--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 12:45:30 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/mtb12/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -687.53          -691.60
2       -687.52          -690.98
--------------------------------------
TOTAL     -687.52          -691.34
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.889151    0.087381    0.358969    1.441778    0.858068   1351.56   1426.28    1.000
r(A<->C){all}   0.169986    0.018358    0.000031    0.428662    0.137168    287.30    309.40    1.001
r(A<->G){all}   0.177551    0.021377    0.000017    0.462466    0.139982    231.20    269.89    1.000
r(A<->T){all}   0.167585    0.019554    0.000043    0.439143    0.128636    212.45    213.85    1.000
r(C<->G){all}   0.147261    0.016567    0.000013    0.402725    0.114249    198.70    253.01    1.001
r(C<->T){all}   0.166514    0.019161    0.000176    0.442858    0.130210    155.03    315.13    1.001
r(G<->T){all}   0.171103    0.019170    0.000044    0.458149    0.136513    196.37    223.48    1.001
pi(A){all}      0.200083    0.000314    0.165987    0.234303    0.199702   1212.01   1239.59    1.000
pi(C){all}      0.293563    0.000392    0.256174    0.333487    0.292839   1346.12   1370.19    1.000
pi(G){all}      0.298446    0.000419    0.256684    0.337835    0.297748   1236.86   1244.34    1.000
pi(T){all}      0.207908    0.000313    0.172985    0.242167    0.207543   1156.50   1184.44    1.000
alpha{1,2}      0.409648    0.238435    0.000160    1.370729    0.233874   1219.89   1267.76    1.000
alpha{3}        0.462465    0.220261    0.000600    1.389817    0.325699   1140.89   1252.61    1.000
pinvar{all}     0.996886    0.000014    0.989630    0.999998    0.998093   1154.48   1198.80    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-658.012176
Model 2: PositiveSelection	-658.01213
Model 0: one-ratio	-658.01244
Model 7: beta	-658.01213
Model 8: beta&w>1	-658.01213


Model 0 vs 1	5.280000000311702E-4

Model 2 vs 1	9.1999999995096E-5

Model 8 vs 7	0.0
>C1
MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
WVLSRHSAMELLQAAGR
>C2
MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
WVLSRHSAMELLQAAGR
>C3
MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
WVLSRHSAMELLQAAGR
>C4
MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
WVLSRHSAMELLQAAGR
>C5
MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
WVLSRHSAMELLQAAGR
>C6
MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
WVLSRHSAMELLQAAGR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=167 

C1              MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
C2              MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
C3              MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
C4              MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
C5              MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
C6              MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
                **************************************************

C1              PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
C2              PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
C3              PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
C4              PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
C5              PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
C6              PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
                **************************************************

C1              AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
C2              AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
C3              AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
C4              AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
C5              AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
C6              AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
                **************************************************

C1              WVLSRHSAMELLQAAGR
C2              WVLSRHSAMELLQAAGR
C3              WVLSRHSAMELLQAAGR
C4              WVLSRHSAMELLQAAGR
C5              WVLSRHSAMELLQAAGR
C6              WVLSRHSAMELLQAAGR
                *****************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  167 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  167 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5010]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [5010]--->[5010]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.471 Mb, Max= 30.704 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
C2              MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
C3              MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
C4              MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
C5              MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
C6              MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
                **************************************************

C1              PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
C2              PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
C3              PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
C4              PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
C5              PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
C6              PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
                **************************************************

C1              AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
C2              AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
C3              AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
C4              AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
C5              AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
C6              AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
                **************************************************

C1              WVLSRHSAMELLQAAGR
C2              WVLSRHSAMELLQAAGR
C3              WVLSRHSAMELLQAAGR
C4              WVLSRHSAMELLQAAGR
C5              WVLSRHSAMELLQAAGR
C6              WVLSRHSAMELLQAAGR
                *****************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC
C2              ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC
C3              ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC
C4              ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC
C5              ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC
C6              ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC
                **************************************************

C1              CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT
C2              CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT
C3              CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT
C4              CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT
C5              CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT
C6              CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT
                **************************************************

C1              CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA
C2              CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA
C3              CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA
C4              CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA
C5              CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA
C6              CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA
                **************************************************

C1              CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA
C2              CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA
C3              CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA
C4              CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA
C5              CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA
C6              CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA
                **************************************************

C1              AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG
C2              AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG
C3              AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG
C4              AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG
C5              AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG
C6              AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG
                **************************************************

C1              GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT
C2              GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT
C3              GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT
C4              GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT
C5              GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT
C6              GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT
                **************************************************

C1              GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG
C2              GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG
C3              GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG
C4              GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG
C5              GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG
C6              GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG
                **************************************************

C1              ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA
C2              ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA
C3              ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA
C4              ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA
C5              ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA
C6              ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA
                **************************************************

C1              AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC
C2              AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC
C3              AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC
C4              AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC
C5              AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC
C6              AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC
                **************************************************

C1              TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG
C2              TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG
C3              TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG
C4              TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG
C5              TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG
C6              TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG
                **************************************************

C1              T
C2              T
C3              T
C4              T
C5              T
C6              T
                *



>C1
ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC
CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT
CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA
CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA
AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG
GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT
GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG
ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA
AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC
TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG
T
>C2
ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC
CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT
CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA
CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA
AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG
GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT
GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG
ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA
AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC
TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG
T
>C3
ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC
CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT
CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA
CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA
AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG
GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT
GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG
ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA
AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC
TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG
T
>C4
ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC
CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT
CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA
CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA
AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG
GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT
GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG
ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA
AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC
TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG
T
>C5
ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC
CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT
CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA
CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA
AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG
GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT
GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG
ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA
AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC
TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG
T
>C6
ATGACCATGAAATCCATCGCCACCTATGCAGCGCTGGCCATAATCGGAGC
CGCCGTCGACGGCCTGACATCGATGGCTATCCCGACGGGCCCGGCCGCGT
CCCACATACAACCCGTTGCCTTCGGTGTGCCGCTGCCGCAAGATCCGGCA
CCGGCTGCGGATGTGCCGACCGCAGCCGAATTGACCAGTTTGCTCAATAA
AATTGTCGATCCTGATGTTTCGTTCATGCACAAGAGCCAGTTGGTCGAGG
GCGGAATCGGTTCTGCGGAGGCTCATATTGGCGATCGCGAGTTGAAAAAT
GCGGCTCAGAAGGGTGAACTGCCGTTGTTGTTCAGTGTGACGAATATTCG
ACCGGGTACCAGTGGTTCAGCCACGGCTGACGTTTCCGTGTCGGGTCCGA
AACTCAACCCGCCGGTCACGCAGAACATCACCTTCATCAATAAGGGCAGC
TGGGTGCTGTCGCGCCACTCCGCGATGGAGCTGTTGCAGGCCGCGGGGCG
T
>C1
MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
WVLSRHSAMELLQAAGR
>C2
MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
WVLSRHSAMELLQAAGR
>C3
MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
WVLSRHSAMELLQAAGR
>C4
MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
WVLSRHSAMELLQAAGR
>C5
MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
WVLSRHSAMELLQAAGR
>C6
MTMKSIATYAALAIIGAAVDGLTSMAIPTGPAASHIQPVAFGVPLPQDPA
PAADVPTAAELTSLLNKIVDPDVSFMHKSQLVEGGIGSAEAHIGDRELKN
AAQKGELPLLFSVTNIRPGTSGSATADVSVSGPKLNPPVTQNITFINKGS
WVLSRHSAMELLQAAGR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 501 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579783454
      Setting output file names to "/data/10res/mtb12/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 791931465
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 9275462235
      Seed = 109632827
      Swapseed = 1579783454
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1121.262018 -- -24.965149
         Chain 2 -- -1121.262018 -- -24.965149
         Chain 3 -- -1121.261954 -- -24.965149
         Chain 4 -- -1121.262018 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1121.262018 -- -24.965149
         Chain 2 -- -1121.262018 -- -24.965149
         Chain 3 -- -1121.262018 -- -24.965149
         Chain 4 -- -1121.262018 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1121.262] (-1121.262) (-1121.262) (-1121.262) * [-1121.262] (-1121.262) (-1121.262) (-1121.262) 
        500 -- (-706.915) (-700.705) [-698.383] (-697.440) * [-697.753] (-699.158) (-693.494) (-697.356) -- 0:33:19
       1000 -- (-697.601) (-700.079) (-701.694) [-698.953] * (-696.356) [-699.355] (-693.486) (-704.088) -- 0:16:39
       1500 -- (-698.809) (-698.533) [-695.010] (-700.106) * (-701.059) (-700.898) [-698.178] (-697.627) -- 0:11:05
       2000 -- (-698.576) (-699.634) (-695.153) [-697.794] * (-700.512) [-696.102] (-692.696) (-697.721) -- 0:08:19
       2500 -- (-692.208) (-695.524) (-705.112) [-699.542] * [-697.340] (-696.405) (-694.473) (-698.623) -- 0:06:39
       3000 -- [-693.757] (-692.181) (-709.545) (-705.310) * (-695.729) (-697.802) [-692.286] (-693.579) -- 0:05:32
       3500 -- [-698.516] (-693.917) (-699.464) (-700.121) * (-694.485) (-701.104) [-696.449] (-695.987) -- 0:04:44
       4000 -- (-700.105) (-693.926) (-696.879) [-696.828] * (-693.521) (-694.395) (-694.174) [-698.804] -- 0:04:09
       4500 -- (-694.415) [-703.464] (-693.992) (-706.067) * (-698.055) (-701.149) [-694.958] (-689.912) -- 0:03:41
       5000 -- (-700.190) [-701.605] (-705.362) (-699.847) * (-696.561) [-691.510] (-698.162) (-696.340) -- 0:03:19

      Average standard deviation of split frequencies: 0.057140

       5500 -- (-703.634) [-697.193] (-698.797) (-701.929) * (-700.798) (-700.186) [-695.657] (-695.994) -- 0:03:00
       6000 -- (-698.935) (-691.918) (-696.306) [-691.209] * (-696.057) [-697.548] (-696.098) (-691.726) -- 0:02:45
       6500 -- [-700.355] (-691.967) (-706.104) (-695.739) * (-691.493) (-707.395) (-691.943) [-695.501] -- 0:02:32
       7000 -- [-695.336] (-694.629) (-699.604) (-693.108) * (-714.135) [-696.789] (-692.798) (-702.549) -- 0:02:21
       7500 -- (-694.736) [-691.808] (-701.842) (-698.122) * (-698.466) [-692.371] (-700.877) (-698.927) -- 0:02:12
       8000 -- (-700.424) (-702.827) [-697.293] (-702.558) * (-695.434) (-698.143) (-692.380) [-696.027] -- 0:02:04
       8500 -- (-697.753) [-698.174] (-699.845) (-703.550) * (-704.413) (-697.436) (-695.302) [-695.828] -- 0:01:56
       9000 -- (-694.778) (-702.626) [-693.237] (-704.057) * (-696.025) (-694.231) [-693.357] (-698.446) -- 0:01:50
       9500 -- [-691.792] (-697.491) (-694.940) (-693.976) * [-695.917] (-696.347) (-691.900) (-704.678) -- 0:01:44
      10000 -- (-701.858) [-694.848] (-707.755) (-702.090) * (-702.321) (-694.708) (-698.360) [-692.806] -- 0:01:39

      Average standard deviation of split frequencies: 0.065239

      10500 -- (-695.220) (-696.045) [-688.802] (-691.941) * (-700.277) (-701.280) (-701.654) [-696.761] -- 0:01:34
      11000 -- (-700.087) [-693.904] (-688.673) (-697.309) * (-691.246) (-701.806) (-694.824) [-699.084] -- 0:01:29
      11500 -- (-697.615) [-692.350] (-690.295) (-695.332) * (-696.963) (-706.332) (-699.369) [-700.347] -- 0:01:25
      12000 -- (-708.078) (-701.634) [-689.723] (-699.853) * (-696.842) [-691.575] (-697.693) (-702.817) -- 0:01:22
      12500 -- (-698.400) (-712.400) (-693.266) [-693.118] * (-694.240) (-690.561) (-693.699) [-694.958] -- 0:01:19
      13000 -- (-703.261) (-698.446) (-687.165) [-700.027] * (-694.174) (-689.932) [-693.161] (-698.691) -- 0:01:15
      13500 -- (-705.436) [-686.164] (-687.907) (-696.353) * [-700.482] (-689.217) (-698.391) (-695.730) -- 0:01:13
      14000 -- [-689.307] (-687.456) (-688.303) (-709.354) * [-694.427] (-686.878) (-701.745) (-694.162) -- 0:01:10
      14500 -- (-689.349) (-687.065) [-687.746] (-693.897) * (-704.554) (-689.370) [-696.620] (-698.021) -- 0:01:07
      15000 -- [-689.141] (-689.049) (-688.849) (-696.208) * [-692.885] (-688.003) (-699.981) (-699.873) -- 0:01:05

      Average standard deviation of split frequencies: 0.078076

      15500 -- (-689.989) [-689.267] (-689.159) (-696.835) * (-693.666) (-688.223) (-704.667) [-698.341] -- 0:01:03
      16000 -- (-692.973) [-687.031] (-687.217) (-702.545) * (-693.936) [-688.418] (-704.565) (-691.269) -- 0:01:01
      16500 -- (-687.864) (-687.373) [-689.639] (-700.615) * (-700.301) (-688.797) (-713.521) [-697.012] -- 0:01:59
      17000 -- (-688.284) [-689.705] (-689.007) (-703.159) * (-694.534) (-687.571) (-695.098) [-695.893] -- 0:01:55
      17500 -- [-687.119] (-690.345) (-687.823) (-695.515) * (-693.772) (-688.928) (-699.927) [-699.875] -- 0:01:52
      18000 -- [-686.098] (-690.719) (-691.589) (-691.867) * (-694.162) (-686.490) [-696.567] (-700.297) -- 0:01:49
      18500 -- (-689.759) [-688.078] (-689.576) (-697.318) * (-700.301) [-687.606] (-698.979) (-704.275) -- 0:01:46
      19000 -- (-689.727) (-687.007) [-688.894] (-698.010) * (-692.603) (-686.757) (-700.873) [-692.588] -- 0:01:43
      19500 -- [-687.910] (-688.687) (-686.817) (-706.247) * (-697.509) (-686.583) [-695.773] (-698.093) -- 0:01:40
      20000 -- (-689.060) (-690.854) [-686.861] (-700.599) * (-699.455) (-686.446) [-695.614] (-695.672) -- 0:01:38

      Average standard deviation of split frequencies: 0.049421

      20500 -- [-688.474] (-688.114) (-687.864) (-699.182) * (-696.443) (-686.738) (-696.379) [-696.908] -- 0:01:35
      21000 -- (-690.005) (-686.354) [-688.881] (-694.918) * [-695.207] (-690.667) (-695.999) (-695.508) -- 0:01:33
      21500 -- (-687.716) (-686.068) [-689.410] (-702.287) * (-696.567) (-687.483) [-702.971] (-691.691) -- 0:01:31
      22000 -- (-687.868) [-686.335] (-690.777) (-705.436) * (-700.349) [-687.400] (-694.374) (-695.309) -- 0:01:28
      22500 -- (-688.690) (-688.312) [-688.270] (-707.974) * (-700.586) [-687.414] (-704.724) (-694.826) -- 0:01:26
      23000 -- (-687.296) [-688.385] (-689.361) (-698.701) * (-698.487) (-689.161) (-695.492) [-694.466] -- 0:01:24
      23500 -- [-687.817] (-689.287) (-688.599) (-697.554) * [-694.713] (-690.031) (-704.012) (-692.839) -- 0:01:23
      24000 -- (-690.452) [-687.971] (-690.650) (-696.228) * (-698.558) (-688.971) (-703.034) [-696.519] -- 0:01:21
      24500 -- (-688.215) [-689.192] (-690.931) (-708.889) * [-702.994] (-688.398) (-687.490) (-697.734) -- 0:01:19
      25000 -- (-687.800) [-687.271] (-687.419) (-703.195) * (-704.067) (-687.572) [-687.546] (-695.740) -- 0:01:18

      Average standard deviation of split frequencies: 0.041780

      25500 -- [-686.312] (-688.246) (-688.307) (-687.893) * (-700.972) (-688.091) [-689.257] (-699.563) -- 0:01:16
      26000 -- (-688.328) (-687.938) (-689.781) [-689.062] * [-698.203] (-687.654) (-686.292) (-694.811) -- 0:01:14
      26500 -- (-688.773) [-689.091] (-690.011) (-693.480) * (-695.613) [-686.860] (-687.753) (-696.166) -- 0:01:13
      27000 -- (-689.746) [-690.689] (-688.968) (-692.862) * [-692.760] (-689.414) (-686.997) (-701.919) -- 0:01:12
      27500 -- (-689.982) [-689.220] (-688.342) (-695.182) * [-702.102] (-688.480) (-688.159) (-698.956) -- 0:01:10
      28000 -- (-690.895) (-688.245) (-688.525) [-689.884] * (-703.474) (-690.565) (-687.569) [-695.785] -- 0:01:09
      28500 -- (-691.209) [-687.240] (-687.754) (-688.090) * [-702.529] (-689.662) (-687.497) (-697.059) -- 0:01:08
      29000 -- (-687.366) [-687.380] (-689.130) (-689.110) * [-695.334] (-693.544) (-687.387) (-699.641) -- 0:01:06
      29500 -- (-688.857) (-688.049) [-689.413] (-690.443) * (-705.327) (-689.134) (-687.184) [-697.861] -- 0:01:05
      30000 -- [-689.104] (-688.206) (-686.905) (-689.202) * [-696.868] (-688.453) (-687.894) (-700.741) -- 0:01:04

      Average standard deviation of split frequencies: 0.043041

      30500 -- (-687.100) (-687.702) (-686.202) [-688.163] * (-694.675) (-688.582) (-691.047) [-696.006] -- 0:01:03
      31000 -- (-687.534) (-687.254) (-687.092) [-686.427] * [-695.859] (-687.131) (-687.229) (-702.467) -- 0:01:02
      31500 -- [-688.227] (-689.034) (-686.442) (-690.255) * [-692.900] (-687.343) (-687.400) (-695.628) -- 0:01:01
      32000 -- (-692.727) (-691.798) (-688.970) [-687.783] * (-697.303) (-686.972) [-687.968] (-699.448) -- 0:01:00
      32500 -- (-688.582) [-689.978] (-688.065) (-687.530) * [-693.331] (-687.659) (-687.073) (-696.506) -- 0:00:59
      33000 -- (-686.703) [-686.300] (-688.698) (-687.499) * (-691.405) [-686.437] (-689.680) (-701.402) -- 0:01:27
      33500 -- (-689.853) [-687.370] (-687.159) (-688.012) * (-692.620) (-686.003) (-689.408) [-694.755] -- 0:01:26
      34000 -- (-686.682) [-691.860] (-689.977) (-690.478) * (-697.586) (-687.588) [-686.977] (-696.148) -- 0:01:25
      34500 -- (-687.731) (-690.359) [-689.493] (-692.631) * [-689.904] (-686.568) (-688.641) (-702.495) -- 0:01:23
      35000 -- [-687.757] (-689.592) (-689.023) (-688.504) * (-699.691) [-688.127] (-690.592) (-695.860) -- 0:01:22

      Average standard deviation of split frequencies: 0.034662

      35500 -- (-687.364) (-688.552) [-687.852] (-694.451) * [-695.978] (-688.822) (-690.631) (-699.800) -- 0:01:21
      36000 -- (-689.263) (-691.290) [-687.748] (-689.135) * (-701.840) [-686.216] (-689.697) (-705.395) -- 0:01:20
      36500 -- (-688.064) (-687.718) [-690.001] (-689.535) * (-702.541) (-688.098) (-688.238) [-699.009] -- 0:01:19
      37000 -- (-686.700) [-686.230] (-687.225) (-687.638) * (-699.986) (-691.650) (-690.656) [-698.103] -- 0:01:18
      37500 -- (-686.279) (-688.260) (-686.200) [-692.989] * (-699.278) (-692.100) (-688.547) [-698.579] -- 0:01:17
      38000 -- [-687.939] (-687.837) (-691.310) (-686.549) * [-693.004] (-689.768) (-688.448) (-699.014) -- 0:01:15
      38500 -- (-687.103) [-686.756] (-692.351) (-690.530) * (-692.322) (-689.810) (-686.836) [-696.105] -- 0:01:14
      39000 -- (-687.174) [-690.208] (-691.021) (-691.011) * (-705.180) (-687.890) (-686.164) [-694.975] -- 0:01:13
      39500 -- [-689.177] (-689.041) (-691.490) (-690.104) * [-697.088] (-689.285) (-687.742) (-697.950) -- 0:01:12
      40000 -- [-689.177] (-690.161) (-689.348) (-690.639) * (-702.613) (-686.390) (-686.416) [-692.237] -- 0:01:12

