) -- 0:00:16
726500 -- [-688.627] (-686.787) (-687.139) (-687.013) * [-686.831] (-688.230) (-688.930) (-690.991) -- 0:00:16
727000 -- [-687.891] (-687.799) (-687.683) (-692.075) * [-686.537] (-689.690) (-687.830) (-692.511) -- 0:00:16
727500 -- (-689.183) (-691.807) [-689.691] (-691.118) * (-691.230) (-687.639) [-687.997] (-688.903) -- 0:00:16
728000 -- (-688.258) (-689.272) (-691.837) [-688.027] * (-689.327) [-688.750] (-688.850) (-689.920) -- 0:00:16
728500 -- (-689.491) (-686.973) [-686.253] (-690.768) * [-690.814] (-687.867) (-687.095) (-686.482) -- 0:00:16
729000 -- (-688.309) (-689.506) (-690.256) [-690.828] * (-689.586) (-687.780) [-688.678] (-686.103) -- 0:00:16
729500 -- (-686.875) (-687.909) (-687.898) [-690.646] * (-689.586) (-689.211) [-689.698] (-689.046) -- 0:00:16
730000 -- (-686.838) (-692.471) [-686.845] (-688.193) * [-687.079] (-689.501) (-688.505) (-686.286) -- 0:00:16
Average standard deviation of split frequencies: 0.007527
730500 -- (-685.954) (-692.524) (-687.742) [-689.689] * [-686.609] (-687.390) (-689.497) (-688.960) -- 0:00:16
731000 -- (-687.488) (-690.822) [-687.419] (-688.470) * (-687.526) (-687.013) [-688.902] (-688.342) -- 0:00:16
731500 -- (-687.358) (-687.786) [-686.710] (-687.968) * (-687.937) (-689.274) (-686.799) [-686.398] -- 0:00:16
732000 -- [-687.398] (-688.152) (-686.771) (-688.910) * (-688.800) (-686.326) [-687.965] (-691.679) -- 0:00:16
732500 -- (-689.062) (-687.605) [-687.424] (-688.136) * (-687.042) (-688.731) (-691.140) [-692.256] -- 0:00:16
733000 -- (-687.117) (-690.095) [-688.094] (-688.018) * [-688.626] (-687.007) (-689.555) (-692.045) -- 0:00:16
733500 -- (-686.870) (-690.441) (-687.745) [-688.233] * (-689.299) (-687.287) (-686.683) [-687.563] -- 0:00:16
734000 -- [-688.960] (-691.154) (-687.817) (-687.668) * [-691.222] (-692.637) (-688.968) (-690.289) -- 0:00:16
734500 -- (-688.028) (-689.656) (-687.227) [-686.941] * (-688.223) [-689.889] (-689.105) (-688.444) -- 0:00:16
735000 -- (-688.589) [-689.016] (-690.243) (-689.073) * (-689.307) (-692.837) [-688.109] (-686.514) -- 0:00:16
Average standard deviation of split frequencies: 0.007686
735500 -- (-686.498) (-687.145) (-690.767) [-688.130] * (-688.210) (-690.004) [-686.931] (-689.105) -- 0:00:16
736000 -- (-689.954) (-687.251) [-690.065] (-688.074) * (-688.826) [-688.862] (-688.665) (-694.662) -- 0:00:16
736500 -- (-690.036) (-686.675) (-688.167) [-690.167] * (-688.713) (-688.623) [-690.571] (-692.952) -- 0:00:16
737000 -- (-686.363) [-690.191] (-688.444) (-691.223) * [-688.188] (-688.807) (-688.543) (-690.000) -- 0:00:16
737500 -- (-688.364) (-690.827) [-687.996] (-686.917) * [-689.050] (-686.728) (-692.200) (-686.164) -- 0:00:16
738000 -- [-687.872] (-688.825) (-686.297) (-687.147) * (-692.589) (-687.022) [-693.308] (-686.057) -- 0:00:16
738500 -- (-690.557) (-692.603) (-686.675) [-687.863] * [-687.945] (-687.360) (-686.883) (-686.025) -- 0:00:16
739000 -- [-688.611] (-690.629) (-686.379) (-687.452) * [-688.246] (-686.923) (-687.915) (-689.014) -- 0:00:16
739500 -- [-691.442] (-688.726) (-685.952) (-693.074) * (-689.110) [-689.783] (-686.038) (-686.487) -- 0:00:16
740000 -- [-686.748] (-688.061) (-686.253) (-686.462) * (-691.011) (-690.944) [-689.282] (-689.366) -- 0:00:16
Average standard deviation of split frequencies: 0.007680
740500 -- (-687.200) (-688.591) [-687.114] (-690.173) * [-689.411] (-688.805) (-687.871) (-689.805) -- 0:00:16
741000 -- (-686.876) [-698.328] (-687.115) (-688.513) * [-688.710] (-689.901) (-690.538) (-687.547) -- 0:00:16
741500 -- [-690.119] (-688.001) (-692.120) (-687.730) * [-692.659] (-689.536) (-690.228) (-687.687) -- 0:00:16
742000 -- [-690.524] (-690.688) (-686.621) (-690.947) * (-691.208) [-690.506] (-691.354) (-687.213) -- 0:00:15
742500 -- (-687.705) (-691.510) [-687.802] (-690.200) * (-692.066) [-686.980] (-688.071) (-688.671) -- 0:00:15
743000 -- (-692.294) [-687.507] (-688.140) (-689.125) * (-690.300) [-689.312] (-687.141) (-688.241) -- 0:00:15
743500 -- (-689.188) (-688.041) (-691.398) [-693.716] * [-687.166] (-687.335) (-687.142) (-690.229) -- 0:00:15
744000 -- (-686.466) (-689.936) [-686.157] (-690.666) * (-688.679) (-687.642) (-689.306) [-689.575] -- 0:00:15
744500 -- (-687.210) (-688.162) [-686.296] (-686.919) * (-688.758) [-686.879] (-686.189) (-687.916) -- 0:00:15
745000 -- (-687.330) (-687.677) [-687.837] (-688.132) * (-689.312) [-687.927] (-688.767) (-688.548) -- 0:00:15
Average standard deviation of split frequencies: 0.007667
745500 -- (-687.436) (-688.669) (-687.123) [-688.553] * [-689.114] (-686.771) (-686.638) (-689.077) -- 0:00:15
746000 -- (-690.450) [-686.796] (-686.567) (-688.776) * (-689.243) (-687.964) (-686.616) [-691.507] -- 0:00:15
746500 -- [-686.274] (-687.930) (-687.501) (-688.193) * [-689.926] (-686.586) (-686.606) (-688.342) -- 0:00:15
747000 -- (-688.407) (-686.962) (-688.889) [-687.467] * (-691.099) [-687.579] (-687.139) (-693.170) -- 0:00:15
747500 -- (-687.781) [-688.023] (-688.001) (-687.979) * (-688.141) (-690.730) (-689.318) [-690.294] -- 0:00:15
748000 -- (-688.223) (-687.510) [-686.997] (-688.454) * (-689.183) [-689.669] (-687.406) (-688.811) -- 0:00:15
748500 -- [-686.565] (-687.700) (-688.386) (-689.876) * (-691.223) (-687.709) (-690.302) [-687.088] -- 0:00:15
749000 -- [-687.860] (-688.715) (-688.550) (-686.614) * (-689.976) (-687.603) (-691.321) [-687.317] -- 0:00:15
749500 -- [-691.445] (-688.161) (-690.974) (-686.227) * (-689.022) (-686.983) [-688.360] (-688.834) -- 0:00:15
750000 -- (-687.217) (-687.372) [-687.847] (-689.357) * (-688.582) [-686.391] (-689.322) (-687.269) -- 0:00:15
Average standard deviation of split frequencies: 0.007410
750500 -- [-687.650] (-689.246) (-693.453) (-688.942) * [-687.335] (-686.057) (-690.171) (-689.111) -- 0:00:15
751000 -- [-689.717] (-689.849) (-688.403) (-688.199) * (-691.401) (-688.494) (-687.609) [-687.891] -- 0:00:15
751500 -- (-688.514) (-688.763) (-687.989) [-686.415] * (-692.691) [-688.952] (-687.502) (-686.395) -- 0:00:15
752000 -- (-689.985) [-688.129] (-689.004) (-689.778) * (-691.339) (-686.912) (-690.426) [-690.060] -- 0:00:15
752500 -- (-689.053) (-686.980) [-689.925] (-688.007) * (-690.255) (-689.478) [-688.312] (-692.154) -- 0:00:15
753000 -- (-688.667) (-688.520) (-686.969) [-688.053] * (-686.705) (-686.765) [-686.704] (-687.326) -- 0:00:15
753500 -- (-688.129) [-687.154] (-687.139) (-689.009) * (-690.584) (-692.115) [-686.416] (-689.596) -- 0:00:15
754000 -- (-687.907) [-686.802] (-686.417) (-692.802) * (-687.654) [-688.594] (-688.815) (-693.684) -- 0:00:15
754500 -- [-690.481] (-687.982) (-688.269) (-689.268) * (-694.416) [-686.883] (-691.397) (-691.709) -- 0:00:15
755000 -- (-687.871) [-685.821] (-689.404) (-688.723) * [-689.982] (-688.213) (-689.106) (-689.633) -- 0:00:15
Average standard deviation of split frequencies: 0.007441
755500 -- (-686.281) [-685.821] (-691.859) (-692.530) * (-688.900) (-688.838) (-689.722) [-688.231] -- 0:00:15
756000 -- (-686.077) [-686.937] (-688.402) (-693.916) * (-689.744) (-688.737) [-687.234] (-688.840) -- 0:00:15
756500 -- [-687.364] (-686.283) (-687.001) (-687.458) * (-693.493) (-688.978) (-687.895) [-687.388] -- 0:00:15
757000 -- (-688.868) (-688.407) [-688.099] (-687.718) * (-688.359) [-687.780] (-688.241) (-686.643) -- 0:00:15
757500 -- (-687.722) (-687.654) [-689.609] (-691.334) * [-687.570] (-687.933) (-686.910) (-687.226) -- 0:00:15
758000 -- (-687.922) [-690.149] (-688.473) (-689.490) * (-686.725) (-687.125) (-687.338) [-688.000] -- 0:00:15
758500 -- [-688.550] (-689.087) (-687.627) (-689.314) * (-689.506) [-690.449] (-686.840) (-688.868) -- 0:00:14
759000 -- (-688.570) [-687.940] (-694.088) (-690.121) * (-690.005) [-688.225] (-687.993) (-685.907) -- 0:00:14
759500 -- [-688.659] (-687.511) (-690.091) (-689.470) * (-693.003) [-687.361] (-688.290) (-687.230) -- 0:00:14
760000 -- (-689.356) (-687.300) [-687.536] (-687.822) * (-687.552) (-687.596) [-689.451] (-687.210) -- 0:00:14
Average standard deviation of split frequencies: 0.007189
760500 -- [-686.788] (-688.077) (-686.581) (-686.667) * (-688.480) [-687.899] (-689.360) (-686.963) -- 0:00:14
761000 -- (-689.037) [-686.720] (-689.736) (-687.474) * (-686.310) (-689.811) (-690.218) [-686.969] -- 0:00:14
761500 -- (-687.275) [-687.421] (-687.495) (-688.406) * [-689.094] (-691.149) (-689.513) (-686.156) -- 0:00:14
762000 -- [-686.284] (-686.476) (-688.003) (-689.502) * (-690.646) (-688.910) (-687.180) [-687.138] -- 0:00:14
762500 -- (-687.297) (-686.913) (-688.003) [-688.186] * (-688.720) [-687.226] (-686.748) (-686.107) -- 0:00:14
763000 -- (-694.010) (-686.572) (-688.330) [-689.248] * (-687.763) (-689.351) [-686.697] (-687.649) -- 0:00:14
763500 -- (-688.702) (-687.918) (-687.658) [-686.566] * (-687.914) (-690.264) [-688.054] (-688.715) -- 0:00:14
764000 -- [-688.082] (-689.838) (-687.942) (-686.182) * (-695.222) (-689.652) (-690.866) [-686.426] -- 0:00:14
764500 -- (-689.572) [-686.270] (-687.865) (-687.673) * (-691.267) [-691.426] (-689.099) (-687.483) -- 0:00:14
765000 -- (-687.976) (-686.162) (-686.811) [-688.431] * (-690.963) [-686.776] (-690.578) (-686.750) -- 0:00:14
Average standard deviation of split frequencies: 0.007303
765500 -- (-688.375) (-686.126) [-689.294] (-689.111) * (-689.486) (-687.995) (-688.120) [-687.331] -- 0:00:14
766000 -- (-687.407) (-686.953) [-690.665] (-687.237) * (-689.638) (-687.450) (-686.507) [-688.183] -- 0:00:14
766500 -- (-693.143) (-689.073) [-694.142] (-692.931) * (-689.580) [-688.018] (-686.743) (-693.299) -- 0:00:14
767000 -- (-689.627) (-688.099) (-687.939) [-689.963] * (-689.828) [-688.662] (-687.757) (-688.512) -- 0:00:14
767500 -- (-687.399) [-688.790] (-687.717) (-689.315) * (-690.461) (-687.113) (-688.374) [-687.520] -- 0:00:14
768000 -- (-687.320) (-687.472) [-689.684] (-686.921) * (-688.390) (-687.811) [-687.568] (-686.559) -- 0:00:14
768500 -- (-686.658) [-687.758] (-688.039) (-689.885) * (-686.958) (-686.139) [-686.291] (-687.018) -- 0:00:14
769000 -- (-688.117) [-688.811] (-688.273) (-688.646) * [-687.668] (-688.542) (-689.924) (-690.715) -- 0:00:14
769500 -- [-687.197] (-688.331) (-687.831) (-689.276) * [-687.045] (-688.717) (-686.549) (-686.115) -- 0:00:14
770000 -- (-687.789) [-686.975] (-687.026) (-687.454) * (-689.059) (-688.292) (-688.505) [-686.868] -- 0:00:14
Average standard deviation of split frequencies: 0.007096
770500 -- (-690.062) (-689.348) [-689.964] (-688.895) * (-690.655) (-689.235) (-692.097) [-687.520] -- 0:00:14
771000 -- [-687.125] (-686.841) (-687.597) (-687.987) * [-689.745] (-691.140) (-688.181) (-687.830) -- 0:00:14
771500 -- (-688.280) (-687.900) [-688.277] (-690.897) * [-689.540] (-688.530) (-689.305) (-689.474) -- 0:00:14
772000 -- (-687.122) [-687.441] (-688.070) (-686.183) * (-688.221) (-687.888) (-691.413) [-686.677] -- 0:00:14
772500 -- (-687.200) (-688.841) (-689.909) [-686.262] * (-687.025) (-686.695) [-687.164] (-687.653) -- 0:00:14
773000 -- (-687.981) (-687.586) [-686.285] (-686.605) * (-687.241) (-687.556) [-688.082] (-688.271) -- 0:00:14
773500 -- (-689.703) (-687.193) [-687.971] (-686.779) * [-686.936] (-689.509) (-687.426) (-688.447) -- 0:00:14
774000 -- (-690.576) (-688.735) [-687.351] (-688.682) * (-689.237) [-687.497] (-687.532) (-687.083) -- 0:00:14
774500 -- (-687.283) (-688.354) [-691.768] (-686.635) * (-688.744) [-687.748] (-689.151) (-686.628) -- 0:00:13
775000 -- [-690.268] (-692.253) (-687.343) (-686.223) * [-690.799] (-686.279) (-688.603) (-686.793) -- 0:00:13
Average standard deviation of split frequencies: 0.006885
775500 -- (-690.697) (-688.128) [-689.112] (-688.129) * (-690.529) (-688.001) [-687.887] (-686.095) -- 0:00:13
776000 -- (-689.267) [-689.543] (-688.252) (-689.469) * [-686.051] (-687.214) (-690.130) (-689.180) -- 0:00:13
776500 -- (-689.192) (-687.247) (-687.228) [-691.751] * (-687.914) [-687.473] (-689.586) (-688.304) -- 0:00:13
777000 -- (-689.303) (-686.976) [-688.454] (-688.973) * (-690.924) [-691.241] (-687.497) (-688.180) -- 0:00:13
777500 -- (-689.939) (-689.848) (-687.467) [-688.135] * (-693.498) [-686.248] (-686.068) (-687.338) -- 0:00:13
778000 -- (-690.687) (-690.812) [-687.097] (-688.522) * [-689.302] (-687.814) (-687.179) (-688.131) -- 0:00:13
778500 -- (-687.235) (-689.404) [-687.693] (-690.564) * (-688.397) [-687.304] (-687.352) (-688.402) -- 0:00:13
779000 -- [-687.640] (-694.081) (-691.023) (-689.048) * (-686.813) [-688.378] (-688.047) (-686.575) -- 0:00:13
779500 -- (-686.585) (-687.562) (-687.430) [-686.634] * (-687.520) (-688.482) [-686.843] (-685.907) -- 0:00:13
780000 -- (-688.446) (-687.458) [-688.486] (-687.340) * [-687.818] (-687.084) (-686.564) (-688.902) -- 0:00:13
Average standard deviation of split frequencies: 0.006924
780500 -- (-686.838) [-687.866] (-688.265) (-686.963) * (-687.401) (-688.315) [-686.439] (-686.807) -- 0:00:13
781000 -- (-687.318) (-690.332) [-687.754] (-688.822) * (-686.745) [-691.640] (-687.027) (-686.567) -- 0:00:13
781500 -- (-687.193) (-688.666) (-686.827) [-687.214] * [-689.837] (-686.970) (-688.208) (-691.368) -- 0:00:13
782000 -- (-688.905) [-688.902] (-685.951) (-686.219) * (-686.523) (-686.723) [-691.708] (-688.818) -- 0:00:13
782500 -- [-690.741] (-686.977) (-689.082) (-691.768) * [-688.974] (-689.282) (-687.239) (-690.945) -- 0:00:13
783000 -- (-687.975) [-686.990] (-692.549) (-687.123) * (-689.168) [-687.698] (-688.512) (-689.293) -- 0:00:13
783500 -- (-687.604) [-688.200] (-689.470) (-686.331) * (-688.056) [-687.576] (-688.710) (-688.160) -- 0:00:13
784000 -- (-689.111) [-687.381] (-686.325) (-687.374) * [-687.218] (-688.197) (-687.032) (-689.940) -- 0:00:13
784500 -- (-688.222) [-687.011] (-689.300) (-689.844) * (-687.218) (-688.083) (-687.045) [-689.466] -- 0:00:13
785000 -- (-686.489) [-687.412] (-690.157) (-688.995) * (-689.919) (-689.434) [-688.592] (-687.629) -- 0:00:13
Average standard deviation of split frequencies: 0.006717
785500 -- (-686.939) [-687.407] (-689.201) (-688.831) * (-688.608) (-688.216) (-689.525) [-686.630] -- 0:00:13
786000 -- (-688.858) (-687.837) [-691.025] (-688.947) * (-690.991) (-688.552) (-689.262) [-688.324] -- 0:00:13
786500 -- [-687.070] (-686.636) (-689.018) (-686.652) * (-688.801) (-687.472) (-688.264) [-689.041] -- 0:00:13
787000 -- (-691.806) (-688.966) (-689.915) [-685.885] * (-686.489) (-688.924) [-687.174] (-689.131) -- 0:00:13
787500 -- (-691.611) (-689.163) [-686.553] (-687.325) * (-687.472) [-689.298] (-689.569) (-688.775) -- 0:00:13
788000 -- (-689.889) [-688.226] (-686.381) (-689.870) * [-686.469] (-687.144) (-687.551) (-687.149) -- 0:00:13
788500 -- (-686.111) (-689.559) [-688.946] (-687.588) * (-686.494) (-688.426) (-691.366) [-687.043] -- 0:00:13
789000 -- [-686.966] (-689.014) (-688.921) (-689.963) * (-687.943) [-690.895] (-689.069) (-686.636) -- 0:00:13
789500 -- [-687.236] (-686.837) (-691.251) (-689.592) * (-688.236) [-689.549] (-688.066) (-690.218) -- 0:00:13
790000 -- (-687.826) (-690.444) [-688.127] (-688.578) * (-689.448) [-693.491] (-688.052) (-687.657) -- 0:00:13
Average standard deviation of split frequencies: 0.006558
790500 -- (-687.483) (-690.203) (-691.798) [-686.438] * [-689.911] (-688.800) (-688.207) (-687.673) -- 0:00:12
791000 -- (-686.249) (-690.847) [-688.363] (-688.080) * (-689.009) (-687.987) [-687.160] (-688.224) -- 0:00:12
791500 -- [-687.443] (-690.834) (-687.865) (-687.909) * [-689.444] (-688.241) (-686.841) (-689.562) -- 0:00:12
792000 -- [-688.676] (-687.176) (-687.584) (-688.913) * (-690.765) (-688.282) [-687.573] (-688.666) -- 0:00:12
792500 -- (-689.310) (-686.604) (-687.409) [-689.544] * (-690.196) (-691.933) (-689.902) [-688.321] -- 0:00:12
793000 -- (-689.025) [-686.571] (-687.458) (-687.406) * [-691.452] (-687.909) (-689.122) (-692.290) -- 0:00:12
793500 -- [-687.634] (-687.114) (-690.609) (-687.104) * (-691.423) [-687.463] (-690.474) (-690.767) -- 0:00:12
794000 -- [-686.549] (-687.670) (-688.336) (-687.413) * (-687.967) [-686.632] (-688.315) (-689.808) -- 0:00:12
794500 -- (-686.371) (-687.884) (-687.006) [-690.769] * (-688.890) (-688.874) [-686.645] (-690.638) -- 0:00:12
795000 -- (-687.937) (-688.198) [-688.242] (-691.017) * (-691.230) (-690.742) [-686.894] (-694.522) -- 0:00:12
Average standard deviation of split frequencies: 0.006554
795500 -- (-687.764) (-687.130) (-688.764) [-690.316] * (-689.450) (-689.321) [-686.934] (-691.182) -- 0:00:12
796000 -- (-686.011) [-686.796] (-689.858) (-690.472) * (-688.537) (-687.536) [-689.106] (-692.188) -- 0:00:12
796500 -- [-686.382] (-687.582) (-687.332) (-688.550) * (-688.600) (-690.518) [-689.148] (-689.226) -- 0:00:12
797000 -- (-687.910) (-688.220) (-686.242) [-686.496] * (-690.731) (-689.913) [-688.842] (-687.902) -- 0:00:12
797500 -- (-688.521) (-686.450) (-688.130) [-686.496] * (-689.579) (-691.653) [-688.849] (-687.703) -- 0:00:12
798000 -- [-691.351] (-687.656) (-689.912) (-686.358) * (-691.186) (-690.374) (-689.540) [-690.420] -- 0:00:12
798500 -- (-690.097) (-687.413) (-686.368) [-687.303] * (-690.942) [-688.525] (-695.173) (-686.877) -- 0:00:12
799000 -- (-689.456) (-687.438) [-688.963] (-686.695) * [-688.215] (-689.465) (-689.488) (-688.549) -- 0:00:12
799500 -- (-692.980) (-688.441) [-687.344] (-687.001) * (-689.295) [-688.847] (-686.994) (-688.517) -- 0:00:12
800000 -- (-692.987) (-687.750) (-691.239) [-688.485] * (-686.428) [-687.917] (-687.231) (-690.438) -- 0:00:12
Average standard deviation of split frequencies: 0.006359
800500 -- (-687.670) (-686.906) [-690.113] (-687.290) * (-688.470) (-692.513) (-686.413) [-687.132] -- 0:00:12
801000 -- (-687.785) (-687.643) (-694.091) [-686.633] * [-689.813] (-688.819) (-688.029) (-688.927) -- 0:00:12
801500 -- (-690.577) [-687.110] (-691.234) (-686.679) * (-687.431) [-690.807] (-688.094) (-686.978) -- 0:00:12
802000 -- (-686.424) (-686.837) [-688.812] (-687.997) * (-687.311) (-688.918) [-686.175] (-687.139) -- 0:00:12
802500 -- [-686.749] (-689.490) (-689.453) (-688.220) * (-687.923) (-687.707) (-688.209) [-686.506] -- 0:00:12
803000 -- (-688.523) (-687.947) [-686.468] (-688.795) * (-689.197) (-687.605) (-690.670) [-686.323] -- 0:00:12
803500 -- [-686.755] (-688.600) (-686.709) (-687.270) * (-688.081) (-693.082) (-687.794) [-688.235] -- 0:00:12
804000 -- (-688.338) [-688.603] (-687.970) (-690.674) * (-687.827) [-690.912] (-688.838) (-688.778) -- 0:00:12
804500 -- (-687.124) (-691.480) [-687.825] (-688.222) * (-688.471) (-688.165) (-688.710) [-690.946] -- 0:00:12
805000 -- (-687.701) (-696.823) (-690.558) [-688.571] * (-687.882) [-692.732] (-690.449) (-687.051) -- 0:00:12
Average standard deviation of split frequencies: 0.006083
805500 -- (-687.224) (-687.765) [-689.290] (-691.980) * (-696.136) (-691.349) (-687.076) [-685.994] -- 0:00:12
806000 -- (-689.330) (-687.251) (-689.996) [-686.865] * (-693.660) [-691.156] (-690.072) (-688.316) -- 0:00:12
806500 -- (-687.691) (-688.233) (-687.494) [-687.835] * (-687.791) [-688.967] (-687.343) (-688.511) -- 0:00:11
807000 -- [-687.998] (-688.851) (-687.196) (-689.831) * [-687.784] (-688.162) (-686.668) (-689.372) -- 0:00:11
807500 -- (-691.043) [-688.061] (-686.982) (-692.843) * [-688.368] (-687.715) (-687.163) (-686.568) -- 0:00:11
808000 -- (-690.619) (-689.278) [-687.396] (-688.872) * (-687.717) [-687.189] (-688.247) (-693.090) -- 0:00:11
808500 -- (-687.724) (-687.246) (-688.296) [-686.787] * [-687.047] (-698.853) (-689.486) (-691.281) -- 0:00:11
809000 -- (-689.706) (-688.082) [-688.284] (-687.363) * [-688.358] (-690.754) (-690.998) (-688.787) -- 0:00:11
809500 -- (-687.512) [-689.422] (-694.419) (-687.704) * (-688.414) [-686.709] (-687.630) (-685.897) -- 0:00:11
810000 -- [-687.555] (-692.051) (-688.025) (-688.949) * (-688.386) (-686.359) [-688.713] (-688.406) -- 0:00:11
Average standard deviation of split frequencies: 0.005815
810500 -- (-689.229) [-686.910] (-690.554) (-691.418) * (-697.001) (-688.869) [-686.512] (-686.552) -- 0:00:11
811000 -- [-687.510] (-688.489) (-687.595) (-691.327) * (-690.104) [-686.794] (-687.054) (-687.048) -- 0:00:11
811500 -- (-687.627) (-687.948) [-688.282] (-689.347) * (-688.303) [-688.255] (-686.734) (-688.400) -- 0:00:11
812000 -- [-690.416] (-689.883) (-687.584) (-688.467) * (-690.097) (-689.328) [-693.600] (-686.587) -- 0:00:11
812500 -- [-690.683] (-690.153) (-690.085) (-687.691) * (-690.132) (-690.827) [-687.626] (-687.116) -- 0:00:11
813000 -- (-691.276) (-688.578) (-688.929) [-690.083] * [-686.903] (-688.170) (-690.743) (-689.389) -- 0:00:11
813500 -- (-688.551) (-689.283) (-686.939) [-692.356] * (-688.428) [-691.533] (-689.241) (-691.876) -- 0:00:11
814000 -- [-686.984] (-689.897) (-687.896) (-690.097) * [-687.340] (-686.160) (-688.294) (-687.524) -- 0:00:11
814500 -- [-688.083] (-698.554) (-690.263) (-689.412) * [-687.379] (-688.957) (-687.631) (-688.408) -- 0:00:11
815000 -- (-689.508) [-686.443] (-687.774) (-690.691) * [-687.293] (-689.968) (-686.888) (-688.260) -- 0:00:11
Average standard deviation of split frequencies: 0.006162
815500 -- [-689.005] (-689.031) (-691.470) (-687.292) * (-686.445) (-689.535) (-691.997) [-687.886] -- 0:00:11
816000 -- [-687.386] (-691.149) (-688.943) (-687.737) * (-689.256) [-686.287] (-688.485) (-693.202) -- 0:00:11
816500 -- (-689.146) (-692.805) [-687.593] (-687.306) * (-689.830) (-686.931) [-687.159] (-688.351) -- 0:00:11
817000 -- (-687.416) (-688.395) [-689.874] (-688.904) * (-686.984) (-692.183) (-690.322) [-691.410] -- 0:00:11
817500 -- (-687.350) [-687.767] (-694.619) (-688.650) * (-686.617) (-687.771) [-689.371] (-687.761) -- 0:00:11
818000 -- (-689.480) [-686.249] (-689.001) (-688.112) * (-687.610) [-686.851] (-689.758) (-687.937) -- 0:00:11
818500 -- (-686.505) [-689.478] (-689.696) (-689.755) * (-689.300) (-692.159) (-693.021) [-686.980] -- 0:00:11
819000 -- (-688.338) [-688.893] (-690.876) (-686.784) * (-687.786) (-688.383) (-689.168) [-689.687] -- 0:00:11
819500 -- [-686.981] (-691.454) (-689.204) (-686.431) * (-686.830) [-689.462] (-690.155) (-688.685) -- 0:00:11
820000 -- [-686.505] (-688.629) (-687.797) (-686.878) * (-690.933) (-693.110) [-688.747] (-686.958) -- 0:00:11
Average standard deviation of split frequencies: 0.006204
820500 -- (-688.231) (-687.097) [-688.358] (-689.336) * [-688.232] (-688.262) (-688.024) (-687.940) -- 0:00:11
821000 -- (-691.676) (-693.713) [-686.662] (-692.754) * (-689.605) [-691.296] (-691.916) (-686.687) -- 0:00:11
821500 -- (-690.328) (-689.609) (-687.775) [-687.735] * (-687.626) (-687.606) [-687.490] (-687.015) -- 0:00:11
822000 -- (-689.216) (-687.658) (-686.444) [-686.941] * (-686.384) (-688.873) [-689.535] (-688.436) -- 0:00:11
822500 -- (-687.432) (-687.626) [-688.273] (-687.168) * (-689.545) (-686.588) (-691.062) [-687.904] -- 0:00:11
823000 -- (-687.693) (-686.634) (-688.315) [-687.083] * (-687.600) (-688.345) (-688.837) [-687.819] -- 0:00:10
823500 -- (-693.374) (-687.638) (-688.402) [-686.541] * [-688.439] (-687.527) (-688.860) (-688.305) -- 0:00:10
824000 -- [-688.578] (-688.417) (-687.843) (-687.314) * (-687.542) (-689.803) [-687.328] (-689.348) -- 0:00:10
824500 -- [-688.067] (-688.550) (-687.465) (-690.023) * (-687.943) (-687.590) [-686.902] (-688.258) -- 0:00:10
825000 -- (-689.621) (-686.227) [-689.111] (-688.229) * (-688.162) [-688.121] (-686.974) (-688.990) -- 0:00:10
Average standard deviation of split frequencies: 0.006430
825500 -- (-694.411) [-687.196] (-690.036) (-689.990) * (-688.068) [-687.824] (-690.540) (-687.193) -- 0:00:10
826000 -- (-688.320) [-689.718] (-691.160) (-689.471) * [-689.880] (-686.649) (-690.467) (-687.214) -- 0:00:10
826500 -- [-688.863] (-689.630) (-691.594) (-687.468) * (-687.773) (-687.505) (-688.835) [-687.798] -- 0:00:10
827000 -- (-690.061) (-687.083) [-692.163] (-688.187) * (-688.598) (-687.504) [-690.798] (-688.862) -- 0:00:10
827500 -- (-689.454) (-696.374) (-688.024) [-687.569] * (-687.106) (-686.692) (-689.675) [-691.299] -- 0:00:10
828000 -- (-691.806) [-690.886] (-686.955) (-687.282) * (-687.218) (-692.000) (-694.503) [-688.482] -- 0:00:10