      Average standard deviation of split frequencies: 0.036708

      40500 -- [-688.090] (-689.369) (-689.221) (-689.262) * (-691.569) (-689.563) (-688.698) [-690.864] -- 0:01:11
      41000 -- (-689.872) [-689.232] (-688.767) (-688.099) * (-702.127) (-686.987) (-688.884) [-699.414] -- 0:01:10
      41500 -- (-687.880) [-689.027] (-689.801) (-687.051) * (-693.839) (-686.909) (-688.198) [-695.354] -- 0:01:09
      42000 -- (-689.960) [-688.295] (-691.567) (-688.111) * (-700.435) [-686.792] (-687.766) (-695.602) -- 0:01:08
      42500 -- (-688.548) [-687.520] (-689.414) (-687.841) * (-708.663) (-688.554) [-686.901] (-693.245) -- 0:01:07
      43000 -- (-690.599) (-687.468) (-688.467) [-687.652] * (-697.785) [-688.711] (-688.445) (-702.136) -- 0:01:06
      43500 -- (-690.370) [-690.991] (-687.579) (-687.362) * [-704.104] (-688.037) (-687.935) (-698.597) -- 0:01:05
      44000 -- (-688.057) (-692.064) (-693.206) [-687.069] * (-693.664) [-690.165] (-687.159) (-697.840) -- 0:01:05
      44500 -- [-689.257] (-687.387) (-694.029) (-687.166) * (-699.201) [-687.805] (-686.665) (-700.039) -- 0:01:04
      45000 -- (-690.811) (-688.057) (-689.195) [-690.550] * (-698.345) [-686.904] (-689.633) (-702.569) -- 0:01:03

      Average standard deviation of split frequencies: 0.036600

      45500 -- (-687.703) (-689.511) (-691.176) [-688.308] * [-698.211] (-688.393) (-686.256) (-692.041) -- 0:01:02
      46000 -- (-689.996) (-689.890) (-688.900) [-687.455] * (-694.452) (-689.847) [-686.086] (-692.110) -- 0:01:02
      46500 -- (-692.984) (-692.842) [-689.535] (-687.040) * (-703.954) (-689.046) [-690.161] (-696.095) -- 0:01:01
      47000 -- (-695.020) (-688.705) [-688.676] (-690.379) * (-696.896) (-689.023) [-686.896] (-696.781) -- 0:01:00
      47500 -- (-687.769) (-687.908) [-689.135] (-686.936) * (-692.628) (-686.515) [-689.437] (-703.996) -- 0:01:00
      48000 -- (-688.664) (-690.256) [-686.522] (-686.951) * (-696.132) (-687.440) (-688.681) [-694.430] -- 0:01:19
      48500 -- (-688.604) [-690.269] (-686.618) (-689.878) * (-697.624) (-691.018) [-689.307] (-686.559) -- 0:01:18
      49000 -- (-692.123) (-694.734) (-687.069) [-688.061] * [-696.427] (-693.484) (-688.253) (-687.368) -- 0:01:17
      49500 -- (-690.740) (-692.436) (-689.175) [-687.422] * [-705.293] (-694.484) (-688.304) (-687.517) -- 0:01:16
      50000 -- [-687.873] (-688.517) (-691.103) (-687.296) * [-697.200] (-690.320) (-686.522) (-686.893) -- 0:01:16

      Average standard deviation of split frequencies: 0.035444

      50500 -- (-687.100) (-687.993) (-689.652) [-690.052] * (-694.922) [-691.940] (-687.604) (-686.493) -- 0:01:15
      51000 -- [-688.794] (-687.986) (-686.853) (-687.246) * [-690.770] (-686.949) (-686.831) (-686.233) -- 0:01:14
      51500 -- (-689.857) [-691.136] (-688.044) (-689.387) * (-699.107) (-692.025) (-688.333) [-687.541] -- 0:01:13
      52000 -- (-688.320) (-692.520) [-687.033] (-687.949) * (-699.080) (-686.144) [-687.015] (-687.057) -- 0:01:12
      52500 -- (-687.892) [-689.406] (-687.263) (-687.502) * [-692.174] (-687.535) (-688.119) (-686.772) -- 0:01:12
      53000 -- [-688.017] (-688.373) (-689.148) (-688.260) * [-696.970] (-686.146) (-687.902) (-687.007) -- 0:01:11
      53500 -- [-686.961] (-690.586) (-687.126) (-688.641) * (-696.327) [-686.235] (-687.188) (-688.647) -- 0:01:10
      54000 -- (-688.403) (-689.007) (-687.822) [-690.804] * [-691.568] (-687.408) (-687.084) (-686.219) -- 0:01:10
      54500 -- (-688.490) [-687.755] (-690.119) (-686.893) * (-696.172) (-686.477) (-687.358) [-687.296] -- 0:01:09
      55000 -- (-693.400) (-687.286) (-691.022) [-689.625] * (-698.249) (-687.146) (-686.402) [-688.791] -- 0:01:08

      Average standard deviation of split frequencies: 0.028461

      55500 -- [-691.053] (-691.038) (-688.278) (-687.243) * [-695.444] (-687.626) (-689.232) (-686.287) -- 0:01:08
      56000 -- (-688.922) (-692.033) [-688.283] (-689.360) * (-705.502) (-687.270) [-689.567] (-690.499) -- 0:01:07
      56500 -- (-688.671) [-686.996] (-688.209) (-686.953) * (-714.229) (-692.384) [-687.644] (-687.557) -- 0:01:06
      57000 -- (-687.913) (-688.315) (-687.790) [-689.978] * [-692.563] (-688.917) (-686.607) (-690.493) -- 0:01:06
      57500 -- (-689.113) (-686.853) (-688.298) [-687.669] * (-688.955) (-691.532) (-686.096) [-687.776] -- 0:01:05
      58000 -- (-687.670) (-687.008) [-688.745] (-690.901) * (-691.773) [-687.872] (-687.942) (-692.999) -- 0:01:04
      58500 -- (-689.029) [-688.005] (-688.524) (-686.866) * (-687.307) (-686.725) [-688.577] (-686.629) -- 0:01:04
      59000 -- (-689.183) (-689.507) [-689.056] (-690.963) * [-686.536] (-690.554) (-690.040) (-686.963) -- 0:01:03
      59500 -- (-687.264) (-691.118) [-687.551] (-690.915) * (-687.940) [-688.497] (-693.128) (-686.990) -- 0:01:03
      60000 -- (-688.344) [-686.025] (-687.127) (-689.790) * (-688.278) (-687.842) [-690.656] (-689.645) -- 0:01:02

      Average standard deviation of split frequencies: 0.020448

      60500 -- (-690.569) (-690.402) (-688.287) [-687.116] * (-690.190) (-689.120) (-688.514) [-687.125] -- 0:01:02
      61000 -- [-689.493] (-690.332) (-689.448) (-687.213) * (-688.612) (-690.886) [-686.324] (-686.660) -- 0:01:01
      61500 -- (-688.779) (-688.161) (-690.008) [-687.257] * (-688.110) (-689.700) (-688.003) [-687.597] -- 0:01:01
      62000 -- (-687.285) (-687.976) (-689.477) [-688.235] * (-687.115) [-689.593] (-694.939) (-691.221) -- 0:01:00
      62500 -- [-687.692] (-690.171) (-687.225) (-686.912) * (-686.695) (-687.161) (-693.040) [-688.247] -- 0:01:00
      63000 -- (-688.037) [-689.659] (-687.003) (-688.829) * (-686.753) (-688.837) (-688.459) [-689.114] -- 0:00:59
      63500 -- (-689.983) (-690.535) (-686.620) [-687.604] * (-686.330) [-689.361] (-686.373) (-690.116) -- 0:00:58
      64000 -- (-687.759) (-687.209) [-691.539] (-687.331) * (-687.681) (-688.702) (-688.330) [-687.602] -- 0:00:58
      64500 -- (-686.620) (-687.415) (-689.029) [-687.156] * (-690.014) (-686.960) (-688.567) [-691.405] -- 0:01:12
      65000 -- (-689.505) (-689.378) (-688.242) [-687.103] * (-688.253) [-688.093] (-688.640) (-690.634) -- 0:01:11

      Average standard deviation of split frequencies: 0.020747

      65500 -- (-688.073) (-688.992) (-686.957) [-687.249] * (-688.151) (-688.141) (-690.194) [-691.471] -- 0:01:11
      66000 -- (-689.260) (-691.433) [-688.113] (-690.835) * (-687.132) (-688.077) [-687.253] (-695.204) -- 0:01:10
      66500 -- (-686.962) (-687.427) (-688.353) [-687.870] * [-689.333] (-689.133) (-693.913) (-692.170) -- 0:01:10
      67000 -- (-692.418) [-691.568] (-688.999) (-687.583) * [-688.780] (-688.156) (-687.220) (-687.155) -- 0:01:09
      67500 -- (-689.787) (-693.737) (-686.306) [-689.425] * [-688.574] (-688.546) (-686.903) (-688.767) -- 0:01:09
      68000 -- (-688.262) [-687.585] (-688.351) (-690.548) * [-686.974] (-688.678) (-688.583) (-692.222) -- 0:01:08
      68500 -- (-688.872) (-688.085) (-687.146) [-690.249] * (-687.567) (-688.456) (-686.629) [-687.397] -- 0:01:07
      69000 -- (-688.096) [-686.778] (-686.667) (-688.589) * (-688.901) (-694.169) (-690.582) [-689.116] -- 0:01:07
      69500 -- (-690.443) (-686.270) [-688.890] (-690.049) * (-689.281) (-687.934) [-688.581] (-691.147) -- 0:01:06
      70000 -- (-691.431) (-689.688) (-689.745) [-689.106] * (-690.479) [-687.898] (-690.184) (-688.288) -- 0:01:06

      Average standard deviation of split frequencies: 0.017471

      70500 -- (-690.070) (-689.508) (-687.958) [-688.669] * (-688.680) (-686.933) [-687.362] (-688.148) -- 0:01:05
      71000 -- [-690.606] (-687.678) (-687.179) (-689.914) * [-686.995] (-687.010) (-687.676) (-688.246) -- 0:01:05
      71500 -- (-688.904) (-689.187) (-689.875) [-687.659] * (-687.153) (-687.002) (-686.215) [-686.608] -- 0:01:04
      72000 -- [-688.092] (-687.271) (-688.849) (-688.054) * [-686.650] (-687.207) (-687.212) (-688.787) -- 0:01:04
      72500 -- (-686.346) [-687.908] (-686.912) (-689.967) * (-687.647) (-689.221) [-688.379] (-687.758) -- 0:01:03
      73000 -- (-691.344) (-686.723) (-690.825) [-686.553] * [-691.088] (-692.486) (-688.426) (-689.588) -- 0:01:03
      73500 -- (-687.497) [-686.947] (-687.760) (-686.586) * (-687.931) (-693.046) [-691.503] (-686.943) -- 0:01:03
      74000 -- (-686.899) (-688.442) [-688.386] (-689.857) * (-691.248) [-686.835] (-690.792) (-686.872) -- 0:01:02
      74500 -- (-687.145) (-689.400) (-688.397) [-687.810] * [-687.287] (-689.599) (-687.478) (-687.222) -- 0:01:02
      75000 -- (-686.833) (-689.787) (-688.435) [-689.056] * (-686.958) (-689.390) (-687.293) [-686.818] -- 0:01:01

      Average standard deviation of split frequencies: 0.015817

      75500 -- (-687.423) (-686.719) [-690.154] (-686.659) * (-692.790) [-691.183] (-687.508) (-686.571) -- 0:01:01
      76000 -- (-689.714) [-687.942] (-686.775) (-688.684) * (-688.614) (-691.170) (-689.533) [-688.001] -- 0:01:00
      76500 -- (-690.215) (-688.022) (-686.643) [-687.463] * [-687.074] (-690.017) (-687.632) (-690.407) -- 0:01:00
      77000 -- (-688.072) (-686.258) (-690.062) [-687.125] * (-687.507) (-692.261) [-686.461] (-688.500) -- 0:00:59
      77500 -- (-686.875) (-691.061) [-687.712] (-689.369) * (-687.265) (-692.102) [-690.914] (-692.560) -- 0:00:59
      78000 -- (-686.546) [-689.861] (-687.258) (-693.050) * (-689.421) [-687.848] (-687.584) (-691.264) -- 0:00:59
      78500 -- [-688.185] (-687.687) (-690.589) (-686.612) * (-691.175) (-686.736) [-687.466] (-689.582) -- 0:00:58
      79000 -- (-690.677) (-686.698) (-688.513) [-689.175] * (-688.383) (-686.582) [-686.548] (-688.022) -- 0:00:58
      79500 -- (-688.632) [-687.089] (-693.478) (-687.653) * (-688.654) (-686.965) (-687.270) [-688.211] -- 0:00:57
      80000 -- (-690.020) [-686.507] (-687.801) (-686.692) * (-689.216) (-690.599) [-688.839] (-689.583) -- 0:00:57

      Average standard deviation of split frequencies: 0.020300

      80500 -- (-689.496) (-686.862) [-689.152] (-688.382) * [-692.884] (-686.452) (-688.379) (-691.171) -- 0:01:08
      81000 -- (-690.259) (-689.481) [-691.314] (-687.583) * (-690.713) (-689.622) [-687.921] (-688.451) -- 0:01:08
      81500 -- (-689.118) [-689.099] (-689.270) (-688.755) * [-687.743] (-691.419) (-688.106) (-687.556) -- 0:01:07
      82000 -- (-690.633) [-686.575] (-691.725) (-687.029) * (-686.792) (-686.839) [-686.744] (-691.771) -- 0:01:07
      82500 -- [-689.396] (-689.229) (-688.273) (-689.180) * (-687.209) (-693.545) (-687.519) [-688.198] -- 0:01:06
      83000 -- (-688.087) [-691.127] (-689.521) (-688.124) * (-686.950) [-687.724] (-689.275) (-689.050) -- 0:01:06
      83500 -- (-687.406) (-687.586) (-687.816) [-686.947] * [-686.436] (-687.180) (-687.991) (-688.057) -- 0:01:05
      84000 -- (-690.534) [-688.440] (-687.531) (-688.700) * (-687.003) [-687.302] (-689.085) (-692.508) -- 0:01:05
      84500 -- (-688.949) (-687.633) (-687.799) [-688.244] * (-686.457) (-691.058) [-686.359] (-688.835) -- 0:01:05
      85000 -- (-689.078) [-686.874] (-691.520) (-688.679) * (-688.331) (-689.167) (-687.609) [-688.899] -- 0:01:04

      Average standard deviation of split frequencies: 0.019459

      85500 -- [-687.689] (-689.428) (-689.473) (-687.937) * (-688.662) [-688.393] (-686.278) (-687.819) -- 0:01:04
      86000 -- (-686.911) [-691.087] (-687.613) (-689.091) * (-687.035) (-688.234) [-687.179] (-688.043) -- 0:01:03
      86500 -- [-686.865] (-689.655) (-690.335) (-688.307) * (-687.242) (-688.628) [-687.902] (-689.490) -- 0:01:03
      87000 -- (-688.722) [-686.253] (-690.412) (-689.979) * (-688.788) (-689.007) (-688.985) [-686.892] -- 0:01:02
      87500 -- [-690.427] (-686.368) (-689.775) (-690.820) * [-687.199] (-688.024) (-688.268) (-687.966) -- 0:01:02
      88000 -- [-690.620] (-687.443) (-692.710) (-690.960) * (-686.720) (-692.336) (-692.404) [-686.546] -- 0:01:02
      88500 -- (-690.269) [-686.154] (-691.245) (-689.915) * [-687.411] (-688.260) (-688.912) (-687.932) -- 0:01:01
      89000 -- (-686.108) (-686.538) (-688.090) [-687.621] * (-686.477) [-688.671] (-691.724) (-690.180) -- 0:01:01
      89500 -- (-687.891) [-690.059] (-691.551) (-686.517) * [-686.566] (-688.604) (-693.304) (-687.305) -- 0:01:01
      90000 -- (-690.843) (-689.657) [-690.102] (-690.530) * [-688.523] (-688.094) (-690.886) (-687.940) -- 0:01:00

      Average standard deviation of split frequencies: 0.021953

      90500 -- [-687.966] (-688.174) (-689.282) (-687.517) * (-690.181) (-687.669) (-687.304) [-689.252] -- 0:01:00
      91000 -- (-688.391) [-689.410] (-690.761) (-687.724) * (-691.575) (-689.394) (-688.046) [-687.834] -- 0:00:59
      91500 -- (-686.699) (-687.777) (-690.065) [-690.597] * [-688.374] (-687.402) (-687.675) (-694.163) -- 0:00:59
      92000 -- [-687.536] (-686.785) (-689.376) (-686.862) * (-690.071) (-687.457) (-687.745) [-686.102] -- 0:00:59
      92500 -- [-689.861] (-687.267) (-687.497) (-687.166) * [-689.865] (-688.873) (-689.516) (-691.246) -- 0:00:58
      93000 -- (-687.912) (-688.397) (-686.764) [-688.442] * (-689.556) (-690.062) (-687.621) [-686.469] -- 0:00:58
      93500 -- (-688.557) (-693.310) (-687.521) [-687.651] * (-690.761) (-691.719) (-690.500) [-688.734] -- 0:00:58
      94000 -- (-686.983) (-691.197) (-687.929) [-687.111] * (-688.400) (-693.158) [-687.225] (-687.530) -- 0:00:57
      94500 -- (-688.430) (-687.973) [-689.213] (-687.141) * (-688.924) [-686.900] (-687.747) (-687.063) -- 0:00:57
      95000 -- (-687.967) (-688.746) [-686.568] (-689.109) * [-686.822] (-687.523) (-688.026) (-687.389) -- 0:00:57

      Average standard deviation of split frequencies: 0.021953

      95500 -- [-688.198] (-690.930) (-686.148) (-688.563) * (-688.926) (-688.688) [-687.339] (-687.289) -- 0:00:56
      96000 -- [-689.960] (-692.026) (-694.166) (-691.768) * (-689.840) [-687.379] (-688.648) (-689.582) -- 0:00:56
      96500 -- [-687.454] (-688.401) (-689.491) (-691.230) * (-686.198) [-687.385] (-687.071) (-687.480) -- 0:00:56
      97000 -- (-688.475) (-689.606) (-689.957) [-689.445] * (-686.653) (-687.630) (-687.104) [-687.439] -- 0:01:05
      97500 -- (-688.626) [-687.722] (-688.035) (-688.104) * [-686.441] (-689.810) (-688.427) (-687.004) -- 0:01:04
      98000 -- (-689.513) (-689.136) (-687.480) [-687.252] * (-688.813) (-690.717) [-689.769] (-688.315) -- 0:01:04
      98500 -- (-687.953) (-687.978) (-688.050) [-688.564] * [-688.625] (-687.700) (-687.137) (-688.073) -- 0:01:04
      99000 -- (-688.185) (-686.993) [-687.134] (-688.228) * (-692.615) (-687.440) [-687.177] (-687.914) -- 0:01:03
      99500 -- (-694.568) (-687.564) [-686.931] (-687.431) * (-692.368) [-688.952] (-688.717) (-689.695) -- 0:01:03
      100000 -- (-689.620) [-687.578] (-688.453) (-687.326) * (-695.699) [-689.489] (-689.438) (-689.710) -- 0:01:02

      Average standard deviation of split frequencies: 0.025618

      100500 -- (-692.009) (-689.205) [-688.818] (-688.677) * [-691.621] (-686.025) (-690.521) (-689.117) -- 0:01:02
      101000 -- [-689.997] (-687.191) (-687.365) (-690.411) * (-688.174) (-689.317) (-692.361) [-689.389] -- 0:01:02
      101500 -- (-691.758) (-686.798) (-687.264) [-686.951] * (-688.057) (-686.525) (-691.551) [-687.366] -- 0:01:01
      102000 -- (-689.934) (-686.623) [-688.090] (-687.696) * (-688.010) (-687.025) [-687.457] (-686.351) -- 0:01:01
      102500 -- (-691.530) (-688.379) [-688.322] (-690.001) * [-687.148] (-688.806) (-688.745) (-686.392) -- 0:01:01
      103000 -- (-687.701) (-689.396) [-686.887] (-687.650) * (-687.916) (-688.754) [-689.269] (-689.464) -- 0:01:00
      103500 -- (-688.331) (-688.014) [-686.777] (-691.234) * (-687.947) (-688.742) (-691.351) [-686.830] -- 0:01:00
      104000 -- (-688.669) [-688.425] (-690.107) (-689.852) * (-688.351) (-690.066) [-690.251] (-687.033) -- 0:01:00
      104500 -- (-687.367) [-688.416] (-688.568) (-687.096) * [-688.972] (-690.283) (-689.300) (-687.360) -- 0:00:59
      105000 -- (-689.818) (-689.454) (-688.132) [-691.831] * [-688.132] (-688.840) (-689.983) (-687.497) -- 0:00:59