828500 -- (-690.841) (-689.688) (-686.988) [-687.763] * [-690.362] (-686.493) (-690.504) (-690.033) -- 0:00:10
829000 -- (-687.318) [-689.480] (-686.639) (-690.044) * (-690.580) [-686.605] (-687.735) (-689.952) -- 0:00:10
829500 -- (-689.655) (-689.318) (-688.142) [-688.443] * (-688.692) [-689.406] (-688.737) (-687.841) -- 0:00:10
830000 -- (-688.535) (-690.073) [-687.307] (-687.900) * (-691.069) (-691.715) [-687.041] (-692.218) -- 0:00:10
Average standard deviation of split frequencies: 0.006129
830500 -- (-686.952) [-688.209] (-687.348) (-686.318) * (-688.749) (-690.112) (-686.405) [-690.549] -- 0:00:10
831000 -- (-689.144) [-687.577] (-690.843) (-686.682) * (-692.945) (-687.695) [-686.358] (-688.599) -- 0:00:10
831500 -- [-688.737] (-686.450) (-691.560) (-686.262) * (-694.284) (-693.046) (-687.247) [-686.668] -- 0:00:10
832000 -- (-688.683) (-688.069) (-693.906) [-686.964] * (-690.132) (-690.380) [-686.846] (-687.448) -- 0:00:10
832500 -- (-687.671) [-692.063] (-689.975) (-692.593) * [-687.023] (-692.592) (-686.769) (-688.191) -- 0:00:10
833000 -- (-690.968) (-688.546) (-688.915) [-690.034] * (-692.622) (-691.936) (-689.059) [-687.014] -- 0:00:10
833500 -- [-688.420] (-687.947) (-687.988) (-692.201) * (-690.353) (-690.003) (-688.149) [-688.307] -- 0:00:10
834000 -- (-687.127) (-690.888) [-688.239] (-693.490) * (-687.828) (-687.996) (-687.382) [-687.506] -- 0:00:10
834500 -- (-690.424) (-690.055) [-686.573] (-689.050) * (-689.552) (-686.621) (-686.726) [-687.730] -- 0:00:10
835000 -- [-689.248] (-686.930) (-691.222) (-688.221) * (-690.191) (-688.841) (-686.986) [-688.253] -- 0:00:10
Average standard deviation of split frequencies: 0.006428
835500 -- (-691.241) [-689.160] (-689.545) (-687.043) * (-687.505) [-686.688] (-686.678) (-689.586) -- 0:00:10
836000 -- (-688.250) (-687.265) (-687.590) [-688.245] * [-689.606] (-686.402) (-687.919) (-686.347) -- 0:00:10
836500 -- [-687.178] (-686.214) (-690.041) (-687.488) * (-688.685) [-686.398] (-688.915) (-686.340) -- 0:00:10
837000 -- (-690.241) (-686.836) (-689.057) [-688.210] * [-687.942] (-690.470) (-688.470) (-688.985) -- 0:00:10
837500 -- (-687.749) (-688.961) (-690.061) [-688.291] * (-688.705) (-688.350) [-691.632] (-686.616) -- 0:00:10
838000 -- (-686.796) (-691.590) (-689.072) [-686.983] * (-689.114) (-686.894) (-688.112) [-687.230] -- 0:00:10
838500 -- (-689.752) [-691.993] (-690.524) (-687.589) * (-687.202) [-688.003] (-688.093) (-687.473) -- 0:00:10
839000 -- (-687.307) (-687.850) (-687.009) [-687.901] * (-688.572) (-687.557) [-689.868] (-688.381) -- 0:00:09
839500 -- [-688.842] (-687.885) (-687.431) (-688.990) * [-687.464] (-687.592) (-690.218) (-688.127) -- 0:00:09
840000 -- (-687.964) (-686.703) [-687.529] (-693.922) * (-691.345) [-686.736] (-688.316) (-689.996) -- 0:00:09
Average standard deviation of split frequencies: 0.006729
840500 -- (-689.337) (-686.545) [-688.030] (-689.608) * (-688.683) (-687.165) [-686.896] (-688.031) -- 0:00:09
841000 -- (-687.632) (-688.426) (-687.917) [-687.987] * (-686.680) (-686.863) (-687.151) [-688.266] -- 0:00:09
841500 -- (-688.379) (-687.905) (-687.751) [-687.942] * (-687.393) [-687.152] (-690.049) (-689.775) -- 0:00:09
842000 -- (-690.617) (-686.943) [-686.042] (-690.794) * (-687.221) (-691.269) (-688.186) [-687.251] -- 0:00:09
842500 -- (-688.819) (-687.292) [-685.981] (-687.790) * (-686.879) (-689.668) (-689.197) [-689.560] -- 0:00:09
843000 -- [-689.032] (-689.508) (-686.255) (-688.903) * (-688.053) (-691.692) [-686.953] (-688.221) -- 0:00:09
843500 -- (-690.846) (-687.204) (-690.744) [-695.234] * (-689.215) (-692.341) [-686.586] (-687.422) -- 0:00:09
844000 -- [-689.346] (-688.401) (-688.193) (-690.385) * (-689.813) (-691.277) [-688.644] (-688.247) -- 0:00:09
844500 -- (-689.745) (-688.666) (-688.255) [-687.607] * (-687.845) (-687.651) [-687.294] (-687.224) -- 0:00:09
845000 -- (-688.816) (-692.525) (-688.997) [-689.261] * (-687.874) (-686.905) [-686.619] (-691.288) -- 0:00:09
Average standard deviation of split frequencies: 0.007170
845500 -- (-687.899) (-689.064) (-689.322) [-687.979] * [-690.504] (-687.101) (-686.977) (-687.222) -- 0:00:09
846000 -- (-687.719) [-687.318] (-686.095) (-686.504) * (-686.873) [-686.911] (-686.729) (-689.506) -- 0:00:09
846500 -- (-686.823) (-687.967) (-688.282) [-687.504] * (-686.558) (-689.086) [-689.005] (-689.450) -- 0:00:09
847000 -- (-689.291) [-688.572] (-690.536) (-691.248) * (-690.670) (-687.200) [-687.966] (-692.726) -- 0:00:09
847500 -- (-690.909) (-686.928) (-686.233) [-689.031] * (-688.508) (-686.786) (-688.555) [-688.571] -- 0:00:09
848000 -- (-694.903) (-689.023) [-686.976] (-691.949) * (-687.888) (-686.352) (-689.998) [-688.543] -- 0:00:09
848500 -- [-691.356] (-690.111) (-688.320) (-687.375) * (-689.164) (-687.860) (-689.447) [-686.724] -- 0:00:09
849000 -- (-691.548) (-686.568) (-691.903) [-686.638] * [-686.857] (-691.069) (-688.840) (-688.543) -- 0:00:09
849500 -- (-689.437) (-688.989) (-689.508) [-687.512] * (-690.587) (-687.283) (-694.506) [-690.191] -- 0:00:09
850000 -- (-689.578) (-687.406) [-690.713] (-688.423) * [-688.075] (-686.897) (-692.093) (-694.730) -- 0:00:09
Average standard deviation of split frequencies: 0.007684
850500 -- (-690.011) [-689.462] (-692.435) (-689.507) * [-687.272] (-687.220) (-689.058) (-690.658) -- 0:00:09
851000 -- (-689.759) (-687.037) [-687.165] (-686.860) * (-686.804) [-687.590] (-687.008) (-686.560) -- 0:00:09
851500 -- (-693.874) [-687.806] (-689.909) (-688.205) * (-689.058) [-687.800] (-687.887) (-694.999) -- 0:00:09
852000 -- [-687.181] (-692.208) (-689.067) (-688.785) * (-686.520) (-688.578) (-687.917) [-689.840] -- 0:00:09
852500 -- [-687.507] (-687.259) (-691.636) (-686.822) * (-686.502) [-691.682] (-687.832) (-687.433) -- 0:00:09
853000 -- (-687.869) (-688.521) (-692.099) [-689.386] * (-687.533) (-689.736) (-687.963) [-687.922] -- 0:00:09
853500 -- [-686.347] (-686.793) (-688.288) (-692.502) * (-686.334) [-689.771] (-687.631) (-687.380) -- 0:00:09
854000 -- (-686.655) (-686.628) (-688.054) [-689.890] * (-686.238) (-688.264) [-686.837] (-686.980) -- 0:00:09
854500 -- (-687.797) (-685.976) [-686.451] (-686.649) * (-689.531) (-687.224) [-685.985] (-687.444) -- 0:00:09
855000 -- (-688.788) (-689.794) [-686.455] (-696.003) * (-689.441) (-686.288) (-689.246) [-686.209] -- 0:00:08
Average standard deviation of split frequencies: 0.007967
855500 -- (-688.920) (-688.342) [-687.208] (-690.694) * (-688.143) (-687.778) (-688.818) [-686.767] -- 0:00:08
856000 -- (-692.885) [-689.972] (-686.957) (-688.152) * [-687.910] (-687.728) (-694.214) (-688.129) -- 0:00:08
856500 -- (-691.949) (-686.367) [-687.301] (-690.548) * (-693.067) (-686.586) (-688.700) [-688.908] -- 0:00:08
857000 -- (-690.815) (-686.629) [-688.247] (-688.413) * (-690.503) [-688.686] (-689.665) (-690.568) -- 0:00:08
857500 -- (-689.524) (-687.859) (-690.220) [-688.301] * (-690.493) [-687.263] (-690.598) (-689.736) -- 0:00:08
858000 -- (-687.286) [-687.674] (-688.161) (-687.579) * (-688.737) (-686.263) (-691.935) [-688.752] -- 0:00:08
858500 -- (-688.044) (-686.693) [-687.013] (-689.586) * [-687.175] (-687.232) (-691.917) (-688.580) -- 0:00:08
859000 -- (-687.809) [-688.196] (-688.673) (-687.129) * (-688.427) (-687.337) (-688.405) [-692.564] -- 0:00:08
859500 -- (-690.826) (-687.992) (-687.938) [-685.979] * [-686.798] (-686.998) (-690.387) (-687.753) -- 0:00:08
860000 -- (-686.567) (-689.249) (-686.450) [-687.484] * (-688.053) [-689.614] (-694.590) (-688.414) -- 0:00:08
Average standard deviation of split frequencies: 0.007924
860500 -- (-688.656) (-687.715) (-690.363) [-686.997] * (-688.604) (-691.744) (-687.333) [-686.654] -- 0:00:08
861000 -- (-687.877) [-689.277] (-690.762) (-688.773) * [-687.011] (-690.380) (-686.703) (-686.041) -- 0:00:08
861500 -- (-687.037) [-686.917] (-688.964) (-688.193) * (-687.814) (-689.241) [-691.082] (-686.051) -- 0:00:08
862000 -- (-688.625) (-686.574) (-692.152) [-692.801] * (-687.492) (-696.485) (-688.834) [-688.214] -- 0:00:08
862500 -- (-687.411) (-688.999) [-689.322] (-688.308) * (-689.161) (-689.279) (-687.709) [-689.568] -- 0:00:08
863000 -- (-694.644) (-694.589) (-691.682) [-687.773] * (-688.724) (-691.587) (-687.659) [-689.115] -- 0:00:08
863500 -- (-691.848) (-691.346) [-690.054] (-686.905) * [-690.161] (-694.447) (-687.980) (-687.870) -- 0:00:08
864000 -- [-687.856] (-691.184) (-694.254) (-692.933) * (-687.148) (-689.672) (-689.326) [-687.431] -- 0:00:08
864500 -- [-687.916] (-690.935) (-690.141) (-690.035) * [-686.237] (-687.936) (-686.506) (-686.782) -- 0:00:08
865000 -- (-687.915) (-688.883) [-688.639] (-687.342) * (-688.285) (-689.230) (-688.270) [-687.109] -- 0:00:08
Average standard deviation of split frequencies: 0.008129
865500 -- (-686.853) (-691.345) (-692.700) [-687.800] * (-691.160) [-687.979] (-692.777) (-688.050) -- 0:00:08
866000 -- (-687.735) [-689.289] (-687.146) (-687.709) * (-690.871) (-687.293) [-686.467] (-688.177) -- 0:00:08
866500 -- (-688.337) (-688.450) (-686.819) [-690.326] * (-687.519) (-687.657) [-688.397] (-687.070) -- 0:00:08
867000 -- [-686.964] (-690.111) (-686.556) (-694.330) * (-690.414) (-689.535) (-686.856) [-688.102] -- 0:00:08
867500 -- [-686.555] (-694.073) (-686.568) (-691.483) * (-687.555) (-686.635) (-687.737) [-687.464] -- 0:00:08
868000 -- (-686.075) (-687.190) (-687.377) [-688.578] * (-688.273) (-687.804) [-689.281] (-687.569) -- 0:00:08
868500 -- (-691.969) (-688.659) (-688.011) [-689.503] * [-688.204] (-687.366) (-687.999) (-687.535) -- 0:00:08
869000 -- [-687.561] (-687.855) (-689.342) (-692.296) * (-687.093) (-692.758) [-687.451] (-689.765) -- 0:00:08
869500 -- (-686.623) [-687.272] (-686.429) (-689.118) * [-687.345] (-689.033) (-689.650) (-689.775) -- 0:00:08
870000 -- (-686.656) (-687.314) (-686.706) [-687.793] * (-686.918) (-686.704) [-687.841] (-689.973) -- 0:00:08
Average standard deviation of split frequencies: 0.007977
870500 -- (-687.222) (-687.039) (-688.327) [-687.641] * (-688.945) [-686.222] (-687.539) (-690.199) -- 0:00:08
871000 -- (-690.832) (-687.359) (-689.057) [-687.146] * [-688.533] (-687.491) (-688.514) (-688.717) -- 0:00:07
871500 -- (-690.682) (-687.208) (-690.101) [-688.412] * (-687.683) [-687.094] (-691.975) (-690.423) -- 0:00:07
872000 -- [-686.931] (-687.584) (-690.014) (-688.809) * (-687.980) [-688.861] (-691.740) (-689.164) -- 0:00:07
872500 -- (-686.943) (-687.584) (-688.012) [-687.013] * (-688.717) (-688.654) [-686.813] (-692.923) -- 0:00:07
873000 -- (-686.758) [-686.534] (-689.680) (-687.515) * (-689.911) (-687.682) [-688.443] (-687.245) -- 0:00:07
873500 -- (-687.548) (-687.794) [-686.996] (-687.938) * (-691.814) (-688.235) [-690.671] (-686.912) -- 0:00:07
874000 -- (-689.201) (-688.331) (-687.845) [-687.755] * (-689.832) (-692.373) (-689.688) [-687.128] -- 0:00:07
874500 -- [-689.395] (-687.993) (-687.280) (-687.336) * [-687.724] (-688.821) (-691.195) (-688.058) -- 0:00:07
875000 -- (-692.403) [-686.560] (-686.753) (-688.022) * (-686.193) (-688.211) [-686.845] (-688.088) -- 0:00:07
Average standard deviation of split frequencies: 0.007893
875500 -- [-686.370] (-686.722) (-687.253) (-688.544) * (-686.213) (-687.875) (-689.462) [-691.340] -- 0:00:07
876000 -- (-686.353) (-686.712) [-688.067] (-688.851) * (-687.166) (-686.779) [-688.299] (-690.993) -- 0:00:07
876500 -- (-686.467) (-688.855) (-686.930) [-688.187] * (-688.595) [-687.828] (-689.117) (-689.612) -- 0:00:07
877000 -- (-688.880) [-689.058] (-687.418) (-686.003) * (-687.301) (-687.881) (-688.004) [-689.349] -- 0:00:07
877500 -- (-690.397) [-687.732] (-689.305) (-686.368) * (-688.660) (-690.553) [-687.444] (-688.443) -- 0:00:07
878000 -- [-687.467] (-694.328) (-691.399) (-687.839) * (-688.067) (-687.106) (-690.187) [-688.644] -- 0:00:07
878500 -- (-688.992) [-688.342] (-688.521) (-691.121) * (-688.392) [-688.570] (-687.325) (-688.657) -- 0:00:07
879000 -- (-688.072) [-689.401] (-694.812) (-688.033) * (-688.643) (-690.379) (-688.939) [-686.994] -- 0:00:07
879500 -- [-686.544] (-691.542) (-686.736) (-687.607) * (-690.495) [-696.963] (-688.743) (-688.117) -- 0:00:07
880000 -- (-686.534) (-691.146) (-686.903) [-687.058] * (-687.730) [-688.770] (-688.818) (-687.412) -- 0:00:07
Average standard deviation of split frequencies: 0.007744
880500 -- (-686.002) (-688.168) (-688.895) [-686.902] * (-688.603) (-686.809) (-687.199) [-686.770] -- 0:00:07
881000 -- [-687.908] (-688.041) (-686.687) (-687.356) * (-687.658) (-687.613) (-691.111) [-686.963] -- 0:00:07
881500 -- (-687.070) [-690.088] (-687.758) (-687.054) * (-686.401) (-687.421) (-689.853) [-687.493] -- 0:00:07
882000 -- (-686.688) (-687.123) [-687.395] (-686.352) * (-690.255) (-687.585) (-688.555) [-687.945] -- 0:00:07
882500 -- (-686.948) (-687.576) [-687.854] (-687.669) * [-686.451] (-688.534) (-686.307) (-687.695) -- 0:00:07
883000 -- (-686.948) (-687.858) (-688.366) [-690.322] * (-686.291) (-692.250) (-689.281) [-689.370] -- 0:00:07
883500 -- (-687.976) (-687.930) [-687.361] (-686.286) * (-687.351) (-687.061) [-689.762] (-689.478) -- 0:00:07
884000 -- (-687.079) (-688.602) (-688.758) [-687.886] * [-688.055] (-690.734) (-690.988) (-688.968) -- 0:00:07
884500 -- (-687.572) [-688.231] (-686.486) (-687.700) * (-687.080) [-690.515] (-688.504) (-688.621) -- 0:00:07
885000 -- [-688.235] (-693.864) (-687.377) (-687.035) * (-687.349) [-688.278] (-687.022) (-687.396) -- 0:00:07
Average standard deviation of split frequencies: 0.007733
885500 -- (-687.610) (-693.413) (-687.581) [-687.125] * (-688.124) (-689.834) (-687.338) [-690.962] -- 0:00:07
886000 -- (-687.781) (-687.748) [-686.411] (-689.190) * (-686.036) (-686.572) [-686.438] (-686.551) -- 0:00:07
886500 -- [-687.524] (-686.461) (-688.675) (-691.558) * [-689.693] (-686.728) (-688.283) (-688.800) -- 0:00:07
887000 -- (-699.160) [-686.495] (-688.619) (-692.513) * (-686.394) [-687.568] (-686.411) (-687.259) -- 0:00:07
887500 -- (-689.318) [-687.351] (-687.995) (-688.108) * (-686.410) (-688.066) (-687.517) [-688.216] -- 0:00:06
888000 -- (-687.847) [-690.817] (-686.918) (-690.586) * [-686.435] (-689.214) (-689.297) (-690.068) -- 0:00:06
888500 -- (-686.887) (-689.297) (-686.840) [-688.010] * (-687.488) (-689.470) [-690.117] (-687.277) -- 0:00:06
889000 -- (-690.638) [-686.847] (-688.180) (-686.743) * (-688.750) (-690.432) (-690.492) [-688.656] -- 0:00:06
889500 -- [-687.787] (-690.929) (-689.141) (-692.655) * (-688.255) [-688.017] (-692.457) (-689.650) -- 0:00:06
890000 -- (-692.824) [-689.700] (-686.878) (-689.510) * (-688.322) (-687.271) [-687.993] (-689.022) -- 0:00:06
Average standard deviation of split frequencies: 0.007869
890500 -- (-688.568) (-688.063) [-687.819] (-689.084) * (-686.714) (-686.394) (-689.000) [-689.432] -- 0:00:06
891000 -- [-685.970] (-689.721) (-688.038) (-688.993) * [-687.107] (-687.044) (-687.568) (-689.065) -- 0:00:06
891500 -- (-686.728) (-687.564) [-688.339] (-688.873) * [-688.989] (-687.838) (-689.275) (-686.790) -- 0:00:06
892000 -- (-686.259) (-686.550) [-687.435] (-691.699) * [-687.572] (-689.187) (-689.604) (-688.176) -- 0:00:06
892500 -- (-695.443) (-686.407) (-688.526) [-688.028] * [-687.210] (-687.572) (-693.916) (-688.859) -- 0:00:06
893000 -- (-689.513) (-687.725) (-687.717) [-687.907] * [-689.063] (-686.516) (-689.391) (-687.130) -- 0:00:06
893500 -- (-687.520) [-687.254] (-689.255) (-687.953) * (-689.266) (-686.289) [-687.943] (-688.618) -- 0:00:06
894000 -- (-687.356) (-688.549) (-688.725) [-689.272] * (-688.766) [-686.845] (-690.278) (-688.141) -- 0:00:06
894500 -- [-687.360] (-688.267) (-687.352) (-687.792) * (-689.489) (-688.057) [-688.053] (-688.402) -- 0:00:06
895000 -- (-690.664) (-688.294) [-686.426] (-688.603) * (-690.062) (-689.721) (-688.308) [-689.678] -- 0:00:06
Average standard deviation of split frequencies: 0.008137
895500 -- [-689.612] (-690.055) (-686.699) (-689.806) * (-689.997) [-689.135] (-686.674) (-687.591) -- 0:00:06
896000 -- [-689.392] (-689.112) (-694.730) (-688.196) * (-686.770) (-689.972) [-689.978] (-693.239) -- 0:00:06
896500 -- [-689.337] (-692.899) (-688.699) (-686.650) * [-687.670] (-689.442) (-686.847) (-687.103) -- 0:00:06
897000 -- [-686.534] (-687.566) (-689.660) (-688.824) * (-687.096) [-687.514] (-685.963) (-688.281) -- 0:00:06
897500 -- [-686.603] (-687.503) (-695.289) (-693.591) * (-690.888) (-688.333) (-687.283) [-687.115] -- 0:00:06
898000 -- (-687.451) [-689.263] (-690.559) (-689.663) * (-689.330) (-690.225) (-688.818) [-689.757] -- 0:00:06
898500 -- (-687.380) [-688.547] (-691.802) (-687.256) * (-691.223) (-688.063) [-687.168] (-694.459) -- 0:00:06
899000 -- (-688.097) (-690.730) (-687.718) [-688.917] * (-689.199) [-690.592] (-689.659) (-688.781) -- 0:00:06
899500 -- (-690.027) [-687.612] (-690.005) (-687.963) * [-689.011] (-689.880) (-687.072) (-688.352) -- 0:00:06
900000 -- (-690.722) [-690.912] (-686.999) (-693.943) * [-687.236] (-687.726) (-689.620) (-689.258) -- 0:00:06
Average standard deviation of split frequencies: 0.008130
900500 -- (-690.775) (-688.350) [-687.209] (-690.030) * (-690.478) (-688.124) (-688.805) [-687.840] -- 0:00:06
901000 -- (-687.687) [-688.016] (-686.528) (-687.781) * [-687.090] (-692.466) (-688.341) (-687.672) -- 0:00:06
901500 -- [-686.943] (-686.900) (-691.662) (-688.605) * (-688.087) (-687.864) (-686.979) [-688.710] -- 0:00:06
902000 -- (-691.259) (-687.273) (-689.953) [-688.404] * (-690.035) (-686.186) (-689.408) [-686.379] -- 0:00:06
902500 -- (-689.784) (-687.845) (-687.075) [-687.608] * (-689.075) [-690.478] (-690.724) (-687.603) -- 0:00:06
903000 -- (-689.396) (-686.904) [-688.331] (-687.445) * (-689.493) (-689.112) [-692.042] (-691.118) -- 0:00:06
903500 -- (-689.098) (-687.669) (-690.629) [-689.324] * (-690.926) [-686.693] (-690.447) (-689.247) -- 0:00:05
904000 -- [-688.177] (-687.585) (-689.610) (-689.576) * (-690.562) (-689.970) [-687.379] (-687.596) -- 0:00:05
904500 -- (-687.350) (-688.747) (-690.768) [-690.053] * (-691.709) (-686.939) [-690.332] (-687.953) -- 0:00:05
905000 -- [-686.583] (-687.887) (-690.039) (-691.892) * (-685.907) (-688.501) [-688.362] (-688.881) -- 0:00:05
Average standard deviation of split frequencies: 0.007805
905500 -- [-688.788] (-688.033) (-687.654) (-688.116) * (-687.373) (-687.554) [-688.243] (-687.421) -- 0:00:05
906000 -- (-691.210) (-688.211) (-687.541) [-690.891] * (-688.200) (-689.599) (-688.726) [-686.949] -- 0:00:05
906500 -- (-688.105) [-688.678] (-689.167) (-688.584) * (-687.982) (-688.579) [-687.274] (-687.877) -- 0:00:05
907000 -- (-689.301) (-686.398) [-690.028] (-690.186) * (-691.056) (-688.114) [-687.122] (-691.667) -- 0:00:05
907500 -- (-688.034) (-688.073) [-687.571] (-687.997) * [-688.090] (-689.297) (-686.624) (-689.209) -- 0:00:05
908000 -- [-687.059] (-688.953) (-690.653) (-686.330) * [-688.112] (-687.400) (-693.128) (-687.704) -- 0:00:05
908500 -- (-687.121) (-687.114) (-691.724) [-687.146] * (-687.346) (-688.756) [-690.383] (-687.598) -- 0:00:05
909000 -- (-690.504) (-688.147) (-694.118) [-688.896] * (-689.062) [-690.403] (-688.239) (-686.529) -- 0:00:05
909500 -- (-689.943) (-692.396) [-692.470] (-689.670) * (-689.955) [-687.047] (-686.945) (-688.061) -- 0:00:05
910000 -- [-689.182] (-689.954) (-694.849) (-691.431) * (-690.161) [-686.929] (-690.884) (-688.324) -- 0:00:05
Average standard deviation of split frequencies: 0.008041
910500 -- [-690.361] (-690.397) (-691.577) (-689.468) * [-693.881] (-687.574) (-687.384) (-687.805) -- 0:00:05
911000 -- (-690.891) [-688.219] (-691.947) (-687.202) * (-693.262) [-688.676] (-687.483) (-687.360) -- 0:00:05
911500 -- (-689.748) (-695.252) (-688.879) [-688.203] * (-689.287) (-688.584) [-686.217] (-686.721) -- 0:00:05
912000 -- (-687.114) (-691.143) [-686.901] (-687.342) * (-687.981) (-688.266) (-686.416) [-689.098] -- 0:00:05
912500 -- [-686.569] (-689.484) (-690.098) (-687.866) * (-689.047) [-686.625] (-688.342) (-686.950) -- 0:00:05
913000 -- (-688.075) (-690.175) (-688.120) [-686.638] * (-686.134) [-688.801] (-687.716) (-687.483) -- 0:00:05
913500 -- (-688.558) (-688.394) (-689.522) [-687.484] * (-686.139) (-686.304) [-686.675] (-688.549) -- 0:00:05
914000 -- [-687.938] (-690.755) (-686.699) (-687.645) * (-685.860) (-688.855) (-691.559) [-692.088] -- 0:00:05
914500 -- (-688.446) (-686.488) (-691.416) [-691.480] * (-686.949) [-687.942] (-688.625) (-686.324) -- 0:00:05
915000 -- (-690.387) (-688.579) (-687.194) [-688.368] * (-687.469) (-688.532) [-687.390] (-688.744) -- 0:00:05
Average standard deviation of split frequencies: 0.008166
915500 -- (-686.549) [-686.850] (-687.041) (-686.011) * [-691.137] (-689.591) (-692.640) (-687.206) -- 0:00:05
916000 -- (-688.685) (-689.362) [-688.913] (-691.350) * (-691.505) (-688.725) (-688.749) [-688.657] -- 0:00:05
916500 -- (-688.752) (-687.396) (-689.671) [-691.498] * (-687.768) (-687.615) [-689.450] (-686.767) -- 0:00:05
917000 -- [-690.177] (-687.320) (-688.836) (-687.581) * [-687.530] (-687.078) (-687.627) (-687.485) -- 0:00:05
917500 -- (-686.777) [-686.783] (-691.745) (-687.635) * [-688.766] (-689.013) (-686.946) (-687.683) -- 0:00:05
918000 -- (-686.839) (-686.581) [-688.556] (-686.410) * (-689.597) (-692.589) [-692.399] (-687.775) -- 0:00:05
918500 -- (-689.037) [-688.421] (-689.033) (-687.864) * (-688.868) (-687.957) (-691.383) [-688.239] -- 0:00:05
919000 -- (-692.797) (-690.326) [-686.713] (-691.187) * (-688.203) (-687.910) [-688.051] (-689.167) -- 0:00:05
919500 -- (-691.773) (-687.835) (-690.844) [-689.801] * (-686.787) (-687.947) (-689.219) [-687.004] -- 0:00:04
920000 -- (-688.240) (-687.185) (-687.300) [-687.391] * [-686.471] (-689.507) (-689.503) (-688.342) -- 0:00:04
Average standard deviation of split frequencies: 0.008090
920500 -- (-686.360) (-687.837) (-687.408) [-686.489] * (-687.504) [-687.702] (-686.896) (-690.157) -- 0:00:04
921000 -- (-686.759) (-689.287) [-687.000] (-686.576) * (-689.640) (-689.071) (-686.032) [-688.731] -- 0:00:04
921500 -- (-694.634) (-688.003) (-688.942) [-689.432] * (-686.749) [-687.135] (-687.985) (-694.821) -- 0:00:04
922000 -- (-689.713) (-690.781) [-689.416] (-687.401) * (-687.061) (-687.462) [-687.696] (-692.972) -- 0:00:04
922500 -- [-688.706] (-689.920) (-689.609) (-687.273) * (-687.653) (-686.876) [-686.468] (-693.079) -- 0:00:04
923000 -- (-689.358) [-693.198] (-688.484) (-687.423) * (-687.992) (-687.254) (-689.213) [-688.081] -- 0:00:04
923500 -- (-689.052) (-690.414) [-688.194] (-690.435) * (-686.798) (-691.032) (-688.397) [-687.414] -- 0:00:04
924000 -- (-691.997) (-688.092) (-690.245) [-687.738] * (-690.948) (-689.477) [-686.438] (-688.864) -- 0:00:04
924500 -- (-690.743) [-687.153] (-688.684) (-687.988) * [-689.199] (-688.594) (-689.988) (-690.890) -- 0:00:04
925000 -- [-687.150] (-689.612) (-686.895) (-687.486) * (-687.453) (-686.778) [-686.840] (-687.202) -- 0:00:04
Average standard deviation of split frequencies: 0.008111
925500 -- (-690.319) (-691.249) [-687.000] (-687.992) * (-688.245) (-686.241) [-687.809] (-686.656) -- 0:00:04
926000 -- [-689.416] (-690.450) (-688.537) (-688.734) * (-686.806) [-687.931] (-688.863) (-691.382) -- 0:00:04
926500 -- (-691.085) (-687.452) (-686.055) [-688.417] * (-689.939) (-688.696) (-687.095) [-688.185] -- 0:00:04
927000 -- (-688.378) (-687.587) [-686.478] (-689.702) * (-689.438) (-687.974) [-686.989] (-690.186) -- 0:00:04
927500 -- (-689.131) (-688.704) (-687.197) [-686.985] * (-687.832) (-688.068) (-689.412) [-689.631] -- 0:00:04
928000 -- (-690.070) [-689.066] (-688.582) (-687.720) * (-689.313) [-687.006] (-689.901) (-687.641) -- 0:00:04
928500 -- (-687.534) (-687.449) (-686.388) [-688.207] * (-687.613) [-689.488] (-687.008) (-688.395) -- 0:00:04
929000 -- (-687.591) (-687.920) [-686.772] (-687.125) * (-688.666) [-687.475] (-686.975) (-689.100) -- 0:00:04
929500 -- (-686.787) [-687.520] (-686.960) (-687.635) * [-686.806] (-687.001) (-687.294) (-689.829) -- 0:00:04
930000 -- (-686.869) (-687.247) [-686.671] (-689.475) * (-687.572) [-690.041] (-686.530) (-690.940) -- 0:00:04