      Average standard deviation of split frequencies: 0.021534

      105500 -- (-689.764) (-689.404) (-688.864) [-688.489] * (-686.023) (-687.657) [-688.252] (-688.695) -- 0:00:59
      106000 -- (-688.740) [-687.512] (-691.544) (-688.354) * (-687.469) [-688.970] (-688.000) (-690.040) -- 0:00:59
      106500 -- (-690.416) (-692.325) [-692.474] (-688.246) * (-690.738) [-690.398] (-688.761) (-693.630) -- 0:00:58
      107000 -- (-693.219) (-691.513) (-686.471) [-688.215] * (-689.359) (-687.617) (-690.343) [-687.817] -- 0:00:58
      107500 -- (-690.726) (-690.687) (-686.632) [-688.550] * (-690.159) (-686.992) (-687.434) [-687.405] -- 0:00:58
      108000 -- (-688.599) [-687.375] (-688.769) (-691.795) * (-686.476) (-686.153) (-687.104) [-687.155] -- 0:00:57
      108500 -- (-687.730) (-687.817) (-688.316) [-690.572] * (-689.092) [-686.622] (-686.270) (-686.405) -- 0:00:57
      109000 -- (-688.012) (-694.040) [-686.923] (-689.083) * (-687.526) [-686.934] (-687.557) (-686.800) -- 0:00:57
      109500 -- [-687.862] (-689.268) (-689.881) (-692.709) * [-687.490] (-686.768) (-687.241) (-688.737) -- 0:00:56
      110000 -- (-687.163) [-689.229] (-689.072) (-692.168) * (-690.086) (-689.997) (-689.749) [-690.438] -- 0:00:56

      Average standard deviation of split frequencies: 0.019056

      110500 -- (-693.415) (-686.833) [-687.992] (-688.640) * [-689.770] (-687.287) (-687.078) (-688.464) -- 0:00:56
      111000 -- (-686.486) [-687.164] (-688.461) (-689.581) * (-689.000) (-687.882) [-688.071] (-688.195) -- 0:00:56
      111500 -- (-687.754) (-687.042) (-689.008) [-687.947] * (-690.850) [-687.104] (-689.526) (-688.011) -- 0:00:55
      112000 -- (-686.521) (-688.127) (-688.030) [-689.292] * (-694.088) [-687.776] (-688.484) (-687.420) -- 0:00:55
      112500 -- (-686.783) (-689.660) (-687.889) [-690.295] * (-692.579) (-690.414) (-687.998) [-689.766] -- 0:00:55
      113000 -- (-690.448) (-691.870) (-690.335) [-687.534] * (-691.621) (-691.018) (-690.122) [-688.143] -- 0:01:02
      113500 -- (-693.478) (-686.941) (-691.706) [-688.834] * (-690.217) (-692.290) (-693.753) [-690.505] -- 0:01:02
      114000 -- (-688.824) [-690.083] (-687.832) (-686.830) * [-686.812] (-686.098) (-691.982) (-688.745) -- 0:01:02
      114500 -- [-687.024] (-688.498) (-687.520) (-690.821) * (-690.543) [-686.813] (-690.196) (-689.542) -- 0:01:01
      115000 -- [-686.223] (-686.835) (-686.782) (-687.699) * (-688.662) (-688.964) [-690.386] (-688.565) -- 0:01:01

      Average standard deviation of split frequencies: 0.019464

      115500 -- [-687.060] (-687.335) (-688.169) (-688.515) * (-687.739) (-689.820) (-689.270) [-687.712] -- 0:01:01
      116000 -- (-692.174) (-688.260) [-687.207] (-689.743) * [-687.203] (-688.392) (-690.249) (-687.571) -- 0:01:00
      116500 -- (-696.500) [-686.686] (-690.289) (-689.418) * [-687.516] (-689.336) (-689.123) (-687.887) -- 0:01:00
      117000 -- (-690.183) (-689.543) (-687.643) [-688.341] * (-689.453) [-686.378] (-689.347) (-688.404) -- 0:01:00
      117500 -- [-686.499] (-687.392) (-690.928) (-686.507) * [-688.632] (-691.536) (-688.842) (-687.811) -- 0:01:00
      118000 -- [-688.927] (-692.280) (-687.152) (-690.794) * (-687.209) [-690.964] (-689.251) (-687.402) -- 0:00:59
      118500 -- (-687.514) [-690.992] (-689.847) (-689.973) * (-690.827) (-691.777) [-686.629] (-687.568) -- 0:00:59
      119000 -- [-693.717] (-689.200) (-689.185) (-690.420) * (-688.054) [-691.192] (-686.122) (-686.819) -- 0:00:59
      119500 -- (-689.577) (-694.607) [-687.249] (-687.366) * (-689.699) (-689.052) [-688.174] (-687.593) -- 0:00:58
      120000 -- [-687.243] (-687.753) (-693.450) (-687.441) * [-688.687] (-691.177) (-687.186) (-687.352) -- 0:00:58

      Average standard deviation of split frequencies: 0.017695

      120500 -- (-687.649) (-688.106) (-690.747) [-687.782] * (-686.573) [-686.965] (-687.816) (-687.266) -- 0:00:58
      121000 -- (-691.612) [-687.578] (-688.575) (-686.702) * (-689.117) (-687.990) [-687.438] (-687.124) -- 0:00:58
      121500 -- (-688.591) [-687.599] (-687.763) (-688.727) * [-689.268] (-687.942) (-686.995) (-689.385) -- 0:00:57
      122000 -- [-688.710] (-688.228) (-689.173) (-693.139) * [-690.402] (-687.387) (-689.165) (-694.213) -- 0:00:57
      122500 -- (-689.185) (-688.536) [-688.011] (-693.698) * (-689.823) [-688.796] (-690.048) (-686.915) -- 0:00:57
      123000 -- (-687.713) (-693.127) (-688.856) [-688.567] * [-689.330] (-692.073) (-687.305) (-687.630) -- 0:00:57
      123500 -- (-688.519) [-690.213] (-688.146) (-687.819) * (-687.370) (-688.811) [-686.412] (-686.409) -- 0:00:56
      124000 -- (-689.110) (-689.586) [-688.519] (-688.348) * [-690.244] (-690.424) (-688.542) (-689.517) -- 0:00:56
      124500 -- (-690.224) (-688.401) (-690.575) [-687.871] * (-689.321) (-689.843) (-688.811) [-690.364] -- 0:00:56
      125000 -- (-686.783) (-690.977) (-686.782) [-686.635] * (-690.687) (-688.985) [-688.484] (-688.545) -- 0:00:56

      Average standard deviation of split frequencies: 0.018885

      125500 -- [-688.463] (-686.600) (-688.067) (-687.412) * (-690.639) [-686.079] (-689.907) (-691.101) -- 0:00:55
      126000 -- (-689.836) [-689.983] (-686.681) (-688.456) * [-686.361] (-686.848) (-689.730) (-688.085) -- 0:00:55
      126500 -- (-691.673) (-690.298) (-687.111) [-692.383] * (-694.805) (-686.970) (-688.019) [-692.531] -- 0:00:55
      127000 -- (-689.504) [-688.304] (-686.514) (-691.504) * (-688.751) (-687.204) [-688.970] (-692.487) -- 0:00:54
      127500 -- (-692.441) [-687.515] (-688.982) (-688.377) * [-686.668] (-690.182) (-688.609) (-688.961) -- 0:00:54
      128000 -- (-686.634) (-689.420) (-688.097) [-688.631] * (-687.970) [-693.171] (-687.209) (-691.279) -- 0:00:54
      128500 -- [-687.058] (-692.824) (-687.540) (-686.582) * (-688.756) (-692.362) [-686.996] (-689.037) -- 0:00:54
      129000 -- [-686.612] (-689.951) (-687.364) (-689.018) * (-688.395) [-689.223] (-689.161) (-686.680) -- 0:00:54
      129500 -- (-686.904) (-686.774) [-688.556] (-689.428) * [-688.873] (-687.759) (-689.062) (-690.343) -- 0:01:00
      130000 -- (-689.048) (-694.792) [-689.089] (-693.643) * [-690.978] (-692.336) (-688.800) (-689.457) -- 0:01:00

      Average standard deviation of split frequencies: 0.018418

      130500 -- [-686.751] (-688.850) (-687.722) (-687.980) * (-688.306) [-691.345] (-686.865) (-687.918) -- 0:00:59
      131000 -- [-687.966] (-695.215) (-689.412) (-688.993) * (-687.081) (-688.201) [-690.241] (-691.829) -- 0:00:59
      131500 -- [-687.805] (-692.255) (-687.311) (-688.333) * [-686.425] (-687.876) (-687.413) (-693.417) -- 0:00:59
      132000 -- [-687.865] (-687.121) (-687.171) (-688.388) * (-688.338) [-687.525] (-686.477) (-691.981) -- 0:00:59
      132500 -- [-688.387] (-686.512) (-687.126) (-687.540) * (-690.512) [-689.140] (-687.997) (-689.796) -- 0:00:58
      133000 -- (-687.388) (-690.839) [-688.783] (-689.102) * [-688.809] (-687.726) (-690.223) (-692.500) -- 0:00:58
      133500 -- [-686.485] (-687.881) (-688.806) (-690.100) * (-689.401) [-689.098] (-690.427) (-693.250) -- 0:00:58
      134000 -- (-687.138) (-690.802) [-687.754] (-686.417) * [-688.763] (-690.467) (-686.963) (-687.331) -- 0:00:58
      134500 -- (-687.617) [-687.012] (-688.425) (-688.335) * (-689.439) (-694.061) (-689.693) [-688.006] -- 0:00:57
      135000 -- (-688.410) (-686.871) [-687.006] (-688.611) * (-691.129) (-689.381) [-688.302] (-688.225) -- 0:00:57

      Average standard deviation of split frequencies: 0.017878

      135500 -- [-689.334] (-688.688) (-686.977) (-686.764) * (-687.459) (-687.673) [-689.288] (-689.084) -- 0:00:57
      136000 -- [-688.082] (-690.143) (-688.528) (-689.847) * [-688.916] (-690.522) (-688.283) (-690.067) -- 0:00:57
      136500 -- (-693.545) (-687.171) [-690.174] (-694.565) * (-692.629) (-689.194) [-687.114] (-691.148) -- 0:00:56
      137000 -- [-686.701] (-689.469) (-689.126) (-690.046) * (-686.468) (-686.881) [-688.319] (-688.227) -- 0:00:56
      137500 -- (-687.839) [-689.921] (-688.482) (-686.745) * [-688.827] (-688.093) (-691.506) (-688.341) -- 0:00:56
      138000 -- (-687.164) [-687.801] (-690.022) (-687.640) * (-688.779) [-686.366] (-688.747) (-687.382) -- 0:00:56
      138500 -- [-688.330] (-688.186) (-688.111) (-688.071) * (-688.416) (-687.954) [-688.632] (-688.928) -- 0:00:55
      139000 -- (-687.569) (-688.162) (-687.987) [-689.963] * (-687.644) (-688.796) (-691.474) [-686.655] -- 0:00:55
      139500 -- (-686.544) (-686.526) [-687.878] (-688.091) * (-687.044) [-688.145] (-687.542) (-687.898) -- 0:00:55
      140000 -- (-687.515) (-687.984) (-690.305) [-688.848] * (-687.250) (-688.167) [-688.327] (-687.166) -- 0:00:55

      Average standard deviation of split frequencies: 0.017150

      140500 -- (-687.987) [-688.671] (-687.601) (-690.164) * (-689.387) (-689.625) [-688.138] (-687.624) -- 0:00:55
      141000 -- (-689.745) [-688.085] (-688.188) (-690.583) * (-688.403) (-688.199) [-688.872] (-690.595) -- 0:00:54
      141500 -- [-689.566] (-687.296) (-692.536) (-690.303) * (-687.715) (-689.059) [-687.858] (-690.522) -- 0:00:54
      142000 -- (-687.140) [-688.978] (-688.247) (-686.817) * [-687.377] (-689.323) (-687.358) (-687.144) -- 0:00:54
      142500 -- (-687.379) (-687.209) (-687.427) [-686.576] * (-692.671) [-688.708] (-693.114) (-687.510) -- 0:00:54
      143000 -- (-687.111) (-687.630) (-689.219) [-688.453] * (-688.555) [-687.378] (-692.311) (-690.620) -- 0:00:53
      143500 -- (-687.721) [-687.696] (-688.563) (-688.027) * (-687.266) [-689.423] (-691.136) (-693.574) -- 0:00:53
      144000 -- (-691.715) (-686.367) (-687.178) [-687.343] * [-686.250] (-686.966) (-689.118) (-690.185) -- 0:00:53
      144500 -- (-691.461) [-686.829] (-688.321) (-688.792) * (-686.583) (-687.344) (-687.413) [-688.212] -- 0:00:53
      145000 -- (-689.930) (-686.566) [-688.849] (-687.731) * (-686.736) (-686.290) (-690.373) [-688.157] -- 0:00:53

      Average standard deviation of split frequencies: 0.017220

      145500 -- (-692.118) [-687.235] (-686.746) (-688.612) * (-686.413) [-686.956] (-690.395) (-690.659) -- 0:00:52
      146000 -- [-688.362] (-687.778) (-695.580) (-689.909) * (-689.029) [-688.550] (-692.921) (-687.070) -- 0:00:58
      146500 -- (-689.374) [-687.352] (-695.260) (-688.497) * (-693.558) (-687.363) [-687.490] (-686.849) -- 0:00:58
      147000 -- [-688.760] (-689.132) (-695.062) (-689.868) * [-688.137] (-687.812) (-687.358) (-687.304) -- 0:00:58
      147500 -- (-687.953) [-689.257] (-695.731) (-688.667) * (-687.891) (-688.098) [-687.648] (-687.640) -- 0:00:57
      148000 -- [-687.677] (-689.906) (-691.134) (-687.342) * (-691.390) (-693.232) [-688.822] (-687.013) -- 0:00:57
      148500 -- (-689.096) (-687.535) [-688.345] (-686.730) * [-688.619] (-687.950) (-688.925) (-690.350) -- 0:00:57
      149000 -- (-688.205) (-688.171) (-688.410) [-686.947] * (-688.440) (-692.175) [-689.772] (-687.666) -- 0:00:57
      149500 -- (-686.861) (-686.958) (-689.262) [-686.638] * (-689.219) (-689.556) [-687.208] (-689.252) -- 0:00:56
      150000 -- (-688.145) (-687.241) (-694.452) [-687.025] * (-688.427) (-688.884) [-687.413] (-686.995) -- 0:00:56

      Average standard deviation of split frequencies: 0.016932

      150500 -- [-687.753] (-688.900) (-692.383) (-686.511) * (-692.418) (-687.911) (-686.432) [-688.946] -- 0:00:56
      151000 -- (-688.286) (-687.052) (-687.245) [-689.540] * (-690.841) (-687.511) [-686.454] (-687.361) -- 0:00:56
      151500 -- [-690.030] (-690.338) (-689.420) (-690.846) * (-688.955) (-691.140) [-687.185] (-690.879) -- 0:00:56
      152000 -- (-687.654) (-688.915) (-687.102) [-687.025] * [-691.476] (-688.618) (-687.933) (-690.294) -- 0:00:55
      152500 -- (-688.795) (-687.452) [-690.237] (-687.620) * (-691.210) (-687.952) [-690.990] (-690.172) -- 0:00:55
      153000 -- (-686.420) (-686.197) (-688.710) [-687.634] * (-686.599) [-687.851] (-688.036) (-690.576) -- 0:00:55
      153500 -- (-686.624) [-688.265] (-687.927) (-693.445) * [-691.798] (-688.875) (-691.186) (-689.242) -- 0:00:55
      154000 -- (-686.239) (-689.704) [-688.915] (-696.040) * (-689.559) [-688.223] (-686.743) (-686.342) -- 0:00:54
      154500 -- (-688.403) (-692.786) [-689.933] (-689.158) * (-686.796) (-688.100) (-687.733) [-686.331] -- 0:00:54
      155000 -- (-691.675) (-688.858) [-687.198] (-687.640) * [-687.485] (-690.411) (-689.290) (-686.521) -- 0:00:54

      Average standard deviation of split frequencies: 0.018970

      155500 -- (-688.972) (-691.070) [-686.147] (-687.553) * (-688.982) (-687.907) (-688.149) [-687.388] -- 0:00:54
      156000 -- (-688.018) [-687.928] (-686.034) (-687.501) * (-691.858) [-687.951] (-687.296) (-687.078) -- 0:00:54
      156500 -- (-688.058) (-688.534) [-687.790] (-687.140) * (-692.119) [-688.086] (-689.458) (-687.198) -- 0:00:53
      157000 -- (-687.711) (-689.380) [-687.208] (-687.954) * (-689.708) (-686.665) (-687.679) [-687.590] -- 0:00:53
      157500 -- [-691.338] (-689.608) (-686.427) (-687.184) * (-690.495) (-689.618) [-687.017] (-689.851) -- 0:00:53
      158000 -- (-689.493) (-689.354) (-687.458) [-685.929] * (-688.891) (-696.430) [-688.688] (-690.462) -- 0:00:53
      158500 -- [-686.812] (-688.716) (-692.301) (-686.669) * (-688.776) (-706.403) [-688.160] (-689.645) -- 0:00:53
      159000 -- (-687.308) [-686.430] (-689.703) (-687.540) * [-687.930] (-705.857) (-688.491) (-688.332) -- 0:00:52
      159500 -- (-689.476) [-688.618] (-689.017) (-687.334) * [-686.513] (-695.131) (-688.700) (-689.981) -- 0:00:52
      160000 -- (-691.678) (-687.709) (-688.083) [-686.893] * (-688.705) (-687.280) [-688.381] (-690.407) -- 0:00:52

      Average standard deviation of split frequencies: 0.016137

      160500 -- (-693.813) (-689.203) (-687.923) [-687.178] * (-692.668) [-686.880] (-688.940) (-690.414) -- 0:00:52
      161000 -- (-687.465) (-687.794) [-687.216] (-687.637) * [-687.752] (-688.057) (-692.339) (-689.178) -- 0:00:52
      161500 -- [-689.432] (-687.037) (-687.344) (-687.913) * (-687.944) (-690.380) (-688.464) [-687.815] -- 0:00:51
      162000 -- (-690.099) [-686.902] (-688.110) (-688.186) * (-690.566) (-690.002) (-688.413) [-687.977] -- 0:00:51
      162500 -- (-687.671) (-686.007) [-686.630] (-689.229) * (-686.897) (-687.727) (-690.736) [-688.569] -- 0:00:56
      163000 -- (-688.498) (-691.110) [-687.943] (-692.263) * [-686.052] (-687.636) (-692.553) (-689.461) -- 0:00:56
      163500 -- [-688.460] (-691.136) (-687.210) (-690.434) * (-687.486) (-686.818) [-687.353] (-687.963) -- 0:00:56
      164000 -- [-688.844] (-688.396) (-686.181) (-691.426) * (-691.481) (-689.435) (-689.756) [-687.498] -- 0:00:56
      164500 -- [-688.009] (-687.531) (-686.377) (-688.936) * (-688.096) [-692.115] (-694.073) (-686.672) -- 0:00:55
      165000 -- (-690.836) [-686.799] (-690.404) (-695.556) * (-688.353) (-688.995) (-687.559) [-687.260] -- 0:00:55

      Average standard deviation of split frequencies: 0.015461

      165500 -- [-686.607] (-687.159) (-687.751) (-688.183) * (-690.957) (-687.337) [-686.601] (-687.216) -- 0:00:55
      166000 -- (-687.369) (-689.083) [-686.852] (-690.026) * (-689.486) [-688.019] (-687.131) (-687.317) -- 0:00:55
      166500 -- (-686.123) (-688.218) (-688.459) [-687.841] * (-689.248) (-688.597) [-689.836] (-686.362) -- 0:00:55
      167000 -- [-686.575] (-687.185) (-686.075) (-688.696) * (-688.394) (-687.170) [-687.236] (-687.421) -- 0:00:54
      167500 -- (-687.848) (-687.214) [-687.033] (-686.340) * (-690.303) (-690.219) [-687.743] (-686.325) -- 0:00:54
      168000 -- (-688.248) (-688.280) [-686.861] (-690.380) * (-689.213) (-687.403) [-689.533] (-687.496) -- 0:00:54
      168500 -- (-688.367) (-686.376) [-686.216] (-688.791) * (-689.772) (-692.428) (-687.831) [-686.890] -- 0:00:54
      169000 -- (-689.079) (-686.650) [-686.498] (-686.461) * (-687.196) (-687.431) (-687.029) [-686.283] -- 0:00:54
      169500 -- (-687.661) (-690.846) (-689.425) [-690.958] * (-687.427) (-686.747) (-689.950) [-687.014] -- 0:00:53
      170000 -- (-687.572) (-688.075) (-691.603) [-687.366] * (-689.566) [-688.076] (-686.921) (-692.234) -- 0:00:53