Average standard deviation of split frequencies: 0.008037
930500 -- [-688.399] (-689.829) (-687.066) (-687.306) * (-689.368) (-693.246) [-686.856] (-691.151) -- 0:00:04
931000 -- (-688.017) (-687.258) [-687.156] (-687.417) * (-690.832) (-688.803) (-687.129) [-689.019] -- 0:00:04
931500 -- [-688.648] (-687.106) (-688.701) (-687.767) * [-687.425] (-689.289) (-687.878) (-688.339) -- 0:00:04
932000 -- (-691.667) (-688.290) [-687.874] (-689.165) * (-688.127) [-690.650] (-691.081) (-687.060) -- 0:00:04
932500 -- (-692.097) [-688.661] (-688.013) (-689.376) * (-690.945) [-689.170] (-689.383) (-687.108) -- 0:00:04
933000 -- [-688.189] (-691.283) (-688.835) (-686.657) * (-687.731) (-691.661) (-688.250) [-687.974] -- 0:00:04
933500 -- [-687.413] (-687.126) (-690.633) (-686.460) * (-688.084) (-688.429) (-690.329) [-688.904] -- 0:00:04
934000 -- (-688.889) [-687.708] (-691.878) (-686.594) * (-690.665) [-686.776] (-687.949) (-688.958) -- 0:00:04
934500 -- [-688.085] (-689.097) (-687.652) (-686.746) * (-687.662) [-688.750] (-687.468) (-687.524) -- 0:00:04
935000 -- (-686.917) (-687.617) [-689.047] (-687.631) * (-686.424) (-688.980) (-686.950) [-687.617] -- 0:00:04
Average standard deviation of split frequencies: 0.008193
935500 -- (-687.119) [-689.380] (-691.001) (-687.834) * (-687.388) [-689.307] (-686.796) (-687.390) -- 0:00:03
936000 -- [-688.384] (-688.480) (-691.654) (-686.787) * (-686.442) [-687.947] (-686.930) (-691.256) -- 0:00:03
936500 -- [-687.546] (-688.507) (-689.337) (-687.763) * (-688.820) [-690.777] (-686.954) (-688.612) -- 0:00:03
937000 -- [-687.065] (-687.859) (-692.168) (-687.011) * (-689.370) [-687.208] (-690.731) (-687.151) -- 0:00:03
937500 -- [-688.099] (-693.731) (-689.739) (-686.180) * (-691.110) (-691.180) (-689.448) [-690.921] -- 0:00:03
938000 -- (-688.053) (-691.306) [-687.242] (-687.984) * [-686.882] (-688.377) (-688.113) (-687.844) -- 0:00:03
938500 -- (-688.059) (-691.337) [-687.861] (-688.297) * (-688.616) [-686.865] (-688.240) (-688.227) -- 0:00:03
939000 -- (-686.420) (-687.596) [-687.978] (-691.394) * [-687.046] (-689.490) (-688.359) (-692.544) -- 0:00:03
939500 -- (-686.913) (-688.007) (-689.109) [-689.141] * (-688.483) (-690.128) (-689.734) [-687.116] -- 0:00:03
940000 -- [-687.320] (-687.465) (-686.500) (-688.516) * [-686.818] (-687.256) (-689.999) (-687.575) -- 0:00:03
Average standard deviation of split frequencies: 0.008252
940500 -- (-687.359) [-686.990] (-686.533) (-686.138) * (-688.414) (-687.182) (-690.101) [-686.553] -- 0:00:03
941000 -- (-689.463) [-688.777] (-686.583) (-686.403) * (-688.238) (-689.289) (-687.698) [-686.485] -- 0:00:03
941500 -- (-688.630) (-689.461) [-687.172] (-686.739) * (-687.372) (-688.264) (-692.566) [-686.520] -- 0:00:03
942000 -- (-687.277) (-686.023) (-686.977) [-687.896] * (-686.061) [-687.706] (-687.768) (-686.338) -- 0:00:03
942500 -- (-689.040) (-686.920) [-690.277] (-687.630) * (-685.975) (-687.649) (-687.329) [-686.773] -- 0:00:03
943000 -- [-687.655] (-687.286) (-687.424) (-695.663) * (-689.315) [-689.367] (-690.436) (-687.291) -- 0:00:03
943500 -- (-687.208) (-687.217) [-688.909] (-689.821) * (-686.639) [-686.975] (-688.450) (-689.903) -- 0:00:03
944000 -- [-689.950] (-687.029) (-687.421) (-688.653) * [-686.627] (-687.954) (-687.969) (-687.838) -- 0:00:03
944500 -- (-690.466) (-690.055) (-685.985) [-692.993] * (-690.589) [-686.559] (-688.825) (-686.332) -- 0:00:03
945000 -- [-688.192] (-689.137) (-685.994) (-687.149) * (-687.546) (-687.285) (-687.577) [-690.758] -- 0:00:03
Average standard deviation of split frequencies: 0.008139
945500 -- (-691.093) (-688.705) [-685.991] (-687.631) * [-689.195] (-687.196) (-686.840) (-688.855) -- 0:00:03
946000 -- (-687.736) (-687.222) (-687.270) [-687.374] * (-688.430) (-688.571) [-686.882] (-686.836) -- 0:00:03
946500 -- (-688.202) (-687.225) [-686.738] (-689.897) * (-687.101) (-688.815) [-688.274] (-689.574) -- 0:00:03
947000 -- (-691.843) (-687.544) (-686.761) [-694.163] * (-690.565) (-691.209) (-687.961) [-693.654] -- 0:00:03
947500 -- (-688.349) [-687.401] (-687.780) (-688.170) * [-687.698] (-686.734) (-690.150) (-698.105) -- 0:00:03
948000 -- [-687.235] (-690.435) (-688.167) (-687.324) * [-690.603] (-688.446) (-687.562) (-692.863) -- 0:00:03
948500 -- [-686.558] (-687.775) (-687.283) (-686.381) * (-688.772) (-688.667) [-693.339] (-691.780) -- 0:00:03
949000 -- (-690.322) (-687.967) (-688.798) [-688.711] * [-686.312] (-686.824) (-689.247) (-689.214) -- 0:00:03
949500 -- (-692.336) [-688.181] (-689.508) (-686.432) * [-688.703] (-689.356) (-686.130) (-687.479) -- 0:00:03
950000 -- (-689.431) (-688.902) (-690.138) [-688.911] * (-687.072) (-686.616) [-686.358] (-688.626) -- 0:00:03
Average standard deviation of split frequencies: 0.007901
950500 -- (-687.942) (-687.746) (-690.272) [-689.081] * (-688.932) [-686.335] (-687.193) (-689.218) -- 0:00:03
951000 -- [-686.278] (-686.539) (-687.373) (-687.559) * (-690.289) (-687.023) (-688.307) [-687.601] -- 0:00:03
951500 -- [-686.449] (-687.849) (-692.611) (-688.211) * (-687.446) (-689.791) [-686.784] (-694.289) -- 0:00:03
952000 -- (-690.594) [-687.941] (-686.785) (-689.168) * (-690.800) (-688.542) (-687.037) [-688.182] -- 0:00:02
952500 -- (-688.461) [-686.635] (-687.328) (-687.935) * (-690.043) [-689.489] (-688.698) (-691.369) -- 0:00:02
953000 -- (-689.260) (-689.529) [-689.905] (-687.866) * (-687.495) (-688.124) [-689.444] (-687.803) -- 0:00:02
953500 -- [-688.539] (-689.401) (-688.839) (-689.489) * (-691.720) (-687.085) (-687.772) [-687.759] -- 0:00:02
954000 -- [-688.402] (-689.301) (-688.840) (-690.357) * (-686.864) (-687.114) (-688.579) [-687.937] -- 0:00:02
954500 -- (-691.523) (-691.545) (-687.237) [-688.614] * (-686.789) (-687.274) [-687.591] (-688.159) -- 0:00:02
955000 -- (-688.772) (-691.013) (-687.654) [-688.659] * [-688.649] (-690.019) (-687.631) (-689.267) -- 0:00:02
Average standard deviation of split frequencies: 0.007692
955500 -- (-687.719) (-687.805) (-690.248) [-688.102] * [-686.848] (-689.168) (-688.850) (-689.655) -- 0:00:02
956000 -- [-692.452] (-686.527) (-689.238) (-690.133) * (-688.368) (-687.680) (-691.665) [-691.631] -- 0:00:02
956500 -- (-693.541) (-687.392) [-688.819] (-688.741) * (-689.419) (-688.260) (-692.010) [-688.787] -- 0:00:02
957000 -- [-688.831] (-687.581) (-688.654) (-688.131) * [-686.885] (-688.774) (-690.923) (-688.234) -- 0:00:02
957500 -- (-688.891) (-689.267) (-686.664) [-687.126] * (-685.996) (-688.654) [-688.128] (-689.700) -- 0:00:02
958000 -- (-686.569) (-691.514) (-687.969) [-686.856] * [-687.808] (-686.666) (-689.262) (-689.406) -- 0:00:02
958500 -- [-686.853] (-688.225) (-689.602) (-687.869) * [-687.532] (-690.211) (-686.671) (-689.664) -- 0:00:02
959000 -- (-690.167) (-687.441) [-689.331] (-696.958) * (-687.243) (-689.254) (-690.014) [-686.218] -- 0:00:02
959500 -- (-690.551) (-690.491) [-688.030] (-692.141) * (-688.644) [-688.075] (-687.319) (-686.013) -- 0:00:02
960000 -- (-688.596) [-686.535] (-688.219) (-689.834) * (-687.578) [-687.789] (-688.126) (-688.285) -- 0:00:02
Average standard deviation of split frequencies: 0.007622
960500 -- (-687.146) (-690.047) [-687.409] (-688.968) * (-687.772) (-688.863) (-690.986) [-687.368] -- 0:00:02
961000 -- (-688.538) (-687.564) (-686.605) [-688.060] * (-689.002) (-687.551) (-688.753) [-689.015] -- 0:00:02
961500 -- [-689.255] (-689.224) (-687.596) (-687.851) * (-690.504) (-686.434) (-687.326) [-688.143] -- 0:00:02
962000 -- [-686.065] (-687.243) (-686.197) (-686.325) * (-687.925) (-686.181) (-687.362) [-690.206] -- 0:00:02
962500 -- (-686.113) (-687.010) [-686.570] (-686.555) * (-688.593) [-687.226] (-687.561) (-689.250) -- 0:00:02
963000 -- (-686.448) (-687.352) (-688.249) [-686.462] * [-690.529] (-688.435) (-691.072) (-690.374) -- 0:00:02
963500 -- (-686.665) (-690.695) [-688.251] (-689.998) * (-686.761) [-687.035] (-689.911) (-692.223) -- 0:00:02
964000 -- (-686.528) [-688.890] (-686.614) (-693.301) * (-688.248) (-687.634) [-688.617] (-690.688) -- 0:00:02
964500 -- [-686.492] (-687.209) (-687.507) (-688.597) * [-688.425] (-691.018) (-691.020) (-687.789) -- 0:00:02
965000 -- (-687.536) (-687.225) (-689.271) [-687.664] * (-687.421) [-685.921] (-690.493) (-690.081) -- 0:00:02
Average standard deviation of split frequencies: 0.007645
965500 -- (-688.989) [-688.136] (-692.781) (-688.323) * (-688.048) (-687.929) (-690.057) [-686.553] -- 0:00:02
966000 -- (-690.364) (-688.868) [-692.292] (-688.137) * (-687.248) [-689.535] (-688.934) (-688.274) -- 0:00:02
966500 -- (-688.475) (-688.407) (-692.847) [-688.670] * (-687.886) (-692.312) [-687.460] (-688.964) -- 0:00:02
967000 -- (-687.458) [-687.056] (-689.306) (-688.207) * (-686.901) [-692.749] (-686.430) (-691.727) -- 0:00:02
967500 -- [-686.826] (-689.888) (-692.151) (-687.946) * [-686.571] (-693.792) (-686.222) (-690.864) -- 0:00:02
968000 -- (-691.456) [-687.318] (-689.839) (-687.356) * (-694.438) (-692.661) [-686.328] (-693.258) -- 0:00:01
968500 -- (-695.350) [-688.094] (-691.394) (-686.121) * [-686.824] (-689.113) (-686.390) (-687.095) -- 0:00:01
969000 -- (-687.292) (-688.136) [-688.881] (-686.100) * (-687.942) [-688.635] (-686.802) (-687.817) -- 0:00:01
969500 -- (-686.973) (-688.597) (-688.963) [-687.854] * (-688.014) (-690.369) [-686.968] (-689.769) -- 0:00:01
970000 -- (-688.257) (-688.938) (-692.624) [-690.996] * (-688.053) (-689.986) [-690.842] (-689.654) -- 0:00:01
Average standard deviation of split frequencies: 0.007965
970500 -- (-686.835) [-691.123] (-688.641) (-690.086) * (-688.371) [-687.088] (-689.761) (-690.388) -- 0:00:01
971000 -- [-687.087] (-687.057) (-689.988) (-695.905) * [-687.709] (-686.470) (-686.491) (-687.315) -- 0:00:01
971500 -- (-688.325) (-687.700) [-689.171] (-691.384) * (-688.358) [-687.005] (-687.761) (-688.011) -- 0:00:01
972000 -- [-686.156] (-688.543) (-688.298) (-691.863) * [-690.609] (-687.414) (-687.683) (-687.202) -- 0:00:01
972500 -- [-689.832] (-686.717) (-689.584) (-689.002) * (-687.488) (-688.005) (-686.073) [-687.597] -- 0:00:01
973000 -- (-688.662) (-687.864) [-688.431] (-686.987) * (-689.318) (-687.868) (-688.387) [-686.988] -- 0:00:01
973500 -- (-688.384) [-692.028] (-692.403) (-686.862) * (-687.152) [-688.770] (-690.407) (-686.815) -- 0:00:01
974000 -- (-687.295) [-686.784] (-690.838) (-688.820) * (-687.430) (-687.623) [-686.727] (-688.094) -- 0:00:01
974500 -- (-688.196) (-688.010) [-689.178] (-686.298) * (-686.443) (-689.434) [-687.226] (-687.128) -- 0:00:01
975000 -- [-690.385] (-685.893) (-692.584) (-686.293) * [-691.288] (-690.140) (-693.107) (-688.052) -- 0:00:01
Average standard deviation of split frequencies: 0.008179
975500 -- (-693.002) [-688.800] (-688.264) (-687.819) * [-687.734] (-692.562) (-686.376) (-686.869) -- 0:00:01
976000 -- (-689.782) [-687.802] (-688.741) (-691.247) * [-688.136] (-688.964) (-687.238) (-688.094) -- 0:00:01
976500 -- (-688.275) (-690.060) (-688.787) [-689.476] * (-688.455) (-687.498) (-689.093) [-687.722] -- 0:00:01
977000 -- (-686.899) (-692.275) [-686.933] (-690.567) * (-687.980) [-690.355] (-686.415) (-687.771) -- 0:00:01
977500 -- (-687.487) (-691.923) (-689.277) [-689.510] * (-687.430) (-689.981) (-689.475) [-689.515] -- 0:00:01
978000 -- (-688.139) [-686.758] (-689.333) (-690.473) * (-687.868) (-688.856) (-690.936) [-688.864] -- 0:00:01
978500 -- [-687.660] (-687.493) (-686.661) (-687.065) * (-688.210) (-688.517) (-689.708) [-689.442] -- 0:00:01
979000 -- (-687.324) [-688.820] (-692.361) (-689.066) * (-689.715) (-688.193) (-686.844) [-686.384] -- 0:00:01
979500 -- (-686.022) (-689.107) (-690.238) [-688.088] * (-687.526) (-689.042) (-686.771) [-694.884] -- 0:00:01
980000 -- (-688.943) (-688.568) (-688.146) [-687.604] * (-688.548) (-687.296) (-686.818) [-688.691] -- 0:00:01
Average standard deviation of split frequencies: 0.008052
980500 -- (-688.366) (-689.307) [-692.153] (-687.367) * (-686.382) (-688.570) [-687.650] (-688.393) -- 0:00:01
981000 -- (-690.444) [-689.643] (-690.260) (-688.175) * (-686.191) (-688.192) (-687.612) [-690.976] -- 0:00:01
981500 -- [-694.387] (-694.174) (-688.181) (-688.408) * (-688.736) (-692.838) [-687.254] (-686.124) -- 0:00:01
982000 -- (-688.897) [-687.135] (-693.051) (-689.597) * (-686.543) (-687.792) [-686.829] (-688.731) -- 0:00:01
982500 -- (-686.592) [-687.479] (-692.755) (-689.548) * (-686.543) (-688.183) [-685.930] (-691.465) -- 0:00:01
983000 -- [-686.825] (-688.714) (-688.880) (-686.624) * (-686.628) [-688.235] (-692.148) (-688.122) -- 0:00:01
983500 -- (-687.483) (-687.504) (-688.529) [-686.886] * (-686.498) (-687.705) [-687.014] (-686.154) -- 0:00:01
984000 -- (-691.846) [-689.232] (-687.006) (-686.614) * [-688.042] (-687.703) (-687.954) (-690.075) -- 0:00:00
984500 -- [-689.292] (-690.047) (-690.683) (-687.797) * (-686.878) [-688.257] (-687.799) (-687.193) -- 0:00:00
985000 -- (-688.544) [-690.212] (-690.685) (-686.194) * (-688.999) [-688.856] (-691.642) (-687.635) -- 0:00:00
Average standard deviation of split frequencies: 0.008158
985500 -- (-689.212) (-687.853) (-690.130) [-686.767] * [-687.567] (-686.935) (-687.348) (-688.482) -- 0:00:00
986000 -- (-687.120) [-689.461] (-689.867) (-687.137) * (-688.649) (-691.606) [-689.732] (-687.189) -- 0:00:00
986500 -- (-691.196) (-688.434) (-686.976) [-688.718] * [-688.810] (-693.807) (-688.732) (-689.427) -- 0:00:00
987000 -- (-688.358) [-687.041] (-687.334) (-689.611) * (-687.336) [-688.763] (-687.308) (-687.705) -- 0:00:00
987500 -- (-689.927) [-687.348] (-687.749) (-687.223) * (-688.289) (-688.763) (-690.134) [-690.733] -- 0:00:00
988000 -- (-687.864) (-690.619) (-688.678) [-688.836] * (-690.713) (-686.642) (-689.162) [-688.748] -- 0:00:00
988500 -- (-687.761) (-686.474) [-693.225] (-689.337) * [-689.684] (-686.903) (-688.244) (-690.248) -- 0:00:00
989000 -- [-688.356] (-695.781) (-690.614) (-687.250) * (-687.651) (-688.095) (-686.685) [-686.055] -- 0:00:00
989500 -- (-686.952) [-690.393] (-689.060) (-693.228) * [-688.431] (-691.598) (-686.995) (-686.683) -- 0:00:00
990000 -- (-686.416) [-687.835] (-693.279) (-686.419) * (-686.785) (-689.683) [-686.691] (-687.586) -- 0:00:00
Average standard deviation of split frequencies: 0.008280
990500 -- (-691.510) (-687.595) [-688.275] (-690.136) * (-687.861) [-687.317] (-688.540) (-686.943) -- 0:00:00
991000 -- (-691.259) (-687.862) [-687.296] (-690.711) * (-690.376) [-689.069] (-688.785) (-688.570) -- 0:00:00
991500 -- (-687.857) (-688.434) [-690.820] (-688.055) * [-686.881] (-688.157) (-686.915) (-688.968) -- 0:00:00
992000 -- [-689.812] (-690.014) (-689.572) (-688.788) * (-687.166) [-688.128] (-688.981) (-692.853) -- 0:00:00
992500 -- (-688.549) (-690.475) [-687.361] (-689.491) * [-688.040] (-689.419) (-695.566) (-692.033) -- 0:00:00
993000 -- (-689.756) [-687.223] (-686.524) (-689.810) * (-688.151) (-690.142) (-693.178) [-693.023] -- 0:00:00
993500 -- (-686.312) (-686.414) [-689.167] (-687.554) * (-686.561) [-687.960] (-690.638) (-688.333) -- 0:00:00
994000 -- (-689.538) (-687.243) (-690.070) [-687.665] * (-687.580) (-688.705) (-689.290) [-693.845] -- 0:00:00
994500 -- (-688.143) [-687.017] (-692.807) (-689.153) * (-688.079) (-687.789) [-688.404] (-692.607) -- 0:00:00
995000 -- [-687.665] (-687.919) (-689.642) (-689.015) * (-689.244) (-687.471) [-690.039] (-690.751) -- 0:00:00
Average standard deviation of split frequencies: 0.008330
995500 -- (-687.754) (-689.872) [-688.182] (-687.168) * (-690.414) (-687.321) [-689.585] (-686.945) -- 0:00:00
996000 -- [-687.782] (-686.564) (-689.888) (-687.757) * (-692.444) (-687.815) (-687.152) [-688.063] -- 0:00:00
996500 -- [-686.299] (-688.314) (-694.001) (-688.496) * [-688.144] (-687.841) (-689.119) (-688.323) -- 0:00:00
997000 -- (-685.999) (-691.128) (-687.327) [-687.879] * (-691.286) (-688.127) [-688.364] (-688.312) -- 0:00:00
997500 -- [-687.197] (-688.358) (-686.432) (-689.494) * (-686.523) (-689.385) [-687.288] (-687.895) -- 0:00:00
998000 -- (-686.603) (-687.388) (-686.233) [-688.369] * [-689.129] (-692.790) (-689.969) (-694.004) -- 0:00:00
998500 -- (-686.306) (-688.371) [-690.475] (-695.164) * (-692.865) (-696.046) [-687.673] (-691.713) -- 0:00:00
999000 -- (-688.207) [-688.951] (-687.586) (-687.357) * (-686.144) [-687.642] (-690.800) (-690.595) -- 0:00:00
999500 -- (-686.453) (-690.517) (-687.515) [-688.661] * [-687.121] (-689.502) (-690.908) (-688.550) -- 0:00:00
1000000 -- (-688.223) (-686.728) [-687.094] (-686.789) * [-689.267] (-690.474) (-687.228) (-687.425) -- 0:00:00
Average standard deviation of split frequencies: 0.008323
Analysis completed in 1 mins 2 seconds
Analysis used 59.83 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -685.81
Likelihood of best state for "cold" chain of run 2 was -685.81
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 72 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
30.7 % ( 31 %) Dirichlet(Pi{all})
32.8 % ( 29 %) Slider(Pi{all})
78.8 % ( 57 %) Multiplier(Alpha{1,2})
77.8 % ( 56 %) Multiplier(Alpha{3})
22.6 % ( 24 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 71 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 92 %) ParsSPR(Tau{all},V{all})
28.2 % ( 21 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.5 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.2 % ( 69 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
30.9 % ( 21 %) Dirichlet(Pi{all})
33.1 % ( 26 %) Slider(Pi{all})
78.1 % ( 53 %) Multiplier(Alpha{1,2})
77.5 % ( 56 %) Multiplier(Alpha{3})
24.3 % ( 29 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.0 % ( 65 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 91 %) ParsSPR(Tau{all},V{all})
28.1 % ( 25 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.5 % ( 33 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166792 0.82 0.67
3 | 166475 166357 0.84
4 | 166932 166822 166622
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166576 0.82 0.67
3 | 166640 166907 0.84
4 | 166245 167108 166524
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -687.42
| 1 |
| |
| 2 2 |
|1 2 2 22 11 1 1 |
| 2 1 222 2 2 11 1 |
| 11 1 1 2 21* 1 22 |
| 1 1 2 21 2 2 2 12 21 |
|2 1 21 1 1 2 1 1* 1 1 2 2 22 |
| 222 1 * 1 1 1 12 2 1 2 2 1 1 |
| 1 22 1 11 122 1 2 1 21 1|
| 2 2 1 21 1 |
| 1 1 2 1 2 1 2 *2|
| 2 1 |
| 1 21 2 2 |
| 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -689.10
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -687.53 -691.60
2 -687.52 -690.98
--------------------------------------
TOTAL -687.52 -691.34
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889151 0.087381 0.358969 1.441778 0.858068 1351.56 1426.28 1.000
r(A<->C){all} 0.169986 0.018358 0.000031 0.428662 0.137168 287.30 309.40 1.001
r(A<->G){all} 0.177551 0.021377 0.000017 0.462466 0.139982 231.20 269.89 1.000
r(A<->T){all} 0.167585 0.019554 0.000043 0.439143 0.128636 212.45 213.85 1.000
r(C<->G){all} 0.147261 0.016567 0.000013 0.402725 0.114249 198.70 253.01 1.001
r(C<->T){all} 0.166514 0.019161 0.000176 0.442858 0.130210 155.03 315.13 1.001
r(G<->T){all} 0.171103 0.019170 0.000044 0.458149 0.136513 196.37 223.48 1.001
pi(A){all} 0.200083 0.000314 0.165987 0.234303 0.199702 1212.01 1239.59 1.000
pi(C){all} 0.293563 0.000392 0.256174 0.333487 0.292839 1346.12 1370.19 1.000
pi(G){all} 0.298446 0.000419 0.256684 0.337835 0.297748 1236.86 1244.34 1.000
pi(T){all} 0.207908 0.000313 0.172985 0.242167 0.207543 1156.50 1184.44 1.000
alpha{1,2} 0.409648 0.238435 0.000160 1.370729 0.233874 1219.89 1267.76 1.000
alpha{3} 0.462465 0.220261 0.000600 1.389817 0.325699 1140.89 1252.61 1.000
pinvar{all} 0.996886 0.000014 0.989630 0.999998 0.998093 1154.48 1198.80 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...**.
8 -- .**...
9 -- .****.
10 -- ..****
11 -- .*.*..
12 -- .*..*.
13 -- .**.**
14 -- ..*.*.
15 -- ....**
16 -- .*...*
17 -- ...*.*
18 -- ..**..
19 -- .***.*
20 -- ..*..*
21 -- .*.***
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 451 0.150233 0.019315 0.136576 0.163891 2
8 446 0.148568 0.003769 0.145903 0.151233 2
9 446 0.148568 0.009422 0.141905 0.155230 2
10 441 0.146902 0.000471 0.146569 0.147235 2
11 437 0.145570 0.004240 0.142572 0.148568 2
12 433 0.144237 0.005182 0.140573 0.147901 2
13 431 0.143571 0.012719 0.134577 0.152565 2
14 429 0.142905 0.010835 0.135243 0.150566 2
15 425 0.141572 0.008009 0.135909 0.147235 2
16 424 0.141239 0.010364 0.133911 0.148568 2
17 419 0.139574 0.006124 0.135243 0.143904 2
18 414 0.137908 0.012248 0.129247 0.146569 2
19 412 0.137242 0.006595 0.132578 0.141905 2
20 412 0.137242 0.008480 0.131246 0.143238 2
21 411 0.136909 0.007066 0.131912 0.141905 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097170 0.009261 0.000019 0.290509 0.067445 1.000 2
length{all}[2] 0.100439 0.010123 0.000003 0.297896 0.068146 1.000 2
length{all}[3] 0.099577 0.009740 0.000085 0.297154 0.068291 1.000 2
length{all}[4] 0.097177 0.008906 0.000011 0.294405 0.067313 1.000 2
length{all}[5] 0.098026 0.009409 0.000010 0.285808 0.067213 1.000 2
length{all}[6] 0.097900 0.010149 0.000026 0.298385 0.064161 1.000 2
length{all}[7] 0.096660 0.008605 0.000166 0.285170 0.069761 0.998 2
length{all}[8] 0.097555 0.009301 0.000287 0.305201 0.066147 0.999 2
length{all}[9] 0.101122 0.008782 0.000551 0.297177 0.072447 0.999 2
length{all}[10] 0.101094 0.011892 0.000174 0.277691 0.068272 0.998 2
length{all}[11] 0.102984 0.008862 0.000214 0.279490 0.073999 0.998 2
length{all}[12] 0.096770 0.009575 0.000818 0.292505 0.063694 0.999 2
length{all}[13] 0.106433 0.011056 0.000427 0.299216 0.076981 0.999 2
length{all}[14] 0.099852 0.008980 0.000256 0.290082 0.071230 0.999 2
length{all}[15] 0.095692 0.008464 0.000325 0.290094 0.068964 0.999 2
length{all}[16] 0.094413 0.009013 0.000443 0.288049 0.067627 0.998 2
length{all}[17] 0.101262 0.010702 0.000049 0.312026 0.069355 1.001 2
length{all}[18] 0.102167 0.009834 0.000425 0.287429 0.072145 1.002 2
length{all}[19] 0.101804 0.009406 0.000409 0.284129 0.075113 0.998 2
length{all}[20] 0.106646 0.010182 0.000023 0.301440 0.079011 1.002 2
length{all}[21] 0.092382 0.009621 0.000461 0.261819 0.065507 1.011 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008323
Maximum standard deviation of split frequencies = 0.019315
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.011
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 501
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 48 patterns at 167 / 167 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 48 patterns at 167 / 167 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
46848 bytes for conP
4224 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.107248 0.047434 0.060771 0.092059 0.037394 0.057875 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -724.799662
Iterating by ming2
Initial: fx= 724.799662
x= 0.10725 0.04743 0.06077 0.09206 0.03739 0.05787 0.30000 1.30000
1 h-m-p 0.0000 0.0002 404.0935 +++ 687.863896 m 0.0002 14 | 1/8
2 h-m-p 0.0013 0.0230 65.1917 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 370.9415 ++ 679.510990 m 0.0001 45 | 2/8
4 h-m-p 0.0003 0.0262 59.6200 ----------.. | 2/8
5 h-m-p 0.0000 0.0001 331.9914 ++ 672.540666 m 0.0001 75 | 3/8
6 h-m-p 0.0004 0.0338 48.7083 ----------.. | 3/8
7 h-m-p 0.0000 0.0000 287.6761 ++ 671.089082 m 0.0000 105 | 4/8
8 h-m-p 0.0001 0.0451 36.4155 ----------.. | 4/8
9 h-m-p 0.0000 0.0002 234.4633 +++ 660.586739 m 0.0002 136 | 5/8
10 h-m-p 0.0013 0.0674 24.8765 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 166.4908 ++ 658.012440 m 0.0001 167 | 6/8
12 h-m-p 0.9381 8.0000 0.0000 ++ 658.012440 m 8.0000 178 | 6/8
13 h-m-p 0.6531 8.0000 0.0000 ++ 658.012440 m 8.0000 191 | 6/8
14 h-m-p 0.0057 2.8419 0.1460 -----Y 658.012440 0 0.0000 209 | 6/8
15 h-m-p 0.0160 8.0000 0.0002 +++++ 658.012440 m 8.0000 225 | 6/8
16 h-m-p 0.0264 5.5431 0.0752 -------Y 658.012440 0 0.0000 245 | 6/8
17 h-m-p 0.0160 8.0000 0.0000 ------Y 658.012440 0 0.0000 264 | 6/8
18 h-m-p 0.0160 8.0000 0.0000 -----------N 658.012440 0 0.0000 288
Out..