      Average standard deviation of split frequencies: 0.015991

      170500 -- (-690.938) (-687.131) (-691.707) [-689.797] * [-687.279] (-689.108) (-687.534) (-688.911) -- 0:00:53
      171000 -- [-689.257] (-687.358) (-691.685) (-688.956) * (-687.241) (-691.448) (-686.568) [-688.064] -- 0:00:53
      171500 -- (-688.840) [-687.741] (-689.543) (-690.457) * [-687.789] (-689.753) (-687.538) (-688.203) -- 0:00:53
      172000 -- (-689.730) (-689.710) (-692.017) [-688.729] * [-686.327] (-689.283) (-689.882) (-686.184) -- 0:00:52
      172500 -- (-687.589) (-688.548) (-687.387) [-687.905] * (-686.797) (-687.378) (-688.785) [-687.058] -- 0:00:52
      173000 -- (-686.740) (-692.280) (-686.804) [-686.463] * [-686.930] (-689.312) (-688.415) (-691.305) -- 0:00:52
      173500 -- [-689.376] (-688.428) (-691.019) (-686.560) * (-688.603) [-686.733] (-693.350) (-688.792) -- 0:00:52
      174000 -- (-690.921) (-691.544) [-686.302] (-691.475) * (-686.918) (-686.960) (-689.144) [-689.414] -- 0:00:52
      174500 -- [-689.502] (-691.050) (-689.658) (-687.357) * (-687.155) (-686.202) (-687.755) [-690.586] -- 0:00:52
      175000 -- [-695.496] (-687.778) (-688.382) (-686.496) * (-689.513) (-687.001) (-692.545) [-688.528] -- 0:00:51

      Average standard deviation of split frequencies: 0.016071

      175500 -- (-690.922) [-687.365] (-690.106) (-687.086) * (-689.265) [-689.930] (-688.804) (-689.865) -- 0:00:51
      176000 -- [-687.323] (-686.332) (-690.934) (-688.622) * (-687.560) (-692.862) (-687.383) [-688.229] -- 0:00:51
      176500 -- (-689.040) (-686.530) [-687.433] (-691.308) * (-687.020) (-688.359) (-687.080) [-686.736] -- 0:00:51
      177000 -- (-688.503) [-688.982] (-688.347) (-686.692) * (-686.758) (-688.975) [-687.371] (-686.603) -- 0:00:51
      177500 -- (-689.493) (-688.245) (-689.054) [-686.756] * (-687.713) (-689.221) [-686.535] (-695.570) -- 0:00:50
      178000 -- (-690.119) (-688.306) [-687.520] (-688.916) * [-687.889] (-687.410) (-688.085) (-690.689) -- 0:00:50
      178500 -- (-689.794) (-689.217) (-689.240) [-690.768] * (-690.067) (-689.701) (-687.436) [-686.344] -- 0:00:50
      179000 -- (-688.345) [-688.445] (-687.660) (-689.287) * (-687.337) (-687.689) (-687.267) [-686.877] -- 0:00:55
      179500 -- [-689.342] (-687.520) (-688.829) (-687.584) * [-687.145] (-686.326) (-690.316) (-688.660) -- 0:00:54
      180000 -- [-688.732] (-686.801) (-689.816) (-688.154) * (-687.661) (-688.512) (-688.328) [-687.978] -- 0:00:54

      Average standard deviation of split frequencies: 0.015656

      180500 -- (-690.547) (-686.668) [-689.306] (-687.133) * (-688.192) [-688.733] (-686.781) (-689.119) -- 0:00:54
      181000 -- [-688.472] (-687.889) (-689.061) (-688.229) * (-690.688) (-687.656) (-686.760) [-686.756] -- 0:00:54
      181500 -- (-688.733) (-689.020) [-686.149] (-691.775) * (-688.133) (-687.939) (-686.917) [-690.048] -- 0:00:54
      182000 -- (-689.459) (-687.201) [-686.674] (-689.555) * [-690.041] (-687.173) (-688.157) (-695.009) -- 0:00:53
      182500 -- (-691.051) (-686.854) (-686.828) [-688.597] * (-689.279) (-688.915) [-687.338] (-687.223) -- 0:00:53
      183000 -- (-687.815) [-688.473] (-686.764) (-688.454) * (-686.283) (-688.249) [-689.366] (-686.855) -- 0:00:53
      183500 -- (-686.333) (-687.359) (-687.008) [-686.605] * (-688.528) [-687.358] (-688.554) (-686.323) -- 0:00:53
      184000 -- (-691.609) [-687.040] (-689.692) (-687.330) * (-688.535) [-688.042] (-687.633) (-686.094) -- 0:00:53
      184500 -- (-688.741) [-688.248] (-688.197) (-693.612) * (-687.648) (-688.386) [-686.251] (-687.308) -- 0:00:53
      185000 -- (-688.178) (-691.410) (-691.750) [-689.267] * [-689.143] (-688.900) (-688.868) (-687.137) -- 0:00:52

      Average standard deviation of split frequencies: 0.012250

      185500 -- (-686.383) [-689.409] (-690.024) (-689.071) * (-689.703) (-687.683) [-689.035] (-689.479) -- 0:00:52
      186000 -- (-687.289) [-689.211] (-689.353) (-689.603) * (-689.451) (-687.290) [-687.270] (-690.775) -- 0:00:52
      186500 -- (-686.548) (-686.775) [-688.905] (-687.489) * (-686.347) [-692.710] (-689.117) (-691.193) -- 0:00:52
      187000 -- (-689.465) [-687.363] (-687.322) (-689.645) * (-686.107) [-688.437] (-694.346) (-687.250) -- 0:00:52
      187500 -- (-687.345) [-687.828] (-688.645) (-689.979) * (-686.191) [-688.098] (-691.170) (-689.303) -- 0:00:52
      188000 -- (-687.715) (-688.469) [-686.362] (-689.255) * (-687.136) [-688.392] (-695.391) (-686.841) -- 0:00:51
      188500 -- (-688.572) [-687.912] (-688.400) (-687.368) * (-687.814) (-686.368) [-690.081] (-687.682) -- 0:00:51
      189000 -- (-688.268) (-687.633) [-688.013] (-687.065) * (-686.756) (-689.682) (-687.142) [-686.678] -- 0:00:51
      189500 -- (-687.223) [-690.737] (-687.414) (-687.126) * (-690.096) [-688.173] (-687.749) (-686.943) -- 0:00:51
      190000 -- (-689.206) (-687.893) (-687.509) [-686.400] * (-693.029) [-689.652] (-687.883) (-688.470) -- 0:00:51

      Average standard deviation of split frequencies: 0.013671

      190500 -- (-687.941) (-687.631) (-692.877) [-690.927] * (-689.013) (-687.285) [-687.039] (-686.594) -- 0:00:50
      191000 -- (-687.359) (-692.220) (-687.514) [-686.836] * [-690.707] (-688.322) (-689.633) (-686.218) -- 0:00:50
      191500 -- (-689.664) [-687.563] (-687.780) (-690.955) * (-689.811) (-688.493) (-690.278) [-686.037] -- 0:00:50
      192000 -- (-691.316) (-696.400) [-687.465] (-688.531) * (-688.512) [-688.288] (-687.580) (-691.532) -- 0:00:50
      192500 -- [-690.127] (-694.052) (-688.330) (-688.002) * (-687.061) (-688.834) [-688.186] (-689.383) -- 0:00:50
      193000 -- (-686.840) [-697.002] (-687.733) (-690.090) * (-688.043) [-687.989] (-686.879) (-687.036) -- 0:00:50
      193500 -- (-690.200) [-695.218] (-689.051) (-687.704) * [-687.941] (-690.849) (-688.261) (-689.560) -- 0:00:50
      194000 -- [-690.352] (-692.143) (-691.298) (-687.595) * (-686.821) (-693.823) [-687.916] (-687.073) -- 0:00:49
      194500 -- (-691.061) (-690.314) (-688.142) [-689.800] * (-691.202) (-686.354) (-691.939) [-687.139] -- 0:00:49
      195000 -- (-694.036) [-687.710] (-689.614) (-687.717) * (-690.300) [-687.836] (-691.811) (-687.347) -- 0:00:49

      Average standard deviation of split frequencies: 0.012874

      195500 -- (-693.680) [-687.239] (-687.163) (-691.397) * [-688.717] (-690.089) (-690.228) (-688.446) -- 0:00:53
      196000 -- (-695.025) (-686.998) (-687.542) [-687.284] * (-690.801) (-687.003) (-695.475) [-688.554] -- 0:00:53
      196500 -- [-691.297] (-688.912) (-687.278) (-687.913) * (-688.383) (-687.936) [-687.967] (-688.422) -- 0:00:53
      197000 -- [-697.173] (-689.277) (-687.777) (-686.141) * (-689.037) [-687.756] (-689.739) (-687.846) -- 0:00:52
      197500 -- (-692.144) (-687.877) (-687.655) [-687.152] * [-689.079] (-687.768) (-691.015) (-689.136) -- 0:00:52
      198000 -- (-688.588) (-688.276) (-689.545) [-687.811] * [-687.820] (-689.567) (-688.813) (-688.786) -- 0:00:52
      198500 -- [-687.178] (-687.120) (-695.906) (-686.713) * [-687.611] (-692.484) (-687.132) (-688.191) -- 0:00:52
      199000 -- (-687.613) (-687.291) (-691.426) [-687.087] * (-688.179) (-692.639) [-688.612] (-688.403) -- 0:00:52
      199500 -- (-686.675) [-686.849] (-687.769) (-689.733) * (-690.690) (-693.766) [-689.904] (-688.929) -- 0:00:52
      200000 -- (-686.593) (-690.158) [-687.940] (-686.972) * [-687.355] (-689.910) (-686.591) (-689.031) -- 0:00:51

      Average standard deviation of split frequencies: 0.013312

      200500 -- (-688.345) (-689.386) [-687.799] (-687.975) * (-687.562) (-690.990) [-686.123] (-690.178) -- 0:00:51
      201000 -- [-688.270] (-686.881) (-686.692) (-687.556) * [-686.923] (-691.741) (-687.694) (-687.629) -- 0:00:51
      201500 -- [-691.870] (-689.472) (-686.712) (-690.344) * (-689.655) (-687.689) (-687.839) [-687.627] -- 0:00:51
      202000 -- (-687.763) (-687.160) [-685.986] (-687.082) * [-688.622] (-686.837) (-689.343) (-688.545) -- 0:00:51
      202500 -- (-686.226) [-689.514] (-688.823) (-688.726) * (-689.267) (-688.919) [-688.769] (-691.209) -- 0:00:51
      203000 -- [-686.484] (-691.301) (-686.259) (-689.905) * [-688.579] (-687.197) (-690.790) (-689.318) -- 0:00:51
      203500 -- [-689.019] (-687.522) (-688.079) (-690.540) * (-688.257) (-688.427) (-689.900) [-688.952] -- 0:00:50
      204000 -- (-688.047) (-686.050) (-693.882) [-689.067] * (-688.886) (-687.468) [-688.535] (-687.705) -- 0:00:50
      204500 -- (-689.463) (-686.844) (-691.583) [-687.148] * (-688.487) (-690.490) (-689.157) [-686.179] -- 0:00:50
      205000 -- (-688.122) [-688.267] (-695.871) (-690.759) * (-687.100) (-693.460) (-689.510) [-686.896] -- 0:00:50

      Average standard deviation of split frequencies: 0.012459

      205500 -- (-686.725) (-686.505) [-689.712] (-687.700) * [-686.344] (-689.422) (-699.086) (-687.573) -- 0:00:50
      206000 -- (-688.180) (-686.540) (-688.287) [-686.363] * (-686.471) (-688.166) (-690.527) [-690.021] -- 0:00:50
      206500 -- (-689.517) (-689.604) (-686.606) [-687.882] * [-688.256] (-686.132) (-688.091) (-689.856) -- 0:00:49
      207000 -- (-689.621) (-689.644) (-686.793) [-687.451] * (-691.350) (-689.240) [-686.063] (-689.046) -- 0:00:49
      207500 -- [-687.626] (-690.133) (-686.868) (-689.961) * (-687.526) [-689.058] (-689.594) (-686.968) -- 0:00:49
      208000 -- (-687.335) (-689.096) (-688.039) [-686.993] * (-687.431) (-688.948) (-688.155) [-687.096] -- 0:00:49
      208500 -- (-688.669) (-690.831) [-689.654] (-687.830) * (-690.357) (-687.630) [-687.365] (-687.766) -- 0:00:49
      209000 -- (-688.171) (-689.562) [-692.757] (-687.545) * (-691.740) (-687.115) (-687.714) [-687.135] -- 0:00:49
      209500 -- (-689.049) [-686.427] (-696.491) (-688.651) * (-688.737) (-688.015) (-687.916) [-689.785] -- 0:00:49
      210000 -- (-689.413) (-688.212) (-690.542) [-686.640] * (-687.642) [-688.381] (-689.429) (-690.597) -- 0:00:48

      Average standard deviation of split frequencies: 0.013031

      210500 -- (-692.956) [-688.133] (-690.637) (-686.858) * (-689.873) (-689.311) (-689.818) [-687.865] -- 0:00:48
      211000 -- (-692.865) (-694.290) (-688.981) [-686.695] * [-689.861] (-687.241) (-688.619) (-687.116) -- 0:00:48
      211500 -- (-693.035) (-689.104) (-697.185) [-687.732] * (-690.215) (-687.915) [-687.490] (-687.776) -- 0:00:52
      212000 -- (-687.978) (-691.210) [-688.480] (-692.149) * (-687.173) (-689.195) [-690.786] (-687.713) -- 0:00:52
      212500 -- [-686.159] (-689.476) (-690.448) (-686.793) * (-687.916) (-689.258) (-688.621) [-687.044] -- 0:00:51
      213000 -- (-688.884) (-688.383) [-686.705] (-686.677) * (-691.839) (-687.022) (-689.135) [-688.097] -- 0:00:51
      213500 -- (-688.891) (-694.055) [-686.269] (-686.267) * (-688.299) (-687.972) (-687.252) [-687.149] -- 0:00:51
      214000 -- (-687.699) [-687.342] (-688.119) (-686.559) * (-692.341) (-691.478) [-686.351] (-692.838) -- 0:00:51
      214500 -- (-686.772) [-686.614] (-688.790) (-688.209) * (-690.535) [-689.419] (-687.620) (-687.612) -- 0:00:51
      215000 -- (-690.421) (-686.829) (-690.463) [-689.636] * (-688.036) (-692.141) (-687.384) [-686.920] -- 0:00:51

      Average standard deviation of split frequencies: 0.013608

      215500 -- (-690.142) [-690.888] (-691.230) (-692.363) * (-690.185) (-691.407) [-689.243] (-687.594) -- 0:00:50
      216000 -- (-686.958) (-687.606) [-688.965] (-686.597) * (-689.610) [-688.988] (-686.397) (-687.325) -- 0:00:50
      216500 -- (-687.579) [-690.393] (-689.394) (-689.150) * [-688.634] (-691.991) (-686.813) (-686.466) -- 0:00:50
      217000 -- [-686.964] (-686.939) (-688.897) (-689.505) * [-688.838] (-693.793) (-686.518) (-686.699) -- 0:00:50
      217500 -- [-689.803] (-687.291) (-690.630) (-688.804) * (-690.369) (-688.823) [-686.444] (-689.943) -- 0:00:50
      218000 -- [-686.674] (-686.658) (-687.971) (-688.501) * (-695.256) (-688.566) [-686.169] (-687.141) -- 0:00:50
      218500 -- [-688.291] (-687.882) (-689.711) (-687.659) * (-692.473) (-687.539) [-687.653] (-689.968) -- 0:00:50
      219000 -- (-687.197) (-690.539) (-687.491) [-686.913] * [-688.454] (-692.394) (-694.534) (-690.799) -- 0:00:49
      219500 -- (-689.169) (-688.052) [-686.403] (-690.024) * (-687.650) (-692.024) (-689.296) [-686.932] -- 0:00:49
      220000 -- (-691.709) (-687.034) [-686.275] (-688.205) * (-686.772) [-690.729] (-686.379) (-688.705) -- 0:00:49

      Average standard deviation of split frequencies: 0.013320

      220500 -- (-687.698) (-691.461) [-686.538] (-691.845) * (-686.131) [-688.095] (-686.277) (-687.743) -- 0:00:49
      221000 -- (-686.919) (-685.989) [-692.627] (-687.689) * [-686.764] (-690.668) (-686.481) (-686.643) -- 0:00:49
      221500 -- (-687.718) (-686.738) (-687.334) [-688.864] * [-686.803] (-692.865) (-688.261) (-689.293) -- 0:00:49
      222000 -- [-686.066] (-688.398) (-687.629) (-688.674) * (-692.729) (-687.425) (-689.264) [-687.861] -- 0:00:49
      222500 -- (-687.950) [-686.175] (-688.453) (-690.081) * (-688.720) [-686.884] (-687.978) (-689.906) -- 0:00:48
      223000 -- (-689.020) [-686.175] (-688.207) (-690.945) * (-688.655) (-686.862) [-687.861] (-690.704) -- 0:00:48
      223500 -- (-690.251) (-687.429) [-686.311] (-688.382) * (-687.181) [-686.357] (-687.262) (-692.278) -- 0:00:48
      224000 -- [-687.403] (-687.157) (-686.935) (-688.598) * (-687.772) (-689.612) [-691.146] (-688.053) -- 0:00:48
      224500 -- (-687.656) (-686.463) [-690.303] (-687.707) * [-687.141] (-690.260) (-689.331) (-687.112) -- 0:00:48
      225000 -- [-688.779] (-687.187) (-687.530) (-687.629) * [-688.002] (-688.821) (-689.095) (-687.265) -- 0:00:48

      Average standard deviation of split frequencies: 0.012270

      225500 -- (-688.642) (-687.443) [-686.783] (-691.931) * [-689.102] (-687.462) (-688.763) (-693.195) -- 0:00:48
      226000 -- (-687.145) (-689.368) (-688.062) [-689.005] * (-688.600) (-687.359) (-688.743) [-687.907] -- 0:00:47
      226500 -- (-686.787) (-689.130) (-690.299) [-689.350] * (-687.884) [-691.413] (-689.522) (-687.360) -- 0:00:47
      227000 -- (-687.186) (-689.620) [-688.733] (-689.453) * (-691.486) [-688.566] (-687.350) (-691.175) -- 0:00:47
      227500 -- (-686.276) [-688.109] (-689.921) (-690.236) * (-688.299) (-687.418) (-687.304) [-688.049] -- 0:00:47
      228000 -- (-686.533) (-693.277) [-687.044] (-686.932) * (-688.207) [-687.271] (-687.524) (-686.914) -- 0:00:50
      228500 -- (-686.935) [-689.969] (-688.921) (-690.858) * (-687.416) (-687.210) [-686.323] (-687.953) -- 0:00:50
      229000 -- (-686.849) (-689.286) (-687.197) [-687.867] * (-688.301) (-688.166) [-686.829] (-687.883) -- 0:00:50
      229500 -- (-690.102) (-690.039) [-686.469] (-690.433) * [-687.094] (-690.904) (-691.945) (-688.090) -- 0:00:50
      230000 -- (-687.809) (-693.301) [-687.441] (-690.442) * (-689.964) (-688.426) [-687.456] (-688.623) -- 0:00:50