lnL = -658.012440
289 lfun, 289 eigenQcodon, 1734 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.062439 0.020336 0.088381 0.072874 0.081984 0.084358 0.301868 0.697224 0.211455
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.806710
np = 9
lnL0 = -721.619573
Iterating by ming2
Initial: fx= 721.619573
x= 0.06244 0.02034 0.08838 0.07287 0.08198 0.08436 0.30187 0.69722 0.21145
1 h-m-p 0.0000 0.0001 360.7111 ++ 703.607838 m 0.0001 14 | 1/9
2 h-m-p 0.0001 0.0005 322.3814 ++ 670.577465 m 0.0005 26 | 2/9
3 h-m-p 0.0000 0.0000 223451.4978 ++ 663.874572 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0002 177.1359 ++ 661.251772 m 0.0002 50 | 4/9
5 h-m-p 0.0004 0.0028 35.5600 ++ 659.353912 m 0.0028 62 | 5/9
6 h-m-p 0.0000 0.0001 284.9414 ++ 658.270294 m 0.0001 74 | 6/9
7 h-m-p 0.0001 0.0004 44.6980 ++ 658.012295 m 0.0004 86 | 7/9
8 h-m-p 1.6000 8.0000 0.0003 ++ 658.012294 m 8.0000 98 | 7/9
9 h-m-p 0.0086 2.9065 0.2854 ------------C 658.012294 0 0.0000 124 | 7/9
10 h-m-p 0.0160 8.0000 0.0005 +++++ 658.012293 m 8.0000 141 | 7/9
11 h-m-p 0.0105 1.1523 0.4022 -------------.. | 7/9
12 h-m-p 0.0160 8.0000 0.0004 +++++ 658.012291 m 8.0000 183 | 7/9
13 h-m-p 0.0132 3.2698 0.2558 -----------Y 658.012291 0 0.0000 208 | 7/9
14 h-m-p 0.0160 8.0000 0.0016 +++++ 658.012287 m 8.0000 225 | 7/9
15 h-m-p 0.0444 3.7783 0.2840 --------------.. | 7/9
16 h-m-p 0.0160 8.0000 0.0004 +++++ 658.012285 m 8.0000 268 | 7/9
17 h-m-p 0.0143 3.4018 0.2499 ------------Y 658.012285 0 0.0000 294 | 7/9
18 h-m-p 0.0160 8.0000 0.0058 +++++ 658.012263 m 8.0000 311 | 7/9
19 h-m-p 0.1705 3.2611 0.2730 ------------Y 658.012263 0 0.0000 337 | 7/9
20 h-m-p 0.0160 8.0000 0.0001 +++++ 658.012262 m 8.0000 354 | 7/9
21 h-m-p 0.0077 3.8271 0.2314 ----------Y 658.012262 0 0.0000 378 | 7/9
22 h-m-p 0.0160 8.0000 0.0001 +++++ 658.012262 m 8.0000 395 | 7/9
23 h-m-p 0.0078 3.8813 0.2285 -------------.. | 7/9
24 h-m-p 0.0160 8.0000 0.0006 +++++ 658.012260 m 8.0000 437 | 7/9
25 h-m-p 0.0194 3.9878 0.2266 -----------C 658.012260 0 0.0000 462 | 7/9
26 h-m-p 0.0160 8.0000 0.0021 +++++ 658.012251 m 8.0000 479 | 7/9
27 h-m-p 0.0642 4.5248 0.2618 ------------C 658.012251 0 0.0000 505 | 7/9
28 h-m-p 0.0160 8.0000 0.0002 +++++ 658.012251 m 8.0000 522 | 7/9
29 h-m-p 0.0011 0.2450 1.0954 ----------Y 658.012251 0 0.0000 546 | 7/9
30 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/9
31 h-m-p 0.0160 8.0000 0.0006 +++++ 658.012248 m 8.0000 586 | 7/9
32 h-m-p 0.0220 4.2189 0.2185 -------------.. | 7/9
33 h-m-p 0.0160 8.0000 0.0006 +++++ 658.012245 m 8.0000 628 | 7/9
34 h-m-p 0.0227 4.2854 0.2163 -------------.. | 7/9
35 h-m-p 0.0160 8.0000 0.0006 +++++ 658.012242 m 8.0000 670 | 7/9
36 h-m-p 0.0235 4.3527 0.2141 ----------C 658.012242 0 0.0000 694 | 7/9
37 h-m-p 0.0010 0.5111 0.1609 +++++ 658.012176 m 0.5111 711 | 8/9
38 h-m-p 0.3278 8.0000 0.0271 ----------C 658.012176 0 0.0000 735 | 8/9
39 h-m-p 0.0160 8.0000 0.0000 +++++ 658.012176 m 8.0000 751 | 8/9
40 h-m-p 0.0160 8.0000 1.0287 -------------.. | 8/9
41 h-m-p 0.0160 8.0000 0.0002 +++++ 658.012176 m 8.0000 790 | 8/9
42 h-m-p 0.0160 8.0000 0.4922 ------------Y 658.012176 0 0.0000 815 | 8/9
43 h-m-p 0.0160 8.0000 0.0000 --------C 658.012176 0 0.0000 836 | 8/9
44 h-m-p 0.0160 8.0000 0.0000 -----------N 658.012176 0 0.0000 860
Out..
lnL = -658.012176
861 lfun, 2583 eigenQcodon, 10332 P(t)
Time used: 0:03
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.021073 0.089136 0.073295 0.040611 0.093262 0.024851 0.249925 1.080652 0.268762 0.301190 1.552074
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 9.859346
np = 11
lnL0 = -711.826655
Iterating by ming2
Initial: fx= 711.826655
x= 0.02107 0.08914 0.07330 0.04061 0.09326 0.02485 0.24993 1.08065 0.26876 0.30119 1.55207
1 h-m-p 0.0000 0.0001 367.8865 ++ 692.672759 m 0.0001 16 | 1/11
2 h-m-p 0.0000 0.0002 149.8562 ++ 689.583793 m 0.0002 30 | 2/11
3 h-m-p 0.0000 0.0002 279.4506 ++ 680.614424 m 0.0002 44 | 3/11
4 h-m-p 0.0001 0.0005 327.4917 ++ 664.786196 m 0.0005 58 | 4/11
5 h-m-p 0.0000 0.0000 47524.4350 ++ 659.174102 m 0.0000 72 | 5/11
6 h-m-p 0.0042 0.0212 4.6111 ------------.. | 5/11
7 h-m-p 0.0000 0.0000 231.2741 ++ 658.836187 m 0.0000 110 | 6/11
8 h-m-p 0.0011 0.5657 3.3814 -----------.. | 6/11
9 h-m-p 0.0000 0.0000 163.6667 ++ 658.012381 m 0.0000 147 | 7/11
10 h-m-p 0.0632 8.0000 0.0000 ++++ 658.012381 m 8.0000 163 | 7/11
11 h-m-p 0.0160 8.0000 0.0069 ----C 658.012381 0 0.0000 185 | 7/11
12 h-m-p 0.0160 8.0000 0.0002 +++++ 658.012381 m 8.0000 206 | 7/11
13 h-m-p 0.0004 0.1804 4.0156 +++++ 658.012377 m 0.1804 227 | 8/11
14 h-m-p 0.0815 8.0000 5.0124 --------------.. | 8/11
15 h-m-p 0.0160 8.0000 0.0000 +++++ 658.012377 m 8.0000 270 | 8/11
16 h-m-p 0.0160 8.0000 0.1698 ---------C 658.012377 0 0.0000 296 | 8/11
17 h-m-p 0.0160 8.0000 0.0419 +++++ 658.012362 m 8.0000 316 | 8/11
18 h-m-p 0.1991 8.0000 1.6829 ---------------.. | 8/11
19 h-m-p 0.0160 8.0000 0.0001 +++++ 658.012362 m 8.0000 363 | 8/11
20 h-m-p 0.0160 8.0000 0.0928 +++++ 658.012314 m 8.0000 383 | 8/11
21 h-m-p 0.3814 8.0000 1.9460 --------------C 658.012314 0 0.0000 414 | 8/11
22 h-m-p 0.0160 8.0000 0.0004 +++++ 658.012313 m 8.0000 431 | 8/11
23 h-m-p 0.0048 2.3760 43.6444 ++YY 658.012217 1 0.0760 451 | 8/11
24 h-m-p 1.6000 8.0000 0.0255 Y 658.012217 0 3.5772 465 | 8/11
25 h-m-p 1.6000 8.0000 0.0010 ++ 658.012216 m 8.0000 482 | 8/11
26 h-m-p 0.0304 8.0000 0.2599 +++Y 658.012215 0 1.5040 502 | 8/11
27 h-m-p 1.6000 8.0000 0.0869 ++ 658.012206 m 8.0000 519 | 8/11
28 h-m-p 0.1019 0.5097 1.8657 ++ 658.012181 m 0.5097 536 | 9/11
29 h-m-p 0.7143 8.0000 1.2687 ++ 658.012130 m 8.0000 550 | 9/11
30 h-m-p 1.6000 8.0000 0.0563 ++ 658.012130 m 8.0000 564 | 9/11
31 h-m-p 0.4241 8.0000 1.0628 +++ 658.012130 m 8.0000 581 | 9/11
32 h-m-p 1.6000 8.0000 0.0000 Y 658.012130 0 1.6000 595 | 8/11
33 h-m-p 0.0160 8.0000 0.0000 Y 658.012130 0 0.0160 611
Out..
lnL = -658.012130
612 lfun, 2448 eigenQcodon, 11016 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -658.042173 S = -658.012735 -0.011316
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 48 patterns 0:06
did 20 / 48 patterns 0:06
did 30 / 48 patterns 0:06
did 40 / 48 patterns 0:06
did 48 / 48 patterns 0:07
Time used: 0:07
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.012254 0.062015 0.054642 0.064597 0.057193 0.015126 0.000100 0.654191 1.545370
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 18.504811
np = 9
lnL0 = -699.581348
Iterating by ming2
Initial: fx= 699.581348
x= 0.01225 0.06202 0.05464 0.06460 0.05719 0.01513 0.00011 0.65419 1.54537
1 h-m-p 0.0000 0.0000 371.5439 ++ 699.017948 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0069 45.2762 ++++ 689.241136 m 0.0069 28 | 2/9
3 h-m-p 0.0000 0.0000 126137.2041 ++ 687.540833 m 0.0000 40 | 3/9
4 h-m-p 0.0000 0.0001 2944.8502 ++ 682.070902 m 0.0001 52 | 4/9
5 h-m-p 0.0005 0.0023 26.1794 ++ 679.172513 m 0.0023 64 | 5/9
6 h-m-p 0.0001 0.0003 91.1141 ++ 673.428345 m 0.0003 76 | 6/9
7 h-m-p 0.0006 0.0031 27.1400 ++ 671.242128 m 0.0031 88 | 7/9
8 h-m-p 0.0558 8.0000 1.0345 --------------.. | 7/9
9 h-m-p 0.0000 0.0006 139.7111 ++++ 658.012130 m 0.0006 126 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 ---Y 658.012130 0 0.0063 141 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 Y 658.012130 0 1.6000 154
Out..
lnL = -658.012130
155 lfun, 1705 eigenQcodon, 9300 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.028827 0.050307 0.059969 0.096106 0.039441 0.059311 0.000100 0.900000 0.781875 1.535288 1.301419
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 15.223171
np = 11
lnL0 = -709.685275
Iterating by ming2
Initial: fx= 709.685275
x= 0.02883 0.05031 0.05997 0.09611 0.03944 0.05931 0.00011 0.90000 0.78188 1.53529 1.30142
1 h-m-p 0.0000 0.0000 360.0728 ++ 709.159664 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0031 98.2306 ++++ 682.971731 m 0.0031 32 | 2/11
3 h-m-p 0.0000 0.0000 3310.9113 ++ 674.721981 m 0.0000 46 | 3/11
4 h-m-p 0.0008 0.0042 34.6828 ++ 670.658965 m 0.0042 60 | 4/11
5 h-m-p 0.0000 0.0001 263.6502 ++ 668.083317 m 0.0001 74 | 5/11
6 h-m-p 0.0010 0.0053 34.9252 ++ 664.967303 m 0.0053 88 | 6/11
7 h-m-p 0.0000 0.0000 4536.7301 ++ 658.012387 m 0.0000 102 | 7/11
8 h-m-p 1.6000 8.0000 0.0001 ++ 658.012386 m 8.0000 116 | 7/11
9 h-m-p 0.0002 0.0651 4.4429 +++++ 658.012313 m 0.0651 137 | 8/11
10 h-m-p 1.0394 7.8427 0.1143 ++ 658.012130 m 7.8427 151 | 9/11
11 h-m-p 1.6000 8.0000 0.0030 ----C 658.012130 0 0.0014 172 | 9/11
12 h-m-p 0.0120 6.0231 4.5777 ----------N 658.012130 0 0.0000 198 | 9/11
13 h-m-p 0.0305 8.0000 0.0000 ----N 658.012130 0 0.0000 216 | 9/11
14 h-m-p 0.0160 8.0000 0.0002 --------N 658.012130 0 0.0000 240
Out..