      Average standard deviation of split frequencies: 0.012142

      230500 -- (-689.215) (-690.902) (-686.930) [-688.200] * [-688.887] (-687.731) (-688.785) (-690.736) -- 0:00:50
      231000 -- [-689.723] (-687.778) (-688.472) (-686.829) * [-687.978] (-688.488) (-686.328) (-688.800) -- 0:00:49
      231500 -- [-691.044] (-688.013) (-687.293) (-686.424) * (-690.141) (-687.999) [-687.703] (-691.963) -- 0:00:49
      232000 -- [-687.199] (-690.843) (-687.429) (-686.717) * (-688.414) [-692.384] (-687.111) (-692.456) -- 0:00:49
      232500 -- (-687.215) (-690.214) [-686.697] (-687.740) * [-693.336] (-688.944) (-688.279) (-687.861) -- 0:00:49
      233000 -- (-691.236) (-687.291) [-688.240] (-688.464) * (-689.011) (-686.733) (-692.114) [-687.826] -- 0:00:49
      233500 -- (-695.659) (-687.238) [-689.257] (-691.520) * (-691.039) (-687.192) (-688.153) [-687.565] -- 0:00:49
      234000 -- (-688.024) (-687.305) [-687.837] (-693.146) * (-692.200) (-688.180) (-688.902) [-687.639] -- 0:00:49
      234500 -- (-687.686) (-689.686) [-687.110] (-689.165) * (-690.773) (-686.650) (-689.800) [-687.293] -- 0:00:48
      235000 -- (-687.663) (-688.119) (-689.213) [-689.606] * (-688.083) (-687.678) [-689.103] (-687.268) -- 0:00:48

      Average standard deviation of split frequencies: 0.012235

      235500 -- [-689.681] (-686.164) (-688.574) (-687.792) * (-687.503) (-686.813) (-689.061) [-688.050] -- 0:00:48
      236000 -- [-686.647] (-686.184) (-688.309) (-687.186) * (-690.346) (-697.599) (-687.548) [-688.174] -- 0:00:48
      236500 -- (-685.972) (-691.315) [-688.634] (-686.499) * (-691.160) (-690.811) [-690.407] (-690.244) -- 0:00:48
      237000 -- (-686.550) (-688.633) (-688.900) [-687.359] * (-688.754) (-692.575) (-691.978) [-690.152] -- 0:00:48
      237500 -- (-691.595) [-687.897] (-687.809) (-687.910) * (-688.922) (-688.752) (-691.425) [-690.093] -- 0:00:48
      238000 -- (-689.646) (-687.409) (-690.808) [-687.570] * [-687.818] (-688.499) (-689.783) (-689.730) -- 0:00:48
      238500 -- [-688.237] (-686.523) (-686.906) (-686.513) * (-688.006) [-687.790] (-686.857) (-690.315) -- 0:00:47
      239000 -- (-688.291) (-686.756) [-688.737] (-689.359) * (-687.090) [-691.744] (-689.002) (-687.217) -- 0:00:47
      239500 -- (-693.473) (-687.536) [-689.909] (-696.209) * (-689.814) [-688.669] (-689.499) (-689.977) -- 0:00:47
      240000 -- (-688.466) (-687.271) (-688.646) [-691.339] * (-692.717) (-690.245) [-687.570] (-688.164) -- 0:00:47

      Average standard deviation of split frequencies: 0.014234

      240500 -- [-687.212] (-686.456) (-688.690) (-690.534) * (-689.941) (-686.653) (-692.177) [-695.065] -- 0:00:47
      241000 -- [-692.399] (-688.531) (-688.550) (-687.678) * (-692.980) [-689.979] (-690.082) (-689.077) -- 0:00:47
      241500 -- [-691.289] (-692.470) (-688.038) (-687.191) * (-691.690) [-691.170] (-686.836) (-686.699) -- 0:00:47
      242000 -- (-687.201) [-690.194] (-687.358) (-687.556) * [-691.160] (-689.986) (-692.012) (-686.147) -- 0:00:46
      242500 -- [-687.610] (-689.632) (-691.505) (-687.235) * [-691.554] (-689.824) (-695.585) (-688.441) -- 0:00:46
      243000 -- (-688.520) (-687.954) [-689.500] (-688.639) * [-687.281] (-690.265) (-688.435) (-690.825) -- 0:00:46
      243500 -- (-687.845) (-687.632) [-689.195] (-687.084) * (-689.224) (-688.679) [-688.323] (-687.819) -- 0:00:46
      244000 -- (-688.303) (-688.693) (-694.215) [-688.317] * (-690.609) (-687.877) (-687.386) [-686.959] -- 0:00:49
      244500 -- [-686.646] (-690.065) (-687.794) (-688.795) * (-687.333) (-687.287) [-686.671] (-686.220) -- 0:00:49
      245000 -- [-687.115] (-687.079) (-689.276) (-689.162) * (-692.352) (-688.827) [-688.396] (-686.676) -- 0:00:49

      Average standard deviation of split frequencies: 0.012775

      245500 -- (-687.124) (-687.126) [-689.432] (-687.815) * [-691.924] (-687.027) (-688.801) (-687.373) -- 0:00:49
      246000 -- (-688.629) [-686.370] (-688.116) (-689.171) * (-691.965) [-689.456] (-687.787) (-689.063) -- 0:00:49
      246500 -- (-688.834) (-687.748) [-686.688] (-689.181) * (-690.110) [-687.491] (-690.752) (-688.859) -- 0:00:48
      247000 -- (-690.455) (-686.690) (-688.158) [-688.083] * (-688.625) (-687.161) [-687.335] (-688.530) -- 0:00:48
      247500 -- (-692.519) (-686.865) (-687.945) [-688.385] * [-689.599] (-689.067) (-688.411) (-687.570) -- 0:00:48
      248000 -- (-687.613) [-688.008] (-689.764) (-687.545) * (-688.723) (-691.922) [-686.869] (-686.296) -- 0:00:48
      248500 -- (-688.315) (-686.205) [-689.764] (-688.563) * [-687.642] (-687.970) (-688.283) (-689.362) -- 0:00:48
      249000 -- (-691.338) [-689.599] (-687.677) (-692.595) * (-691.484) (-688.205) (-687.250) [-687.954] -- 0:00:48
      249500 -- (-689.367) [-689.847] (-688.088) (-689.792) * (-691.792) [-687.929] (-688.135) (-687.228) -- 0:00:48
      250000 -- (-687.312) [-687.074] (-688.079) (-686.052) * [-692.073] (-687.435) (-688.802) (-687.741) -- 0:00:48

      Average standard deviation of split frequencies: 0.012913

      250500 -- [-687.484] (-689.502) (-687.531) (-686.019) * (-687.226) [-688.731] (-687.680) (-692.590) -- 0:00:47
      251000 -- (-687.526) (-690.101) (-686.659) [-686.394] * (-689.311) (-688.905) [-689.395] (-695.690) -- 0:00:47
      251500 -- (-694.601) (-686.591) [-688.214] (-687.811) * [-687.305] (-688.161) (-688.975) (-693.806) -- 0:00:47
      252000 -- (-688.508) (-686.213) [-686.471] (-687.582) * [-687.722] (-690.704) (-689.848) (-690.422) -- 0:00:47
      252500 -- (-687.787) [-687.907] (-689.341) (-688.355) * [-687.784] (-689.958) (-690.983) (-690.529) -- 0:00:47
      253000 -- (-688.037) (-686.320) (-687.064) [-688.706] * (-686.336) (-689.670) [-687.892] (-687.672) -- 0:00:47
      253500 -- (-688.354) [-685.862] (-691.516) (-690.844) * (-688.653) (-687.442) [-690.610] (-692.655) -- 0:00:47
      254000 -- [-687.094] (-686.175) (-687.612) (-691.330) * (-690.637) (-688.656) [-686.998] (-689.298) -- 0:00:46
      254500 -- (-688.170) (-686.656) (-689.044) [-687.920] * (-692.672) [-687.881] (-688.610) (-689.327) -- 0:00:46
      255000 -- (-691.360) (-691.031) (-688.995) [-688.054] * (-689.209) (-689.982) [-689.632] (-690.796) -- 0:00:46

      Average standard deviation of split frequencies: 0.012644

      255500 -- (-687.106) (-687.898) (-692.882) [-690.763] * [-688.891] (-686.963) (-688.905) (-698.698) -- 0:00:46
      256000 -- [-688.029] (-687.635) (-690.802) (-695.798) * (-691.023) [-688.689] (-691.258) (-690.261) -- 0:00:46
      256500 -- [-687.718] (-689.021) (-689.339) (-690.132) * (-694.625) (-689.853) [-687.216] (-689.913) -- 0:00:46
      257000 -- (-688.278) (-691.493) (-690.932) [-686.683] * (-689.476) (-686.104) [-686.842] (-689.121) -- 0:00:46
      257500 -- [-688.356] (-689.510) (-687.829) (-689.337) * (-687.356) (-687.776) (-687.343) [-688.791] -- 0:00:46
      258000 -- (-687.798) [-688.163] (-688.471) (-686.779) * (-689.341) [-690.263] (-689.033) (-687.465) -- 0:00:46
      258500 -- (-687.267) [-688.739] (-687.271) (-688.779) * (-689.551) (-687.594) (-688.846) [-686.906] -- 0:00:45
      259000 -- [-686.623] (-687.547) (-687.278) (-690.354) * (-689.966) (-687.926) (-689.646) [-687.571] -- 0:00:45
      259500 -- (-690.932) [-686.982] (-689.617) (-688.315) * (-690.119) [-687.044] (-690.509) (-687.717) -- 0:00:45
      260000 -- (-687.514) [-687.409] (-687.039) (-691.444) * (-688.372) [-687.281] (-688.009) (-689.821) -- 0:00:45

      Average standard deviation of split frequencies: 0.012094

      260500 -- (-688.028) (-687.374) [-687.472] (-687.361) * [-687.041] (-688.742) (-688.868) (-686.420) -- 0:00:48
      261000 -- [-689.188] (-689.524) (-687.386) (-687.952) * (-686.476) [-687.689] (-689.445) (-688.894) -- 0:00:48
      261500 -- (-691.045) (-686.761) [-689.860] (-687.138) * (-686.445) (-687.129) [-689.371] (-688.019) -- 0:00:48
      262000 -- (-687.032) [-687.088] (-688.143) (-688.706) * (-689.219) (-687.182) [-687.666] (-689.615) -- 0:00:47
      262500 -- [-687.196] (-686.513) (-688.953) (-690.901) * (-690.130) (-687.329) [-690.558] (-688.554) -- 0:00:47
      263000 -- (-687.008) (-687.950) [-686.930] (-687.763) * (-695.713) (-688.675) (-688.033) [-686.661] -- 0:00:47
      263500 -- [-686.309] (-687.652) (-687.863) (-689.334) * (-691.534) (-689.446) [-687.214] (-687.934) -- 0:00:47
      264000 -- [-687.616] (-688.377) (-691.182) (-689.213) * [-686.798] (-687.674) (-688.324) (-687.046) -- 0:00:47
      264500 -- (-688.344) (-689.153) (-688.479) [-688.531] * (-689.841) (-686.692) [-687.886] (-688.788) -- 0:00:47
      265000 -- (-686.944) (-690.761) [-688.535] (-688.390) * (-689.300) (-687.117) [-689.601] (-688.287) -- 0:00:47

      Average standard deviation of split frequencies: 0.011741

      265500 -- [-687.054] (-690.871) (-689.553) (-689.269) * (-686.695) [-687.486] (-688.557) (-687.463) -- 0:00:47
      266000 -- (-688.415) (-691.254) [-687.174] (-688.368) * [-689.362] (-688.926) (-688.202) (-688.618) -- 0:00:46
      266500 -- (-689.089) (-691.526) (-691.530) [-688.414] * [-688.388] (-691.412) (-686.583) (-691.115) -- 0:00:46
      267000 -- (-686.625) [-687.002] (-689.425) (-686.460) * [-687.446] (-689.681) (-689.163) (-691.079) -- 0:00:46
      267500 -- (-687.446) [-686.330] (-689.934) (-688.003) * (-688.253) [-694.374] (-686.803) (-687.568) -- 0:00:46
      268000 -- [-688.197] (-689.167) (-689.135) (-692.146) * [-688.195] (-694.945) (-686.625) (-687.316) -- 0:00:46
      268500 -- (-688.158) (-692.203) (-690.693) [-686.152] * (-690.793) (-693.373) (-689.073) [-687.782] -- 0:00:46
      269000 -- [-687.648] (-690.767) (-688.981) (-695.159) * [-690.323] (-690.644) (-686.615) (-686.501) -- 0:00:46
      269500 -- [-688.284] (-688.613) (-688.467) (-691.671) * (-688.682) (-690.035) (-686.943) [-690.296] -- 0:00:46
      270000 -- (-689.106) [-688.782] (-689.977) (-693.053) * (-690.515) (-692.104) (-688.753) [-687.713] -- 0:00:45

      Average standard deviation of split frequencies: 0.011379

      270500 -- (-686.488) (-688.316) [-687.454] (-693.842) * (-690.576) (-688.904) [-686.854] (-689.926) -- 0:00:45
      271000 -- (-686.611) (-686.804) [-686.338] (-692.166) * (-688.239) [-690.323] (-686.623) (-688.695) -- 0:00:45
      271500 -- (-686.516) (-687.580) (-690.455) [-689.516] * (-687.519) [-692.749] (-686.674) (-687.614) -- 0:00:45
      272000 -- (-686.879) (-689.956) [-687.027] (-688.389) * (-687.139) (-693.468) [-687.369] (-688.971) -- 0:00:45
      272500 -- [-686.443] (-690.857) (-688.792) (-688.863) * (-687.589) (-689.912) [-687.886] (-688.189) -- 0:00:45
      273000 -- (-687.736) (-687.466) [-686.795] (-688.511) * [-691.019] (-687.194) (-688.416) (-687.107) -- 0:00:45
      273500 -- [-687.492] (-688.304) (-690.021) (-688.860) * [-687.324] (-688.164) (-687.528) (-690.532) -- 0:00:45
      274000 -- [-686.901] (-688.896) (-689.572) (-687.935) * (-686.630) (-689.861) [-688.847] (-689.500) -- 0:00:45
      274500 -- [-687.307] (-692.764) (-687.948) (-692.720) * (-690.517) (-687.980) [-687.528] (-685.917) -- 0:00:44
      275000 -- (-686.579) [-691.635] (-687.885) (-688.623) * (-695.090) [-689.305] (-687.181) (-687.625) -- 0:00:44

      Average standard deviation of split frequencies: 0.011728

      275500 -- (-686.803) (-688.108) (-688.134) [-686.668] * (-689.704) (-692.461) [-687.377] (-686.388) -- 0:00:44
      276000 -- (-687.941) [-688.357] (-686.749) (-687.206) * (-687.122) [-693.239] (-692.313) (-689.258) -- 0:00:44
      276500 -- (-688.035) (-690.457) [-688.168] (-687.130) * [-686.779] (-686.799) (-688.535) (-690.866) -- 0:00:44
      277000 -- (-688.925) (-686.821) (-690.812) [-686.278] * (-686.852) (-686.531) [-688.763] (-690.278) -- 0:00:46
      277500 -- [-686.960] (-690.769) (-687.808) (-691.711) * (-687.393) (-689.104) (-688.907) [-690.145] -- 0:00:46
      278000 -- (-686.522) (-694.194) [-687.904] (-686.003) * (-689.341) (-689.107) (-688.302) [-689.365] -- 0:00:46
      278500 -- (-687.595) (-692.111) (-689.173) [-687.805] * [-688.650] (-686.164) (-688.054) (-688.496) -- 0:00:46
      279000 -- (-687.091) (-686.301) (-688.746) [-686.939] * [-687.944] (-688.298) (-689.460) (-689.086) -- 0:00:46
      279500 -- (-687.807) (-687.755) (-686.178) [-688.030] * (-688.959) (-690.815) (-690.452) [-686.762] -- 0:00:46
      280000 -- (-686.910) [-686.436] (-688.987) (-688.016) * (-687.246) (-686.616) [-688.676] (-687.588) -- 0:00:46

      Average standard deviation of split frequencies: 0.011533

      280500 -- [-691.037] (-688.067) (-687.097) (-686.993) * (-689.730) (-690.647) [-689.713] (-688.164) -- 0:00:46
      281000 -- (-693.323) (-687.630) [-689.696] (-689.213) * (-687.910) [-687.727] (-688.350) (-689.495) -- 0:00:46
      281500 -- (-687.676) [-687.269] (-687.590) (-686.567) * (-686.684) [-689.515] (-687.880) (-688.433) -- 0:00:45
      282000 -- (-688.276) [-688.794] (-689.911) (-689.004) * (-688.048) [-688.803] (-687.641) (-692.388) -- 0:00:45
      282500 -- (-691.808) (-687.775) [-688.068] (-690.604) * [-688.234] (-686.581) (-688.223) (-689.366) -- 0:00:45
      283000 -- [-688.551] (-690.645) (-692.919) (-688.546) * (-687.210) (-687.808) (-688.663) [-688.540] -- 0:00:45
      283500 -- [-686.369] (-693.204) (-692.279) (-688.146) * (-687.260) (-687.066) (-686.475) [-690.249] -- 0:00:45
      284000 -- [-689.831] (-688.766) (-688.583) (-690.315) * [-686.915] (-689.082) (-687.006) (-689.002) -- 0:00:45
      284500 -- (-687.474) [-686.902] (-689.119) (-690.228) * (-687.673) (-688.845) [-687.260] (-689.286) -- 0:00:45
      285000 -- (-693.795) (-688.894) [-687.279] (-691.733) * (-687.174) (-691.996) [-687.693] (-690.029) -- 0:00:45

      Average standard deviation of split frequencies: 0.010611

      285500 -- (-689.192) (-688.527) (-690.119) [-692.608] * (-688.712) [-686.198] (-688.427) (-687.703) -- 0:00:45
      286000 -- [-687.991] (-687.275) (-688.973) (-689.289) * [-688.236] (-688.417) (-688.107) (-687.905) -- 0:00:44
      286500 -- (-687.047) (-687.272) [-687.703] (-688.233) * (-688.936) (-687.849) [-686.755] (-686.972) -- 0:00:44
      287000 -- [-687.340] (-692.214) (-687.810) (-687.355) * (-695.302) (-687.498) (-687.535) [-687.044] -- 0:00:44
      287500 -- [-687.723] (-687.999) (-695.311) (-689.699) * [-687.248] (-688.980) (-688.874) (-688.765) -- 0:00:44
      288000 -- (-688.061) (-687.834) (-692.165) [-692.382] * (-688.095) (-687.258) (-688.624) [-691.593] -- 0:00:44
      288500 -- (-690.068) (-688.177) (-690.543) [-687.156] * (-686.705) (-688.184) (-688.577) [-689.313] -- 0:00:44
      289000 -- (-688.085) (-696.767) [-687.161] (-688.945) * (-690.463) (-690.963) [-689.012] (-689.876) -- 0:00:44
      289500 -- (-689.957) [-688.633] (-687.361) (-690.911) * [-690.561] (-688.141) (-688.843) (-688.652) -- 0:00:44
      290000 -- [-689.730] (-688.008) (-688.649) (-690.385) * (-691.558) (-689.251) (-687.069) [-687.045] -- 0:00:44

      Average standard deviation of split frequencies: 0.010589

      290500 -- (-690.612) (-687.297) (-693.567) [-688.141] * (-689.940) (-689.639) (-687.155) [-687.393] -- 0:00:43
      291000 -- (-688.619) (-686.566) (-687.253) [-686.858] * (-688.920) (-689.096) [-686.289] (-686.580) -- 0:00:43
      291500 -- (-690.574) (-687.203) (-689.943) [-691.619] * (-690.059) (-689.430) (-686.937) [-689.638] -- 0:00:43
      292000 -- (-686.714) [-687.670] (-689.486) (-688.334) * (-689.235) (-690.858) [-689.886] (-688.793) -- 0:00:43
      292500 -- (-688.569) (-690.005) [-688.868] (-687.264) * (-689.962) (-690.405) (-688.607) [-689.737] -- 0:00:43
      293000 -- (-692.690) (-688.396) [-687.478] (-688.795) * (-687.410) (-689.134) (-692.322) [-687.808] -- 0:00:45
      293500 -- (-687.243) (-689.132) (-688.218) [-689.044] * (-688.555) (-690.999) [-687.554] (-690.144) -- 0:00:45
      294000 -- (-686.695) (-689.734) [-688.921] (-688.169) * [-686.778] (-692.943) (-690.507) (-687.951) -- 0:00:45
      294500 -- (-686.952) [-686.839] (-690.001) (-688.655) * (-690.214) [-686.669] (-691.633) (-688.259) -- 0:00:45
      295000 -- [-690.191] (-687.852) (-686.890) (-687.741) * (-689.412) [-686.929] (-686.457) (-689.341) -- 0:00:45