lnL = -658.012130
241 lfun, 2892 eigenQcodon, 15906 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -658.051077 S = -658.012734 -0.016943
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 48 patterns 0:13
did 20 / 48 patterns 0:13
did 30 / 48 patterns 0:13
did 40 / 48 patterns 0:13
did 48 / 48 patterns 0:14
Time used: 0:14
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=167
NC_011896_1_WP_010907840_1_651_MLBR_RS03095 MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
NC_002677_1_NP_301516_1_388_mtb12 MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
NZ_LVXE01000001_1_WP_010907840_1_37_A3216_RS00190 MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
NZ_LYPH01000001_1_WP_010907840_1_25_A8144_RS00135 MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
NZ_CP029543_1_WP_010907840_1_666_DIJ64_RS03390 MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
NZ_AP014567_1_WP_010907840_1_682_JK2ML_RS03470 MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
**************************************************
NC_011896_1_WP_010907840_1_651_MLBR_RS03095 PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
NC_002677_1_NP_301516_1_388_mtb12 PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
NZ_LVXE01000001_1_WP_010907840_1_37_A3216_RS00190 PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
NZ_LYPH01000001_1_WP_010907840_1_25_A8144_RS00135 PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
NZ_CP029543_1_WP_010907840_1_666_DIJ64_RS03390 PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
NZ_AP014567_1_WP_010907840_1_682_JK2ML_RS03470 PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
**************************************************
NC_011896_1_WP_010907840_1_651_MLBR_RS03095 AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
NC_002677_1_NP_301516_1_388_mtb12 AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
NZ_LVXE01000001_1_WP_010907840_1_37_A3216_RS00190 AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
NZ_LYPH01000001_1_WP_010907840_1_25_A8144_RS00135 AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
NZ_CP029543_1_WP_010907840_1_666_DIJ64_RS03390 AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
NZ_AP014567_1_WP_010907840_1_682_JK2ML_RS03470 AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
**************************************************
NC_011896_1_WP_010907840_1_651_MLBR_RS03095 WVLSRHSAMELLQAAGR
NC_002677_1_NP_301516_1_388_mtb12 WVLSRHSAMELLQAAGR
NZ_LVXE01000001_1_WP_010907840_1_37_A3216_RS00190 WVLSRHSAMELLQAAGR
NZ_LYPH01000001_1_WP_010907840_1_25_A8144_RS00135 WVLSRHSAMELLQAAGR
NZ_CP029543_1_WP_010907840_1_666_DIJ64_RS03390 WVLSRHSAMELLQAAGR
NZ_AP014567_1_WP_010907840_1_682_JK2ML_RS03470 WVLSRHSAMELLQAAGR
*****************
>NC_011896_1_WP_010907840_1_651_MLBR_RS03095 ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG T >NC_002677_1_NP_301516_1_388_mtb12 ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG T >NZ_LVXE01000001_1_WP_010907840_1_37_A3216_RS00190 ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG T >NZ_LYPH01000001_1_WP_010907840_1_25_A8144_RS00135 ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG T >NZ_CP029543_1_WP_010907840_1_666_DIJ64_RS03390 ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG T >NZ_AP014567_1_WP_010907840_1_682_JK2ML_RS03470 ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG T
>NC_011896_1_WP_010907840_1_651_MLBR_RS03095 MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS WVLSRHSAMELLQAAGR >NC_002677_1_NP_301516_1_388_mtb12 MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS WVLSRHSAMELLQAAGR >NZ_LVXE01000001_1_WP_010907840_1_37_A3216_RS00190 MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS WVLSRHSAMELLQAAGR >NZ_LYPH01000001_1_WP_010907840_1_25_A8144_RS00135 MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS WVLSRHSAMELLQAAGR >NZ_CP029543_1_WP_010907840_1_666_DIJ64_RS03390 MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS WVLSRHSAMELLQAAGR >NZ_AP014567_1_WP_010907840_1_682_JK2ML_RS03470 MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS WVLSRHSAMELLQAAGR
#NEXUS
[ID: 9275462235]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907840_1_651_MLBR_RS03095
NC_002677_1_NP_301516_1_388_mtb12
NZ_LVXE01000001_1_WP_010907840_1_37_A3216_RS00190
NZ_LYPH01000001_1_WP_010907840_1_25_A8144_RS00135
NZ_CP029543_1_WP_010907840_1_666_DIJ64_RS03390
NZ_AP014567_1_WP_010907840_1_682_JK2ML_RS03470
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907840_1_651_MLBR_RS03095,
2 NC_002677_1_NP_301516_1_388_mtb12,
3 NZ_LVXE01000001_1_WP_010907840_1_37_A3216_RS00190,
4 NZ_LYPH01000001_1_WP_010907840_1_25_A8144_RS00135,
5 NZ_CP029543_1_WP_010907840_1_666_DIJ64_RS03390,
6 NZ_AP014567_1_WP_010907840_1_682_JK2ML_RS03470
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06744481,2:0.06814559,3:0.0682908,4:0.0673127,5:0.06721304,6:0.06416142);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06744481,2:0.06814559,3:0.0682908,4:0.0673127,5:0.06721304,6:0.06416142);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -687.53 -691.60
2 -687.52 -690.98
--------------------------------------
TOTAL -687.52 -691.34
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889151 0.087381 0.358969 1.441778 0.858068 1351.56 1426.28 1.000
r(A<->C){all} 0.169986 0.018358 0.000031 0.428662 0.137168 287.30 309.40 1.001
r(A<->G){all} 0.177551 0.021377 0.000017 0.462466 0.139982 231.20 269.89 1.000
r(A<->T){all} 0.167585 0.019554 0.000043 0.439143 0.128636 212.45 213.85 1.000
r(C<->G){all} 0.147261 0.016567 0.000013 0.402725 0.114249 198.70 253.01 1.001
r(C<->T){all} 0.166514 0.019161 0.000176 0.442858 0.130210 155.03 315.13 1.001
r(G<->T){all} 0.171103 0.019170 0.000044 0.458149 0.136513 196.37 223.48 1.001
pi(A){all} 0.200083 0.000314 0.165987 0.234303 0.199702 1212.01 1239.59 1.000
pi(C){all} 0.293563 0.000392 0.256174 0.333487 0.292839 1346.12 1370.19 1.000
pi(G){all} 0.298446 0.000419 0.256684 0.337835 0.297748 1236.86 1244.34 1.000
pi(T){all} 0.207908 0.000313 0.172985 0.242167 0.207543 1156.50 1184.44 1.000
alpha{1,2} 0.409648 0.238435 0.000160 1.370729 0.233874 1219.89 1267.76 1.000
alpha{3} 0.462465 0.220261 0.000600 1.389817 0.325699 1140.89 1252.61 1.000
pinvar{all} 0.996886 0.000014 0.989630 0.999998 0.998093 1154.48 1198.80 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/10res/mtb12/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 167
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 4 4 4 4 4 4 | TCC 4 4 4 4 4 4 | TAC 0 0 0 0 0 0 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 7 7 7 7 7 7 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 1 1 1 1 1 | His CAT 1 1 1 1 1 1 | Arg CGT 1 1 1 1 1 1
CTC 2 2 2 2 2 2 | CCC 1 1 1 1 1 1 | CAC 3 3 3 3 3 3 | CGC 2 2 2 2 2 2
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 2 2 2 2 2 2 | CGA 1 1 1 1 1 1
CTG 6 6 6 6 6 6 | CCG 12 12 12 12 12 12 | CAG 4 4 4 4 4 4 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 0 0 0 0 0 0 | Asn AAT 4 4 4 4 4 4 | Ser AGT 3 3 3 3 3 3
ATC 6 6 6 6 6 6 | ACC 6 6 6 6 6 6 | AAC 2 2 2 2 2 2 | AGC 2 2 2 2 2 2
ATA 2 2 2 2 2 2 | ACA 1 1 1 1 1 1 | Lys AAA 4 4 4 4 4 4 | Arg AGA 0 0 0 0 0 0
Met ATG 5 5 5 5 5 5 | ACG 4 4 4 4 4 4 | AAG 3 3 3 3 3 3 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 5 5 5 5 5 5 | Asp GAT 5 5 5 5 5 5 | Gly GGT 6 6 6 6 6 6
GTC 4 4 4 4 4 4 | GCC 9 9 9 9 9 9 | GAC 2 2 2 2 2 2 | GGC 5 5 5 5 5 5
GTA 0 0 0 0 0 0 | GCA 3 3 3 3 3 3 | Glu GAA 2 2 2 2 2 2 | GGA 2 2 2 2 2 2
GTG 5 5 5 5 5 5 | GCG 7 7 7 7 7 7 | GAG 4 4 4 4 4 4 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907840_1_651_MLBR_RS03095
position 1: T:0.13772 C:0.21557 A:0.26946 G:0.37725
position 2: T:0.28144 C:0.35329 A:0.22156 G:0.14371
position 3: T:0.20359 C:0.31138 A:0.10778 G:0.37725
Average T:0.20758 C:0.29341 A:0.19960 G:0.29940
#2: NC_002677_1_NP_301516_1_388_mtb12
position 1: T:0.13772 C:0.21557 A:0.26946 G:0.37725
position 2: T:0.28144 C:0.35329 A:0.22156 G:0.14371
position 3: T:0.20359 C:0.31138 A:0.10778 G:0.37725
Average T:0.20758 C:0.29341 A:0.19960 G:0.29940
#3: NZ_LVXE01000001_1_WP_010907840_1_37_A3216_RS00190
position 1: T:0.13772 C:0.21557 A:0.26946 G:0.37725
position 2: T:0.28144 C:0.35329 A:0.22156 G:0.14371
position 3: T:0.20359 C:0.31138 A:0.10778 G:0.37725
Average T:0.20758 C:0.29341 A:0.19960 G:0.29940
#4: NZ_LYPH01000001_1_WP_010907840_1_25_A8144_RS00135
position 1: T:0.13772 C:0.21557 A:0.26946 G:0.37725
position 2: T:0.28144 C:0.35329 A:0.22156 G:0.14371
position 3: T:0.20359 C:0.31138 A:0.10778 G:0.37725
Average T:0.20758 C:0.29341 A:0.19960 G:0.29940
#5: NZ_CP029543_1_WP_010907840_1_666_DIJ64_RS03390
position 1: T:0.13772 C:0.21557 A:0.26946 G:0.37725
position 2: T:0.28144 C:0.35329 A:0.22156 G:0.14371
position 3: T:0.20359 C:0.31138 A:0.10778 G:0.37725
Average T:0.20758 C:0.29341 A:0.19960 G:0.29940
#6: NZ_AP014567_1_WP_010907840_1_682_JK2ML_RS03470
position 1: T:0.13772 C:0.21557 A:0.26946 G:0.37725
position 2: T:0.28144 C:0.35329 A:0.22156 G:0.14371
position 3: T:0.20359 C:0.31138 A:0.10778 G:0.37725
Average T:0.20758 C:0.29341 A:0.19960 G:0.29940
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 6 | Tyr Y TAT 6 | Cys C TGT 0
TTC 24 | TCC 24 | TAC 0 | TGC 0
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 42 | TCG 24 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 6 | His H CAT 6 | Arg R CGT 6
CTC 12 | CCC 6 | CAC 18 | CGC 12
CTA 0 | CCA 0 | Gln Q CAA 12 | CGA 6
CTG 36 | CCG 72 | CAG 24 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 0 | Asn N AAT 24 | Ser S AGT 18
ATC 36 | ACC 36 | AAC 12 | AGC 12
ATA 12 | ACA 6 | Lys K AAA 24 | Arg R AGA 0
Met M ATG 30 | ACG 24 | AAG 18 | AGG 0
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 30 | Asp D GAT 30 | Gly G GGT 36
GTC 24 | GCC 54 | GAC 12 | GGC 30
GTA 0 | GCA 18 | Glu E GAA 12 | GGA 12
GTG 30 | GCG 42 | GAG 24 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13772 C:0.21557 A:0.26946 G:0.37725
position 2: T:0.28144 C:0.35329 A:0.22156 G:0.14371
position 3: T:0.20359 C:0.31138 A:0.10778 G:0.37725
Average T:0.20758 C:0.29341 A:0.19960 G:0.29940
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -658.012440 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.301868 1.301419
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907840_1_651_MLBR_RS03095: 0.000004, NC_002677_1_NP_301516_1_388_mtb12: 0.000004, NZ_LVXE01000001_1_WP_010907840_1_37_A3216_RS00190: 0.000004, NZ_LYPH01000001_1_WP_010907840_1_25_A8144_RS00135: 0.000004, NZ_CP029543_1_WP_010907840_1_666_DIJ64_RS03390: 0.000004, NZ_AP014567_1_WP_010907840_1_682_JK2ML_RS03470: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30187
omega (dN/dS) = 1.30142
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 372.3 128.7 1.3014 0.0000 0.0000 0.0 0.0
7..2 0.000 372.3 128.7 1.3014 0.0000 0.0000 0.0 0.0
7..3 0.000 372.3 128.7 1.3014 0.0000 0.0000 0.0 0.0
7..4 0.000 372.3 128.7 1.3014 0.0000 0.0000 0.0 0.0
7..5 0.000 372.3 128.7 1.3014 0.0000 0.0000 0.0 0.0
7..6 0.000 372.3 128.7 1.3014 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -658.012176 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.249925 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907840_1_651_MLBR_RS03095: 0.000004, NC_002677_1_NP_301516_1_388_mtb12: 0.000004, NZ_LVXE01000001_1_WP_010907840_1_37_A3216_RS00190: 0.000004, NZ_LYPH01000001_1_WP_010907840_1_25_A8144_RS00135: 0.000004, NZ_CP029543_1_WP_010907840_1_666_DIJ64_RS03390: 0.000004, NZ_AP014567_1_WP_010907840_1_682_JK2ML_RS03470: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.24993
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 372.6 128.4 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 372.6 128.4 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 372.6 128.4 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 372.6 128.4 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 372.6 128.4 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 372.6 128.4 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:03
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -658.012130 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999997 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907840_1_651_MLBR_RS03095: 0.000004, NC_002677_1_NP_301516_1_388_mtb12: 0.000004, NZ_LVXE01000001_1_WP_010907840_1_37_A3216_RS00190: 0.000004, NZ_LYPH01000001_1_WP_010907840_1_25_A8144_RS00135: 0.000004, NZ_CP029543_1_WP_010907840_1_666_DIJ64_RS03390: 0.000004, NZ_AP014567_1_WP_010907840_1_682_JK2ML_RS03470: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 374.1 126.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 374.1 126.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 374.1 126.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 374.1 126.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 374.1 126.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 374.1 126.9 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907840_1_651_MLBR_RS03095)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.102 0.101 0.101 0.101 0.100 0.100 0.099 0.099 0.099 0.098
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:07
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -658.012130 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.612548
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907840_1_651_MLBR_RS03095: 0.000004, NC_002677_1_NP_301516_1_388_mtb12: 0.000004, NZ_LVXE01000001_1_WP_010907840_1_37_A3216_RS00190: 0.000004, NZ_LYPH01000001_1_WP_010907840_1_25_A8144_RS00135: 0.000004, NZ_CP029543_1_WP_010907840_1_666_DIJ64_RS03390: 0.000004, NZ_AP014567_1_WP_010907840_1_682_JK2ML_RS03470: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.61255
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 374.1 126.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 374.1 126.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 374.1 126.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 374.1 126.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 374.1 126.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 374.1 126.9 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -658.012130 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.592465 2.028873
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907840_1_651_MLBR_RS03095: 0.000004, NC_002677_1_NP_301516_1_388_mtb12: 0.000004, NZ_LVXE01000001_1_WP_010907840_1_37_A3216_RS00190: 0.000004, NZ_LYPH01000001_1_WP_010907840_1_25_A8144_RS00135: 0.000004, NZ_CP029543_1_WP_010907840_1_666_DIJ64_RS03390: 0.000004, NZ_AP014567_1_WP_010907840_1_682_JK2ML_RS03470: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.59246
(p1 = 0.00001) w = 2.02887
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 2.02887
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 374.1 126.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 374.1 126.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 374.1 126.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 374.1 126.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 374.1 126.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 374.1 126.9 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907840_1_651_MLBR_RS03095)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.097 0.098 0.098 0.099 0.100 0.100 0.101 0.102 0.102 0.103
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.103 0.102 0.101 0.101 0.100 0.100 0.099 0.098 0.098 0.097
Time used: 0:14
Model 1: NearlyNeutral -658.012176 Model 2: PositiveSelection -658.01213 Model 0: one-ratio -658.01244 Model 7: beta -658.01213 Model 8: beta&w>1 -658.01213 Model 0 vs 1 5.280000000311702E-4 Model 2 vs 1 9.1999999995096E-5 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