      Average standard deviation of split frequencies: 0.010551

      295500 -- (-688.209) (-689.159) [-686.498] (-686.970) * (-687.955) (-688.721) [-687.548] (-694.168) -- 0:00:45
      296000 -- (-688.289) [-688.318] (-688.202) (-687.824) * [-688.724] (-688.372) (-690.554) (-687.940) -- 0:00:45
      296500 -- (-687.965) [-687.985] (-687.881) (-689.486) * (-689.119) (-686.356) [-688.354] (-686.658) -- 0:00:45
      297000 -- (-690.008) [-686.995] (-687.856) (-688.229) * (-688.181) [-689.782] (-687.017) (-686.778) -- 0:00:44
      297500 -- (-690.945) (-689.858) (-690.192) [-688.268] * [-687.717] (-688.827) (-686.834) (-688.790) -- 0:00:44
      298000 -- [-686.068] (-688.741) (-689.681) (-687.410) * [-687.237] (-687.805) (-688.985) (-687.373) -- 0:00:44
      298500 -- (-688.112) (-686.154) [-686.700] (-687.997) * [-689.673] (-689.140) (-687.721) (-687.036) -- 0:00:44
      299000 -- (-688.739) [-687.816] (-687.260) (-686.126) * (-687.837) (-688.449) (-686.737) [-687.132] -- 0:00:44
      299500 -- [-695.090] (-687.243) (-692.191) (-686.221) * (-687.517) (-688.409) (-688.245) [-690.365] -- 0:00:44
      300000 -- (-692.851) (-686.950) [-688.018] (-686.191) * (-691.621) (-687.927) [-691.201] (-688.195) -- 0:00:44

      Average standard deviation of split frequencies: 0.010093

      300500 -- (-687.396) [-687.184] (-689.779) (-686.388) * (-692.028) [-686.249] (-687.613) (-689.071) -- 0:00:44
      301000 -- (-686.963) (-688.949) [-688.972] (-687.711) * [-687.458] (-687.800) (-691.005) (-688.144) -- 0:00:44
      301500 -- (-688.153) [-687.741] (-688.685) (-688.623) * (-687.272) [-686.474] (-692.223) (-690.512) -- 0:00:44
      302000 -- [-688.593] (-688.614) (-689.502) (-688.158) * [-687.776] (-688.122) (-696.391) (-688.781) -- 0:00:43
      302500 -- [-690.345] (-691.083) (-688.508) (-690.948) * (-688.122) (-687.656) (-689.674) [-689.853] -- 0:00:43
      303000 -- (-688.317) (-688.024) (-690.176) [-686.178] * [-686.649] (-689.329) (-687.822) (-687.623) -- 0:00:43
      303500 -- [-690.323] (-691.405) (-687.527) (-688.884) * (-688.339) [-690.226] (-688.434) (-689.197) -- 0:00:43
      304000 -- (-689.658) (-687.594) [-688.310] (-689.316) * (-687.787) (-688.111) (-687.738) [-687.561] -- 0:00:43
      304500 -- (-687.924) (-689.053) (-688.857) [-686.572] * (-687.030) (-687.582) [-686.195] (-686.503) -- 0:00:43
      305000 -- (-688.780) (-688.182) (-688.305) [-687.189] * (-686.886) (-689.723) [-688.093] (-688.009) -- 0:00:43

      Average standard deviation of split frequencies: 0.010302

      305500 -- (-688.451) [-687.376] (-692.659) (-689.708) * (-687.685) (-688.531) (-686.546) [-686.652] -- 0:00:43
      306000 -- [-693.252] (-686.119) (-691.830) (-693.082) * (-689.008) (-691.419) (-687.660) [-687.921] -- 0:00:43
      306500 -- (-690.160) (-686.129) (-689.917) [-687.921] * (-690.930) (-687.176) [-687.300] (-690.757) -- 0:00:42
      307000 -- [-691.269] (-688.180) (-689.340) (-690.886) * (-691.857) (-686.617) (-687.067) [-690.630] -- 0:00:42
      307500 -- (-691.897) (-688.543) [-686.972] (-690.780) * (-690.499) (-690.276) [-686.935] (-688.996) -- 0:00:42
      308000 -- (-686.723) (-689.089) [-687.272] (-689.283) * [-692.420] (-689.573) (-690.959) (-694.359) -- 0:00:42
      308500 -- [-689.975] (-692.437) (-688.326) (-689.282) * (-690.890) (-693.079) (-687.907) [-693.579] -- 0:00:42
      309000 -- (-688.521) (-693.652) (-687.521) [-687.129] * (-686.554) [-689.087] (-688.003) (-695.231) -- 0:00:42
      309500 -- (-687.762) (-686.925) (-687.405) [-686.585] * (-686.919) [-688.925] (-690.157) (-688.955) -- 0:00:44
      310000 -- (-688.975) [-686.630] (-688.721) (-687.156) * (-686.384) [-687.527] (-687.787) (-686.959) -- 0:00:44

      Average standard deviation of split frequencies: 0.010242

      310500 -- (-687.169) (-686.750) (-687.835) [-686.953] * [-686.591] (-690.417) (-686.247) (-690.991) -- 0:00:44
      311000 -- (-688.385) (-688.702) (-687.979) [-688.046] * (-687.427) [-686.946] (-687.669) (-688.623) -- 0:00:44
      311500 -- [-688.266] (-694.270) (-687.643) (-689.364) * (-688.544) (-687.570) [-689.892] (-689.715) -- 0:00:44
      312000 -- (-686.925) (-691.769) (-691.161) [-686.718] * [-687.169] (-687.519) (-691.405) (-688.208) -- 0:00:44
      312500 -- [-688.124] (-689.959) (-690.039) (-688.023) * (-689.714) (-689.295) (-693.670) [-688.570] -- 0:00:44
      313000 -- (-688.576) [-689.555] (-690.831) (-687.076) * (-687.503) (-688.975) [-696.620] (-687.937) -- 0:00:43
      313500 -- (-687.933) (-689.464) [-693.139] (-689.621) * [-687.847] (-687.378) (-687.725) (-689.102) -- 0:00:43
      314000 -- (-687.428) (-688.207) [-687.557] (-688.628) * [-686.013] (-688.657) (-690.568) (-687.879) -- 0:00:43
      314500 -- (-687.480) (-688.329) [-687.468] (-689.316) * [-688.870] (-688.670) (-686.969) (-690.539) -- 0:00:43
      315000 -- (-687.287) (-689.668) (-687.400) [-688.175] * (-688.884) (-691.661) (-687.518) [-687.668] -- 0:00:43

      Average standard deviation of split frequencies: 0.010629

      315500 -- [-687.359] (-688.937) (-686.557) (-690.164) * (-690.699) (-694.115) [-688.888] (-687.994) -- 0:00:43
      316000 -- [-688.178] (-689.900) (-691.005) (-689.752) * (-689.080) (-688.021) (-686.748) [-687.343] -- 0:00:43
      316500 -- (-687.291) (-687.039) [-689.171] (-687.456) * [-689.734] (-688.101) (-686.326) (-688.479) -- 0:00:43
      317000 -- [-687.291] (-688.067) (-686.773) (-687.702) * [-687.445] (-686.982) (-686.366) (-687.413) -- 0:00:43
      317500 -- [-686.868] (-691.640) (-687.059) (-689.054) * [-689.440] (-692.653) (-691.726) (-689.424) -- 0:00:42
      318000 -- (-689.514) (-687.901) (-687.748) [-687.272] * (-687.907) [-689.080] (-689.257) (-689.909) -- 0:00:42
      318500 -- (-690.060) (-687.048) (-687.335) [-689.330] * (-691.768) [-687.488] (-687.954) (-692.305) -- 0:00:42
      319000 -- (-689.433) (-688.119) (-687.420) [-687.044] * [-689.600] (-687.803) (-687.199) (-688.119) -- 0:00:42
      319500 -- [-686.396] (-690.778) (-692.115) (-687.314) * [-688.511] (-688.982) (-688.406) (-689.553) -- 0:00:42
      320000 -- (-687.974) (-689.389) [-687.560] (-688.341) * (-690.026) [-688.867] (-689.487) (-691.493) -- 0:00:42

      Average standard deviation of split frequencies: 0.009555

      320500 -- [-690.247] (-688.699) (-691.996) (-688.928) * (-687.207) [-689.776] (-689.712) (-691.325) -- 0:00:42
      321000 -- (-696.516) [-687.152] (-688.409) (-690.606) * (-687.142) (-687.327) [-688.861] (-686.456) -- 0:00:42
      321500 -- (-689.396) [-688.980] (-688.269) (-690.779) * (-688.238) (-687.386) [-686.855] (-687.217) -- 0:00:42
      322000 -- [-687.913] (-689.118) (-686.546) (-689.538) * (-687.607) (-687.726) (-692.000) [-687.564] -- 0:00:42
      322500 -- (-688.574) (-688.218) (-689.226) [-687.728] * (-689.944) (-691.034) (-688.639) [-688.356] -- 0:00:42
      323000 -- (-689.700) (-686.649) (-687.433) [-687.978] * (-691.797) [-687.818] (-689.346) (-687.600) -- 0:00:41
      323500 -- (-687.159) [-686.602] (-693.046) (-686.388) * [-687.302] (-686.903) (-689.963) (-692.146) -- 0:00:41
      324000 -- (-687.997) (-690.701) [-689.010] (-690.221) * [-687.798] (-689.096) (-687.581) (-689.517) -- 0:00:41
      324500 -- (-689.511) [-690.013] (-686.514) (-689.611) * (-687.572) [-687.643] (-688.138) (-687.430) -- 0:00:41
      325000 -- (-687.177) (-689.205) [-689.794] (-692.889) * (-687.318) [-688.410] (-692.711) (-689.203) -- 0:00:41

      Average standard deviation of split frequencies: 0.009490

      325500 -- (-687.149) (-689.609) [-688.486] (-686.934) * (-688.254) (-687.929) (-689.499) [-686.433] -- 0:00:43
      326000 -- (-693.007) (-686.415) (-689.849) [-686.680] * (-687.656) (-689.610) (-692.046) [-686.127] -- 0:00:43
      326500 -- (-692.010) [-686.991] (-688.175) (-691.237) * (-689.470) (-691.308) (-691.954) [-686.623] -- 0:00:43
      327000 -- [-687.031] (-690.159) (-688.831) (-690.553) * (-687.693) [-688.347] (-690.140) (-687.418) -- 0:00:43
      327500 -- [-686.814] (-686.534) (-689.591) (-692.082) * (-688.989) (-690.705) (-689.346) [-687.280] -- 0:00:43
      328000 -- [-687.299] (-691.091) (-687.540) (-691.823) * (-686.439) [-686.467] (-688.030) (-688.701) -- 0:00:43
      328500 -- [-688.082] (-688.300) (-691.141) (-687.099) * [-686.778] (-686.244) (-688.916) (-687.779) -- 0:00:42
      329000 -- [-691.264] (-688.168) (-690.428) (-687.922) * (-686.211) (-687.282) [-686.652] (-689.470) -- 0:00:42
      329500 -- (-688.275) (-687.666) (-688.580) [-688.458] * [-689.476] (-688.118) (-687.898) (-689.430) -- 0:00:42
      330000 -- (-695.775) (-688.491) (-687.779) [-688.593] * (-689.195) [-686.389] (-687.572) (-686.987) -- 0:00:42

      Average standard deviation of split frequencies: 0.010930

      330500 -- [-690.113] (-689.854) (-689.519) (-687.801) * (-691.760) [-686.219] (-687.552) (-688.007) -- 0:00:42
      331000 -- (-686.199) [-692.314] (-689.186) (-690.135) * [-691.604] (-686.401) (-688.126) (-689.530) -- 0:00:42
      331500 -- (-686.967) (-686.926) [-689.538] (-687.794) * (-689.627) [-690.473] (-687.315) (-687.831) -- 0:00:42
      332000 -- (-686.609) (-688.287) (-689.033) [-687.439] * (-686.877) (-688.399) [-688.867] (-687.922) -- 0:00:42
      332500 -- (-687.728) (-686.736) (-691.626) [-686.893] * (-686.792) [-691.567] (-687.250) (-688.377) -- 0:00:42
      333000 -- (-688.934) (-689.684) [-688.820] (-692.654) * (-687.690) (-688.275) (-692.651) [-686.093] -- 0:00:42
      333500 -- [-687.308] (-690.651) (-687.486) (-687.247) * (-687.309) (-687.756) [-687.007] (-688.168) -- 0:00:41
      334000 -- (-687.837) [-687.585] (-688.417) (-687.839) * [-687.215] (-690.641) (-689.066) (-688.748) -- 0:00:41
      334500 -- [-690.406] (-690.175) (-692.862) (-687.226) * (-688.033) [-687.174] (-688.419) (-690.415) -- 0:00:41
      335000 -- (-690.682) [-687.133] (-689.541) (-686.386) * [-691.168] (-686.407) (-687.853) (-688.973) -- 0:00:41

      Average standard deviation of split frequencies: 0.010347

      335500 -- [-692.351] (-687.790) (-688.810) (-688.515) * (-691.982) (-687.752) [-687.618] (-688.422) -- 0:00:41
      336000 -- (-688.770) (-689.240) (-687.359) [-688.037] * (-688.406) [-692.083] (-687.235) (-688.172) -- 0:00:41
      336500 -- (-689.440) (-688.783) [-692.042] (-687.537) * (-693.608) (-692.408) (-688.255) [-686.581] -- 0:00:41
      337000 -- [-687.966] (-689.441) (-695.142) (-687.907) * (-688.896) (-689.742) (-692.558) [-686.120] -- 0:00:41
      337500 -- (-688.789) [-689.025] (-687.423) (-687.579) * (-690.026) (-689.178) (-687.360) [-686.461] -- 0:00:41
      338000 -- (-687.512) [-687.584] (-686.939) (-689.613) * [-690.045] (-689.873) (-691.463) (-689.906) -- 0:00:41
      338500 -- [-688.744] (-690.047) (-692.678) (-688.567) * (-690.663) (-688.396) [-688.541] (-694.628) -- 0:00:41
      339000 -- (-690.398) [-687.995] (-686.096) (-687.806) * [-690.242] (-688.545) (-690.505) (-691.553) -- 0:00:40
      339500 -- (-689.541) (-687.569) [-687.099] (-687.972) * (-692.274) [-687.867] (-687.518) (-687.768) -- 0:00:40
      340000 -- (-690.820) (-689.748) (-686.181) [-688.217] * (-688.928) [-687.291] (-688.628) (-690.041) -- 0:00:40

      Average standard deviation of split frequencies: 0.010897

      340500 -- (-688.942) (-688.992) [-686.826] (-691.272) * (-690.930) (-686.805) (-690.739) [-688.534] -- 0:00:40
      341000 -- (-691.830) (-694.933) [-690.276] (-690.590) * (-690.668) (-689.306) (-686.836) [-690.060] -- 0:00:40
      341500 -- [-690.657] (-688.007) (-686.985) (-687.097) * [-688.777] (-693.050) (-687.068) (-689.429) -- 0:00:40
      342000 -- (-689.626) [-688.958] (-686.712) (-687.105) * (-687.287) (-694.132) [-687.212] (-689.987) -- 0:00:42
      342500 -- (-690.315) (-688.301) (-686.170) [-687.851] * (-687.485) (-692.018) (-689.237) [-687.070] -- 0:00:42
      343000 -- [-688.220] (-687.141) (-692.817) (-690.721) * [-687.422] (-686.632) (-687.253) (-689.088) -- 0:00:42
      343500 -- (-687.694) [-687.038] (-688.011) (-691.574) * (-687.246) (-689.246) [-687.644] (-689.062) -- 0:00:42
      344000 -- (-689.322) [-686.788] (-689.692) (-686.924) * (-689.129) (-687.334) [-686.072] (-690.248) -- 0:00:41
      344500 -- (-691.423) [-687.904] (-691.479) (-694.389) * (-689.559) (-686.642) [-687.453] (-688.238) -- 0:00:41
      345000 -- (-689.515) (-687.348) (-686.998) [-686.855] * (-686.149) [-689.151] (-690.481) (-687.899) -- 0:00:41

      Average standard deviation of split frequencies: 0.010559

      345500 -- (-688.553) (-687.223) (-687.562) [-687.171] * [-686.337] (-689.918) (-690.952) (-690.176) -- 0:00:41
      346000 -- [-687.837] (-689.551) (-688.104) (-688.620) * (-689.591) (-688.806) (-689.682) [-688.861] -- 0:00:41
      346500 -- (-690.397) [-688.552] (-687.013) (-688.735) * (-691.505) (-687.087) (-691.926) [-688.375] -- 0:00:41
      347000 -- (-686.812) (-691.097) [-689.746] (-688.712) * (-687.051) (-690.141) (-690.532) [-686.576] -- 0:00:41
      347500 -- (-687.330) (-688.525) (-687.867) [-688.259] * [-690.357] (-687.924) (-695.172) (-690.419) -- 0:00:41
      348000 -- (-688.504) (-687.146) (-686.842) [-691.422] * (-687.216) (-686.601) [-689.493] (-690.576) -- 0:00:41
      348500 -- (-687.658) (-687.139) [-689.704] (-689.644) * [-690.507] (-690.395) (-691.502) (-689.633) -- 0:00:41
      349000 -- (-692.913) (-689.204) [-689.107] (-693.158) * (-689.538) [-686.773] (-688.927) (-688.878) -- 0:00:41
      349500 -- (-687.412) (-689.657) [-688.476] (-690.809) * (-691.280) [-689.358] (-687.284) (-688.735) -- 0:00:40
      350000 -- [-689.383] (-693.641) (-688.422) (-688.495) * [-694.009] (-689.548) (-688.740) (-687.098) -- 0:00:40

      Average standard deviation of split frequencies: 0.009589

      350500 -- (-690.243) (-692.233) (-689.087) [-690.448] * (-692.412) (-690.137) (-688.977) [-689.808] -- 0:00:40
      351000 -- (-691.029) [-686.417] (-688.001) (-691.479) * (-687.713) (-689.328) (-687.446) [-688.959] -- 0:00:40
      351500 -- (-703.696) [-689.032] (-688.897) (-693.913) * (-686.564) (-687.728) [-687.540] (-688.093) -- 0:00:40
      352000 -- [-690.579] (-689.185) (-686.558) (-694.284) * (-686.636) [-687.304] (-687.363) (-688.143) -- 0:00:40
      352500 -- (-688.882) (-688.570) (-689.055) [-689.831] * (-687.840) [-687.801] (-688.786) (-686.468) -- 0:00:40
      353000 -- (-688.082) (-688.066) (-686.724) [-687.412] * (-691.694) (-690.657) (-687.662) [-686.634] -- 0:00:40
      353500 -- (-687.977) (-689.093) (-686.093) [-687.098] * (-690.216) [-687.689] (-686.735) (-686.795) -- 0:00:40
      354000 -- (-689.208) (-689.841) (-688.850) [-687.725] * (-687.750) (-689.413) [-686.270] (-687.988) -- 0:00:40
      354500 -- (-688.728) [-687.041] (-689.142) (-689.964) * (-686.484) [-686.614] (-689.908) (-688.910) -- 0:00:40
      355000 -- (-687.560) [-687.525] (-686.650) (-689.280) * (-686.737) (-691.028) (-686.816) [-689.222] -- 0:00:39

      Average standard deviation of split frequencies: 0.009799

      355500 -- (-688.853) [-687.541] (-686.575) (-687.996) * (-688.295) [-688.080] (-686.309) (-689.418) -- 0:00:39
      356000 -- (-688.420) (-687.503) (-692.658) [-688.554] * [-688.175] (-690.108) (-689.560) (-690.036) -- 0:00:39
      356500 -- (-688.223) (-687.682) [-686.872] (-688.107) * (-689.011) (-689.662) (-687.690) [-689.055] -- 0:00:39
      357000 -- (-687.519) (-689.122) (-690.275) [-687.567] * (-691.281) [-689.071] (-686.352) (-690.078) -- 0:00:39
      357500 -- [-687.221] (-690.601) (-690.900) (-688.545) * (-689.234) (-688.606) [-687.126] (-686.456) -- 0:00:39
      358000 -- [-687.864] (-688.476) (-687.452) (-686.995) * (-692.768) (-687.394) (-688.905) [-690.062] -- 0:00:39
      358500 -- (-690.600) [-690.614] (-688.075) (-688.956) * (-687.892) [-688.105] (-690.672) (-690.964) -- 0:00:41
      359000 -- (-690.184) (-689.182) [-690.869] (-687.597) * (-689.769) (-690.934) [-686.497] (-690.357) -- 0:00:41
      359500 -- (-689.481) (-692.141) [-687.146] (-687.404) * (-687.592) (-689.173) [-686.968] (-689.036) -- 0:00:40
      360000 -- (-690.122) (-690.217) (-687.663) [-686.674] * (-687.174) [-689.970] (-686.151) (-689.037) -- 0:00:40

      Average standard deviation of split frequencies: 0.010979

      360500 -- (-690.959) [-686.411] (-687.358) (-689.803) * [-687.141] (-687.635) (-687.028) (-688.676) -- 0:00:40
      361000 -- [-688.638] (-688.506) (-689.086) (-689.364) * (-689.657) (-686.479) [-687.845] (-688.448) -- 0:00:40
      361500 -- [-690.608] (-690.292) (-688.853) (-690.453) * [-686.889] (-687.240) (-687.139) (-689.315) -- 0:00:40
      362000 -- (-687.105) (-689.464) (-688.239) [-688.226] * (-690.221) (-687.798) [-688.226] (-688.843) -- 0:00:40
      362500 -- (-687.042) (-687.514) [-688.571] (-688.287) * [-687.200] (-688.910) (-692.227) (-688.116) -- 0:00:40
      363000 -- (-691.114) (-686.550) (-686.607) [-688.331] * (-687.634) (-688.089) [-688.031] (-688.373) -- 0:00:40
      363500 -- [-688.475] (-686.654) (-688.732) (-688.851) * (-686.816) (-688.582) [-691.422] (-692.919) -- 0:00:40
      364000 -- (-688.239) (-687.475) [-690.072] (-688.235) * (-687.627) (-686.930) [-688.261] (-690.338) -- 0:00:40
      364500 -- (-690.385) (-688.323) (-689.838) [-689.697] * (-688.600) [-690.919] (-687.942) (-691.691) -- 0:00:40
      365000 -- (-691.256) (-691.117) (-693.147) [-688.215] * (-688.523) [-690.421] (-687.215) (-689.590) -- 0:00:40

      Average standard deviation of split frequencies: 0.010062

      365500 -- [-687.729] (-687.047) (-688.340) (-688.037) * [-692.327] (-689.305) (-690.766) (-688.905) -- 0:00:39
      366000 -- (-691.489) (-692.641) (-687.776) [-690.234] * (-692.090) [-686.950] (-687.546) (-688.765) -- 0:00:39
      366500 -- (-687.162) (-691.087) [-687.424] (-688.910) * (-688.086) [-688.628] (-688.094) (-688.802) -- 0:00:39
      367000 -- [-689.127] (-690.984) (-691.967) (-689.541) * (-692.251) (-688.276) (-689.516) [-690.000] -- 0:00:39
      367500 -- (-687.833) [-689.048] (-691.608) (-689.247) * (-687.208) (-687.189) (-691.838) [-686.402] -- 0:00:39
      368000 -- [-687.491] (-687.995) (-687.635) (-686.943) * (-690.173) (-688.302) (-688.853) [-687.791] -- 0:00:39
      368500 -- (-686.564) [-689.955] (-688.121) (-687.989) * (-689.966) (-686.966) [-687.859] (-690.194) -- 0:00:39
      369000 -- (-687.257) [-686.773] (-690.490) (-688.038) * (-689.509) [-689.300] (-687.731) (-687.875) -- 0:00:39
      369500 -- (-688.381) (-689.602) (-686.921) [-687.201] * (-687.781) (-691.056) (-688.780) [-687.370] -- 0:00:39
      370000 -- (-688.770) [-688.361] (-687.772) (-687.637) * [-687.468] (-691.171) (-687.483) (-686.287) -- 0:00:39

      Average standard deviation of split frequencies: 0.009538

      370500 -- (-688.841) (-689.645) [-687.458] (-686.105) * (-688.923) (-689.232) (-690.475) [-687.806] -- 0:00:39
      371000 -- (-687.428) (-687.879) (-687.679) [-686.126] * (-691.989) (-688.444) [-687.550] (-688.840) -- 0:00:38
      371500 -- [-688.658] (-688.926) (-687.423) (-688.565) * (-688.272) (-687.564) [-687.223] (-688.540) -- 0:00:38
      372000 -- (-687.702) [-686.905] (-689.475) (-687.378) * (-690.167) (-686.617) (-688.757) [-686.399] -- 0:00:38
      372500 -- [-687.687] (-690.166) (-691.201) (-686.420) * (-688.355) [-686.566] (-686.699) (-687.962) -- 0:00:38
      373000 -- (-687.822) (-690.284) [-689.584] (-689.209) * (-690.182) (-687.679) (-687.631) [-687.835] -- 0:00:38
      373500 -- [-688.868] (-686.623) (-691.812) (-691.519) * (-689.651) (-687.817) (-688.154) [-687.499] -- 0:00:38
      374000 -- [-689.007] (-685.889) (-689.182) (-690.264) * (-688.070) (-687.748) [-690.962] (-688.007) -- 0:00:38
      374500 -- (-686.967) (-689.840) (-687.540) [-689.309] * [-686.728] (-688.750) (-693.149) (-687.277) -- 0:00:38
      375000 -- (-686.199) (-688.040) (-688.327) [-687.848] * (-688.184) (-686.385) (-687.768) [-688.528] -- 0:00:40

      Average standard deviation of split frequencies: 0.008609

      375500 -- (-686.819) [-686.302] (-689.469) (-686.183) * (-689.943) (-686.751) (-690.466) [-687.481] -- 0:00:39
      376000 -- (-688.102) (-687.906) (-688.326) [-688.219] * (-687.076) (-691.750) (-690.545) [-692.168] -- 0:00:39
      376500 -- [-687.521] (-686.061) (-688.291) (-688.631) * (-689.424) [-690.994] (-687.803) (-688.654) -- 0:00:39
      377000 -- (-688.678) [-690.312] (-688.288) (-691.499) * (-687.816) (-690.632) (-687.566) [-688.122] -- 0:00:39
      377500 -- (-686.316) [-686.650] (-686.390) (-688.989) * (-687.682) [-689.705] (-686.957) (-691.865) -- 0:00:39
      378000 -- (-688.480) (-688.549) [-688.155] (-691.513) * (-690.034) [-688.716] (-689.432) (-695.507) -- 0:00:39
      378500 -- (-686.879) (-686.106) [-690.839] (-687.867) * (-687.509) (-689.076) (-690.195) [-692.232] -- 0:00:39
      379000 -- (-688.450) (-687.039) (-688.090) [-686.802] * [-688.601] (-688.848) (-689.773) (-686.723) -- 0:00:39
      379500 -- (-691.909) (-690.737) [-686.812] (-688.140) * (-687.985) (-688.645) (-695.012) [-690.964] -- 0:00:39
      380000 -- (-689.025) [-688.812] (-691.091) (-686.741) * (-689.917) (-688.693) (-691.315) [-689.715] -- 0:00:39

      Average standard deviation of split frequencies: 0.007760

      380500 -- [-690.706] (-689.365) (-693.165) (-688.304) * (-690.725) (-689.297) [-689.544] (-688.307) -- 0:00:39
      381000 -- (-694.259) [-688.898] (-687.283) (-688.470) * (-689.041) (-689.035) [-687.417] (-689.165) -- 0:00:38
      381500 -- (-687.730) (-689.601) (-692.597) [-689.400] * (-689.628) (-695.056) (-693.640) [-686.760] -- 0:00:38
      382000 -- (-691.585) (-688.813) (-692.713) [-686.553] * [-688.925] (-689.939) (-694.745) (-688.218) -- 0:00:38
      382500 -- (-688.732) (-687.669) (-690.130) [-686.764] * (-687.267) (-687.524) (-689.263) [-687.503] -- 0:00:38
      383000 -- (-688.133) [-689.286] (-693.040) (-686.307) * (-687.158) (-686.732) (-687.040) [-688.037] -- 0:00:38
      383500 -- (-687.716) (-688.011) [-688.248] (-689.685) * (-687.119) (-688.533) (-689.737) [-688.578] -- 0:00:38
      384000 -- (-686.789) (-688.749) (-689.971) [-687.161] * [-686.695] (-688.514) (-689.953) (-689.411) -- 0:00:38
      384500 -- (-687.634) (-691.763) [-689.954] (-688.815) * (-688.215) (-692.864) (-688.901) [-687.566] -- 0:00:38
      385000 -- (-690.055) (-687.211) [-693.276] (-688.316) * (-688.308) [-694.516] (-688.371) (-686.861) -- 0:00:38

      Average standard deviation of split frequencies: 0.008467

      385500 -- (-688.789) (-687.088) (-690.700) [-686.951] * (-688.050) [-691.851] (-688.864) (-689.298) -- 0:00:38
      386000 -- (-689.267) [-687.575] (-689.122) (-686.525) * (-688.545) [-686.835] (-689.587) (-688.206) -- 0:00:38
      386500 -- (-688.704) (-686.237) (-689.885) [-686.855] * (-691.462) (-687.230) [-688.339] (-687.511) -- 0:00:38
      387000 -- [-686.246] (-688.695) (-688.256) (-687.179) * (-687.653) (-690.907) [-686.320] (-691.031) -- 0:00:38
      387500 -- (-687.319) (-687.358) [-688.025] (-688.764) * [-686.716] (-687.945) (-688.168) (-693.552) -- 0:00:37
      388000 -- [-687.256] (-687.055) (-691.679) (-690.392) * (-688.297) [-687.879] (-686.913) (-687.257) -- 0:00:37
      388500 -- [-686.555] (-691.098) (-689.859) (-686.991) * (-688.319) (-688.854) [-688.287] (-687.663) -- 0:00:37
      389000 -- (-687.215) (-690.330) [-690.156] (-687.412) * (-689.257) (-688.796) (-689.496) [-687.355] -- 0:00:37
      389500 -- [-689.106] (-691.106) (-687.397) (-686.648) * (-687.067) [-687.121] (-687.886) (-688.903) -- 0:00:37
      390000 -- (-688.928) (-689.299) [-687.102] (-686.428) * (-688.810) (-686.548) (-688.109) [-689.692] -- 0:00:37

      Average standard deviation of split frequencies: 0.008598

      390500 -- [-688.765] (-687.940) (-689.659) (-688.351) * [-686.666] (-691.368) (-686.096) (-689.557) -- 0:00:37
      391000 -- (-688.719) (-690.981) (-689.950) [-688.643] * (-689.212) (-688.396) [-688.854] (-688.734) -- 0:00:37
      391500 -- (-687.440) (-691.903) (-689.155) [-686.026] * [-689.322] (-691.172) (-691.916) (-687.986) -- 0:00:38
      392000 -- (-691.754) (-693.088) [-688.116] (-687.930) * (-687.137) (-689.893) (-691.044) [-686.553] -- 0:00:38
      392500 -- (-686.551) [-689.895] (-688.286) (-686.537) * [-689.788] (-691.036) (-687.704) (-688.288) -- 0:00:38
      393000 -- [-686.929] (-688.747) (-690.283) (-690.990) * (-688.521) [-687.526] (-688.023) (-687.095) -- 0:00:38
      393500 -- (-687.720) [-688.536] (-687.457) (-691.132) * (-686.760) [-687.104] (-689.346) (-686.509) -- 0:00:38
      394000 -- (-690.036) (-688.076) (-689.149) [-686.893] * [-688.488] (-692.618) (-687.940) (-689.492) -- 0:00:38
      394500 -- (-688.108) (-687.672) [-688.220] (-688.309) * [-691.963] (-688.522) (-688.061) (-694.621) -- 0:00:38
      395000 -- (-690.599) [-688.921] (-692.381) (-689.581) * (-689.857) [-686.542] (-688.177) (-689.915) -- 0:00:38

      Average standard deviation of split frequencies: 0.008110

      395500 -- (-688.992) (-688.413) [-692.392] (-690.695) * (-691.811) (-688.599) [-687.808] (-691.751) -- 0:00:38
      396000 -- (-687.737) (-687.864) [-687.980] (-686.861) * [-686.281] (-687.444) (-687.389) (-688.722) -- 0:00:38
      396500 -- (-686.971) [-687.678] (-694.042) (-686.860) * (-686.990) (-687.642) (-686.852) [-690.894] -- 0:00:38
      397000 -- [-687.981] (-691.266) (-690.190) (-686.019) * [-686.887] (-690.750) (-693.474) (-689.000) -- 0:00:37
      397500 -- (-689.204) (-694.011) (-689.711) [-686.795] * [-686.310] (-687.205) (-686.896) (-688.072) -- 0:00:37
      398000 -- [-691.043] (-689.362) (-693.034) (-688.718) * (-688.110) [-686.983] (-688.199) (-687.761) -- 0:00:37
      398500 -- (-689.037) [-687.437] (-688.451) (-687.412) * (-687.474) (-688.689) (-686.781) [-686.966] -- 0:00:37
      399000 -- (-687.029) [-689.102] (-686.696) (-688.250) * (-690.951) [-692.735] (-687.696) (-693.837) -- 0:00:37
      399500 -- [-688.720] (-689.359) (-685.967) (-686.988) * (-689.080) [-690.361] (-688.175) (-688.806) -- 0:00:37
      400000 -- (-689.220) [-689.230] (-687.264) (-687.532) * (-691.672) (-689.892) (-686.414) [-691.808] -- 0:00:37

      Average standard deviation of split frequencies: 0.008824

      400500 -- (-689.784) [-687.584] (-690.029) (-687.661) * (-688.070) (-687.687) [-689.321] (-689.255) -- 0:00:37
      401000 -- (-688.467) (-688.820) [-689.013] (-686.142) * (-687.714) (-687.089) (-686.391) [-686.776] -- 0:00:37
      401500 -- (-691.863) [-686.777] (-692.869) (-688.837) * [-687.021] (-687.407) (-688.233) (-690.557) -- 0:00:37
      402000 -- [-687.186] (-687.510) (-690.084) (-686.479) * (-686.880) (-690.219) [-687.637] (-692.032) -- 0:00:37
      402500 -- (-689.025) (-689.341) (-686.912) [-686.263] * (-688.353) [-689.455] (-687.099) (-692.875) -- 0:00:37
      403000 -- (-691.368) (-692.200) [-689.039] (-687.430) * (-690.101) [-688.569] (-688.283) (-686.536) -- 0:00:37
      403500 -- [-686.979] (-691.494) (-687.141) (-687.430) * (-689.074) (-689.499) (-689.113) [-686.874] -- 0:00:36
      404000 -- (-688.696) (-691.313) [-686.587] (-686.695) * (-693.198) (-689.038) [-686.154] (-686.422) -- 0:00:36
      404500 -- (-687.819) [-688.842] (-687.531) (-687.629) * (-687.958) (-692.513) [-687.136] (-689.792) -- 0:00:36
      405000 -- (-688.897) [-687.253] (-690.504) (-688.209) * [-687.594] (-690.856) (-686.942) (-686.403) -- 0:00:36

      Average standard deviation of split frequencies: 0.008781

      405500 -- (-691.135) (-686.579) (-688.236) [-691.158] * (-687.667) (-686.780) [-686.088] (-686.620) -- 0:00:36
      406000 -- [-686.371] (-686.366) (-687.197) (-687.686) * [-688.838] (-687.155) (-688.884) (-687.228) -- 0:00:36
      406500 -- [-689.467] (-686.521) (-686.840) (-692.967) * (-688.172) [-692.463] (-692.284) (-687.644) -- 0:00:36
      407000 -- (-688.195) (-687.750) [-687.715] (-687.650) * [-686.897] (-686.414) (-687.375) (-690.034) -- 0:00:36
      407500 -- [-691.535] (-690.112) (-686.600) (-686.825) * (-686.779) [-688.177] (-690.707) (-687.330) -- 0:00:37
      408000 -- [-687.109] (-687.473) (-686.194) (-694.330) * (-686.315) (-686.805) [-689.146] (-689.386) -- 0:00:37
      408500 -- (-688.557) [-687.331] (-687.722) (-689.101) * (-686.725) (-687.873) (-690.147) [-686.824] -- 0:00:37
      409000 -- [-688.307] (-686.656) (-688.713) (-688.815) * (-687.162) (-687.440) (-688.488) [-687.728] -- 0:00:37
      409500 -- (-690.192) (-687.234) (-689.815) [-688.132] * [-686.998] (-688.215) (-691.473) (-686.793) -- 0:00:37
      410000 -- [-687.030] (-689.387) (-688.752) (-687.969) * (-689.283) (-689.069) (-687.947) [-687.519] -- 0:00:37

      Average standard deviation of split frequencies: 0.009398

      410500 -- (-686.283) [-687.111] (-687.548) (-686.342) * (-686.883) (-688.372) [-690.016] (-687.187) -- 0:00:37
      411000 -- [-690.447] (-687.390) (-688.939) (-688.132) * [-689.018] (-690.503) (-690.700) (-687.776) -- 0:00:37
      411500 -- (-694.267) (-687.930) [-688.437] (-688.143) * (-686.939) (-688.333) [-694.782] (-689.252) -- 0:00:37
      412000 -- (-689.743) [-689.357] (-688.496) (-688.333) * [-689.168] (-689.937) (-692.682) (-689.734) -- 0:00:37
      412500 -- (-689.639) (-688.974) [-688.438] (-689.032) * (-690.937) (-690.222) (-687.645) [-688.189] -- 0:00:37
      413000 -- (-686.560) [-687.882] (-689.883) (-687.540) * [-688.050] (-692.983) (-688.803) (-686.172) -- 0:00:36
      413500 -- (-691.561) (-688.699) (-689.831) [-688.439] * (-689.570) [-692.071] (-688.701) (-690.327) -- 0:00:36
      414000 -- [-691.557] (-687.723) (-690.958) (-689.228) * (-689.960) (-689.938) [-689.305] (-687.548) -- 0:00:36
      414500 -- (-687.436) (-686.329) [-688.167] (-689.205) * (-688.988) (-691.451) [-689.556] (-686.505) -- 0:00:36
      415000 -- (-688.295) (-689.207) [-691.284] (-686.697) * [-687.800] (-688.514) (-689.946) (-687.820) -- 0:00:36

      Average standard deviation of split frequencies: 0.010048

      415500 -- (-686.444) (-686.708) (-687.647) [-687.735] * (-687.507) (-688.643) (-688.322) [-688.773] -- 0:00:36
      416000 -- (-688.749) [-688.769] (-689.489) (-689.084) * (-687.799) [-687.364] (-691.849) (-691.486) -- 0:00:36
      416500 -- (-688.200) (-688.059) (-689.546) [-687.076] * (-687.010) (-690.745) [-687.949] (-689.107) -- 0:00:36
      417000 -- [-686.197] (-688.248) (-687.605) (-690.862) * [-687.385] (-691.364) (-687.382) (-688.796) -- 0:00:36
      417500 -- (-688.681) (-688.158) [-689.112] (-688.170) * [-688.738] (-689.786) (-688.979) (-686.980) -- 0:00:36
      418000 -- [-688.035] (-686.619) (-687.862) (-686.531) * (-687.180) [-688.629] (-686.778) (-688.506) -- 0:00:36
      418500 -- (-699.210) (-686.309) [-687.902] (-689.770) * [-687.955] (-689.160) (-689.123) (-691.912) -- 0:00:36
      419000 -- (-686.703) (-686.346) [-686.267] (-690.470) * (-689.426) (-687.883) [-688.932] (-689.739) -- 0:00:36
      419500 -- [-686.516] (-686.327) (-690.424) (-689.190) * (-689.065) (-688.256) (-690.870) [-689.426] -- 0:00:35
      420000 -- (-687.588) [-686.374] (-692.316) (-687.275) * (-688.336) [-687.573] (-687.338) (-687.957) -- 0:00:35

      Average standard deviation of split frequencies: 0.009861

      420500 -- (-688.499) (-686.406) [-688.770] (-688.131) * (-687.812) (-694.312) [-687.357] (-688.703) -- 0:00:35
      421000 -- (-688.364) [-687.825] (-687.368) (-687.331) * (-687.553) (-687.302) [-686.652] (-689.010) -- 0:00:35
      421500 -- (-687.371) [-686.446] (-687.374) (-687.562) * [-689.539] (-690.704) (-686.867) (-687.634) -- 0:00:35
      422000 -- (-688.844) (-687.903) [-686.490] (-687.577) * (-691.241) (-690.147) (-690.825) [-687.313] -- 0:00:35
      422500 -- (-687.589) (-689.254) [-686.490] (-691.833) * (-690.617) (-688.538) [-690.146] (-691.498) -- 0:00:35
      423000 -- [-688.234] (-690.555) (-686.825) (-687.168) * (-690.613) (-689.256) (-690.284) [-687.255] -- 0:00:35
      423500 -- (-688.956) (-689.740) (-687.164) [-688.150] * (-688.672) (-686.316) [-689.347] (-688.627) -- 0:00:35
      424000 -- (-690.128) (-691.194) [-686.615] (-692.948) * (-690.203) [-687.169] (-697.614) (-688.842) -- 0:00:36
      424500 -- (-687.157) [-689.453] (-688.075) (-693.960) * (-689.300) (-690.561) [-689.000] (-688.622) -- 0:00:36
      425000 -- (-688.003) (-686.929) (-689.136) [-691.749] * (-687.808) [-689.445] (-690.077) (-688.098) -- 0:00:36

      Average standard deviation of split frequencies: 0.009222

      425500 -- [-688.912] (-689.148) (-687.922) (-689.706) * (-687.518) [-690.636] (-690.270) (-687.917) -- 0:00:36
      426000 -- (-689.185) (-688.271) [-686.228] (-691.730) * (-689.787) [-688.341] (-689.006) (-686.704) -- 0:00:36
      426500 -- (-689.569) [-687.113] (-687.618) (-686.609) * (-689.122) [-689.510] (-698.047) (-686.411) -- 0:00:36
      427000 -- (-686.735) [-688.295] (-689.728) (-689.643) * [-688.405] (-692.607) (-688.311) (-692.072) -- 0:00:36
      427500 -- [-688.383] (-687.391) (-688.667) (-686.912) * [-688.136] (-690.264) (-687.982) (-689.113) -- 0:00:36
      428000 -- [-690.373] (-688.531) (-692.485) (-688.482) * (-691.398) (-690.745) (-690.962) [-688.147] -- 0:00:36
      428500 -- (-692.082) [-687.181] (-691.575) (-687.055) * (-687.001) [-691.218] (-693.376) (-689.428) -- 0:00:36
      429000 -- (-688.260) (-687.795) [-686.418] (-688.136) * (-687.153) (-688.623) (-687.803) [-687.244] -- 0:00:35
      429500 -- (-688.478) (-690.654) [-686.670] (-687.304) * (-688.989) (-688.524) (-689.418) [-688.204] -- 0:00:35
      430000 -- (-688.105) [-687.581] (-689.953) (-687.234) * (-688.348) (-688.287) (-693.223) [-690.436] -- 0:00:35

      Average standard deviation of split frequencies: 0.009705

      430500 -- (-688.899) (-690.122) (-688.272) [-688.271] * (-686.935) (-691.363) (-688.171) [-687.819] -- 0:00:35
      431000 -- (-689.810) [-688.358] (-687.011) (-689.004) * [-687.031] (-695.161) (-686.377) (-687.276) -- 0:00:35
      431500 -- (-692.522) [-689.873] (-689.493) (-686.375) * [-687.933] (-692.059) (-687.927) (-686.933) -- 0:00:35
      432000 -- (-690.198) (-689.433) (-687.275) [-686.150] * (-692.072) [-690.495] (-686.692) (-689.165) -- 0:00:35
      432500 -- (-691.027) (-687.738) [-691.375] (-687.070) * (-686.910) [-688.026] (-687.973) (-688.197) -- 0:00:35
      433000 -- (-688.778) [-691.820] (-687.991) (-686.811) * (-687.090) (-687.043) [-688.815] (-690.029) -- 0:00:35
      433500 -- (-690.531) [-688.678] (-687.998) (-687.787) * (-687.421) [-691.619] (-686.361) (-688.228) -- 0:00:35
      434000 -- [-686.377] (-689.864) (-687.090) (-691.437) * (-690.585) [-689.206] (-688.285) (-688.042) -- 0:00:35
      434500 -- [-686.962] (-689.193) (-689.294) (-688.525) * (-688.025) (-687.747) [-687.306] (-686.689) -- 0:00:35
      435000 -- (-687.467) [-688.863] (-691.486) (-690.109) * [-686.877] (-687.751) (-693.042) (-687.262) -- 0:00:35

      Average standard deviation of split frequencies: 0.010380

      435500 -- (-686.724) [-688.166] (-688.972) (-688.993) * (-686.404) (-686.657) (-689.346) [-687.512] -- 0:00:34
      436000 -- (-687.739) (-690.610) [-686.688] (-688.478) * (-687.214) (-688.271) (-689.365) [-687.502] -- 0:00:34
      436500 -- [-689.390] (-691.199) (-687.551) (-689.811) * (-687.083) (-689.464) [-688.428] (-688.073) -- 0:00:34
      437000 -- (-690.796) (-688.902) (-688.404) [-689.300] * (-687.766) [-686.340] (-688.851) (-687.031) -- 0:00:34
      437500 -- (-691.241) (-687.376) [-687.504] (-689.696) * (-691.150) (-689.515) [-688.172] (-688.212) -- 0:00:34
      438000 -- (-691.710) [-688.003] (-692.063) (-688.269) * (-692.757) (-692.294) [-687.237] (-686.403) -- 0:00:34
      438500 -- (-686.908) (-690.170) [-688.378] (-689.241) * [-686.737] (-691.493) (-686.087) (-687.000) -- 0:00:34
      439000 -- (-690.339) (-687.260) (-686.642) [-690.239] * [-686.518] (-686.472) (-688.191) (-687.207) -- 0:00:34
      439500 -- (-687.906) (-686.838) (-687.582) [-687.968] * (-687.855) [-686.940] (-687.684) (-689.631) -- 0:00:34
      440000 -- (-688.194) [-689.573] (-688.258) (-686.836) * (-692.900) (-692.674) [-687.254] (-690.407) -- 0:00:34

      Average standard deviation of split frequencies: 0.010127

      440500 -- (-688.650) [-687.790] (-687.091) (-687.927) * (-689.113) [-687.485] (-688.755) (-686.757) -- 0:00:35
      441000 -- [-687.068] (-688.763) (-686.706) (-688.512) * [-687.131] (-686.094) (-687.618) (-686.572) -- 0:00:35
      441500 -- (-689.140) [-687.463] (-690.095) (-688.208) * (-688.426) [-689.070] (-687.872) (-688.369) -- 0:00:35
      442000 -- (-688.547) (-686.892) (-688.136) [-688.441] * (-686.480) (-689.720) [-688.114] (-691.925) -- 0:00:35
      442500 -- (-689.018) (-688.135) (-688.376) [-690.115] * (-688.780) (-690.771) (-691.429) [-689.131] -- 0:00:35
      443000 -- (-688.615) (-687.870) (-693.710) [-689.483] * (-690.629) [-688.709] (-687.800) (-691.681) -- 0:00:35
      443500 -- (-686.621) (-689.376) [-689.512] (-688.654) * (-687.806) [-688.535] (-690.241) (-687.723) -- 0:00:35
      444000 -- (-688.038) (-689.430) (-687.473) [-688.097] * (-690.995) [-691.916] (-694.887) (-687.896) -- 0:00:35
      444500 -- [-686.454] (-689.394) (-688.520) (-688.029) * (-690.786) (-687.476) (-692.216) [-687.336] -- 0:00:34
      445000 -- [-686.792] (-687.156) (-687.970) (-687.423) * (-689.220) [-686.691] (-691.054) (-688.524) -- 0:00:34

      Average standard deviation of split frequencies: 0.009442

      445500 -- [-689.710] (-688.361) (-689.479) (-688.448) * (-687.038) [-687.905] (-693.269) (-687.418) -- 0:00:34
      446000 -- (-687.804) (-689.569) (-688.014) [-687.697] * (-686.398) (-693.252) [-686.590] (-686.816) -- 0:00:34
      446500 -- (-686.175) (-692.305) [-687.778] (-687.796) * [-687.644] (-690.004) (-688.555) (-687.125) -- 0:00:34
      447000 -- [-686.597] (-690.798) (-688.014) (-688.869) * (-687.922) (-687.736) (-691.275) [-686.376] -- 0:00:34
      447500 -- (-687.825) (-690.346) [-690.999] (-691.469) * (-688.658) (-687.764) (-686.109) [-685.943] -- 0:00:34
      448000 -- (-693.295) (-688.127) [-690.618] (-691.587) * (-687.299) (-690.529) [-686.917] (-685.960) -- 0:00:34
      448500 -- [-686.832] (-689.775) (-687.960) (-691.998) * (-690.080) (-687.743) (-688.077) [-688.945] -- 0:00:34
      449000 -- [-686.235] (-689.001) (-689.784) (-687.459) * (-692.753) (-688.913) (-687.564) [-687.851] -- 0:00:34
      449500 -- (-685.967) [-686.856] (-689.440) (-688.836) * [-687.522] (-692.197) (-689.822) (-692.605) -- 0:00:34
      450000 -- (-687.399) (-686.487) [-687.971] (-689.332) * (-686.875) [-688.949] (-689.705) (-687.735) -- 0:00:34

      Average standard deviation of split frequencies: 0.009205

      450500 -- (-687.937) (-686.755) [-689.053] (-686.944) * (-689.763) (-690.236) [-686.216] (-688.113) -- 0:00:34
      451000 -- [-690.452] (-692.683) (-690.904) (-691.632) * (-687.204) [-688.411] (-687.658) (-686.475) -- 0:00:34
      451500 -- (-690.384) (-693.050) (-691.710) [-687.364] * (-688.741) (-690.612) [-688.595] (-686.895) -- 0:00:34
      452000 -- [-688.328] (-686.868) (-691.548) (-691.404) * [-686.569] (-690.917) (-687.670) (-693.204) -- 0:00:33
      452500 -- [-686.201] (-688.792) (-691.318) (-696.721) * (-688.626) (-693.636) (-688.399) [-687.477] -- 0:00:33
      453000 -- (-686.746) [-689.142] (-687.511) (-689.154) * (-689.764) [-690.234] (-686.946) (-687.903) -- 0:00:33
      453500 -- (-687.089) [-687.836] (-687.735) (-688.195) * [-688.202] (-689.799) (-688.640) (-687.984) -- 0:00:33
      454000 -- (-687.159) (-693.290) (-689.041) [-687.950] * (-689.607) [-690.202] (-686.242) (-691.084) -- 0:00:33
      454500 -- (-687.375) [-691.943] (-689.070) (-686.908) * (-692.826) (-687.325) [-687.532] (-686.705) -- 0:00:33
      455000 -- (-686.564) [-692.710] (-689.713) (-688.233) * (-686.703) (-687.335) (-687.856) [-690.485] -- 0:00:33

      Average standard deviation of split frequencies: 0.008753

      455500 -- (-688.321) [-689.494] (-688.807) (-686.762) * (-687.751) (-687.102) (-688.218) [-688.694] -- 0:00:33
      456000 -- (-689.927) (-687.481) (-687.438) [-686.341] * (-686.440) (-690.433) (-687.833) [-688.432] -- 0:00:33
      456500 -- [-687.990] (-687.061) (-688.688) (-687.136) * (-686.965) (-689.737) [-688.630] (-690.879) -- 0:00:33
      457000 -- (-687.451) (-687.430) (-689.800) [-688.121] * [-687.150] (-688.936) (-689.086) (-687.085) -- 0:00:34
      457500 -- [-688.023] (-689.277) (-688.690) (-687.580) * [-686.555] (-688.805) (-689.769) (-687.994) -- 0:00:34
      458000 -- [-691.315] (-688.406) (-688.153) (-690.021) * (-688.814) (-687.254) (-689.557) [-689.576] -- 0:00:34
      458500 -- [-688.351] (-689.788) (-688.069) (-688.094) * (-687.789) (-686.496) [-688.011] (-687.653) -- 0:00:34
      459000 -- [-686.829] (-686.613) (-687.180) (-686.859) * (-686.966) [-687.410] (-687.771) (-690.581) -- 0:00:34
      459500 -- [-686.987] (-687.199) (-691.330) (-687.205) * [-686.635] (-687.363) (-690.052) (-690.807) -- 0:00:34
      460000 -- (-688.886) [-688.742] (-696.572) (-689.990) * [-687.521] (-686.366) (-689.181) (-689.048) -- 0:00:34

      Average standard deviation of split frequencies: 0.009414

      460500 -- [-687.228] (-689.978) (-687.882) (-689.686) * (-688.927) (-688.839) [-687.878] (-691.489) -- 0:00:33
      461000 -- (-688.077) (-689.780) (-687.255) [-689.568] * (-689.455) [-688.332] (-687.061) (-686.111) -- 0:00:33
      461500 -- (-687.125) [-692.793] (-687.539) (-686.213) * (-689.818) (-691.304) [-688.086] (-687.735) -- 0:00:33
      462000 -- (-687.958) [-686.228] (-690.461) (-687.075) * (-689.093) (-689.343) [-689.285] (-686.211) -- 0:00:33
      462500 -- (-688.253) (-687.445) (-696.729) [-687.533] * (-688.095) (-690.420) (-688.558) [-686.493] -- 0:00:33
      463000 -- [-688.857] (-688.136) (-692.775) (-686.795) * (-690.159) [-688.465] (-690.096) (-687.181) -- 0:00:33
      463500 -- (-690.725) (-689.055) [-687.383] (-686.437) * [-687.920] (-687.204) (-690.211) (-688.787) -- 0:00:33
      464000 -- [-687.551] (-688.088) (-688.982) (-689.512) * [-687.420] (-688.774) (-691.235) (-687.313) -- 0:00:33
      464500 -- [-687.943] (-686.652) (-686.791) (-690.540) * [-686.322] (-690.522) (-687.284) (-688.198) -- 0:00:33
      465000 -- (-689.068) (-686.732) (-686.554) [-687.852] * (-687.119) (-686.813) [-686.047] (-687.464) -- 0:00:33

      Average standard deviation of split frequencies: 0.009442

      465500 -- (-688.260) [-687.668] (-686.487) (-687.231) * (-688.327) [-687.436] (-690.563) (-687.223) -- 0:00:33
      466000 -- (-688.755) (-687.736) (-690.010) [-688.185] * (-686.791) (-689.088) [-686.425] (-686.683) -- 0:00:33
      466500 -- (-688.952) [-688.265] (-688.902) (-688.028) * (-687.951) (-690.314) [-687.924] (-686.105) -- 0:00:33
      467000 -- (-689.251) (-695.012) [-687.309] (-689.402) * [-687.001] (-689.307) (-686.295) (-686.590) -- 0:00:33
      467500 -- (-686.227) (-687.859) [-690.877] (-690.382) * (-690.019) (-689.160) [-687.090] (-693.687) -- 0:00:33
      468000 -- (-686.409) [-688.113] (-688.175) (-688.360) * [-689.583] (-688.976) (-687.605) (-686.263) -- 0:00:32
      468500 -- (-687.027) [-688.151] (-692.248) (-691.151) * [-687.329] (-692.192) (-688.721) (-687.164) -- 0:00:32
      469000 -- (-687.363) (-688.504) [-692.571] (-691.999) * (-688.363) [-688.535] (-687.061) (-690.198) -- 0:00:32
      469500 -- [-689.020] (-688.070) (-687.369) (-689.055) * (-687.588) (-689.807) (-692.186) [-689.424] -- 0:00:32
      470000 -- (-688.340) [-690.290] (-689.307) (-688.223) * (-688.367) [-689.569] (-690.255) (-686.394) -- 0:00:32

      Average standard deviation of split frequencies: 0.009749

      470500 -- (-687.862) (-688.742) (-688.521) [-687.223] * (-687.926) (-688.884) (-689.179) [-688.274] -- 0:00:32
      471000 -- (-688.181) [-688.363] (-688.470) (-689.853) * (-689.076) (-688.376) [-691.623] (-686.235) -- 0:00:32
      471500 -- [-690.652] (-689.994) (-687.548) (-686.347) * (-686.638) (-688.970) [-688.160] (-686.588) -- 0:00:32
      472000 -- [-686.689] (-687.734) (-687.291) (-687.343) * (-687.688) (-688.255) [-688.442] (-691.917) -- 0:00:32
      472500 -- (-686.518) (-686.515) (-688.743) [-687.735] * [-686.958] (-690.857) (-690.653) (-689.953) -- 0:00:32
      473000 -- (-687.290) (-687.215) [-688.342] (-687.328) * [-686.896] (-695.615) (-688.962) (-690.630) -- 0:00:32
      473500 -- (-690.029) [-688.685] (-692.562) (-697.415) * (-689.571) (-691.761) [-686.662] (-689.147) -- 0:00:33
      474000 -- (-690.002) (-688.024) [-687.644] (-689.272) * (-688.696) [-690.122] (-688.952) (-691.824) -- 0:00:33
      474500 -- [-688.843] (-687.608) (-693.102) (-690.738) * (-687.356) [-686.886] (-689.799) (-687.772) -- 0:00:33
      475000 -- [-687.714] (-687.822) (-695.075) (-687.459) * [-687.677] (-686.540) (-688.094) (-688.918) -- 0:00:33

      Average standard deviation of split frequencies: 0.009705

      475500 -- [-686.671] (-687.708) (-692.004) (-688.433) * [-687.329] (-689.761) (-690.230) (-692.453) -- 0:00:33
      476000 -- (-691.350) [-687.308] (-690.654) (-688.440) * (-688.814) (-687.607) (-688.626) [-686.988] -- 0:00:33
      476500 -- (-693.565) (-687.800) [-691.834] (-688.367) * [-686.653] (-691.973) (-687.917) (-688.159) -- 0:00:32
      477000 -- (-687.574) [-687.673] (-687.813) (-686.598) * (-687.215) (-688.171) [-688.471] (-689.465) -- 0:00:32
      477500 -- (-688.692) (-687.761) (-687.096) [-688.342] * (-687.418) (-687.928) [-689.799] (-688.385) -- 0:00:32
      478000 -- (-688.258) (-688.519) [-687.126] (-689.902) * (-686.330) (-689.415) [-691.268] (-693.243) -- 0:00:32
      478500 -- [-688.230] (-687.698) (-687.475) (-688.850) * (-687.029) [-690.149] (-691.701) (-687.514) -- 0:00:32
      479000 -- [-686.939] (-687.282) (-687.066) (-686.921) * (-687.295) (-686.592) (-692.471) [-686.019] -- 0:00:32
      479500 -- (-690.185) [-686.992] (-687.449) (-687.580) * (-688.535) (-688.710) (-689.907) [-687.284] -- 0:00:32
      480000 -- [-689.534] (-689.504) (-687.155) (-691.479) * (-686.806) (-688.530) (-688.791) [-687.778] -- 0:00:32

      Average standard deviation of split frequencies: 0.009677

      480500 -- (-688.990) (-686.594) (-687.560) [-691.248] * [-686.495] (-688.960) (-688.719) (-692.063) -- 0:00:32
      481000 -- (-686.596) [-687.827] (-688.133) (-687.436) * (-688.250) (-690.321) [-688.434] (-688.101) -- 0:00:32
      481500 -- (-689.888) (-690.973) [-687.093] (-687.952) * (-688.072) (-687.776) [-686.271] (-686.968) -- 0:00:32
      482000 -- (-686.529) (-693.858) (-691.555) [-688.396] * (-688.044) (-691.434) (-688.114) [-688.204] -- 0:00:32
      482500 -- [-687.014] (-689.810) (-687.192) (-687.174) * [-690.468] (-692.337) (-688.114) (-687.715) -- 0:00:32
      483000 -- (-690.053) (-688.935) [-686.362] (-689.164) * (-691.566) (-690.480) [-688.411] (-686.221) -- 0:00:32
      483500 -- (-693.197) (-687.584) [-688.680] (-689.320) * (-689.021) [-686.637] (-688.433) (-692.245) -- 0:00:32
      484000 -- [-690.498] (-689.339) (-687.912) (-691.554) * (-687.928) [-686.740] (-689.551) (-688.326) -- 0:00:31
      484500 -- (-686.636) (-688.291) [-687.984] (-687.303) * [-686.795] (-687.303) (-688.050) (-686.615) -- 0:00:31
      485000 -- [-687.346] (-686.818) (-687.805) (-689.656) * (-689.458) [-686.445] (-686.689) (-689.483) -- 0:00:31

      Average standard deviation of split frequencies: 0.009312

      485500 -- (-689.574) (-687.410) [-687.141] (-687.660) * [-687.692] (-689.853) (-686.915) (-687.738) -- 0:00:31
      486000 -- (-687.630) (-689.037) [-686.596] (-686.998) * (-687.595) [-690.044] (-686.640) (-690.621) -- 0:00:31
      486500 -- (-687.629) [-689.806] (-689.048) (-688.224) * (-688.301) (-686.939) (-686.418) [-688.646] -- 0:00:31
      487000 -- (-685.999) (-687.988) (-688.868) [-687.447] * (-688.492) (-686.897) (-686.438) [-688.417] -- 0:00:31
      487500 -- (-690.107) [-686.282] (-689.594) (-688.717) * (-688.732) [-688.327] (-687.431) (-688.609) -- 0:00:31
      488000 -- [-688.610] (-687.611) (-685.888) (-686.679) * [-686.416] (-689.099) (-686.024) (-687.609) -- 0:00:31
      488500 -- (-687.298) (-689.063) [-686.706] (-689.377) * (-686.647) (-687.341) [-685.976] (-686.998) -- 0:00:31
      489000 -- (-686.750) [-688.160] (-690.817) (-688.466) * (-686.617) (-688.375) [-686.167] (-686.939) -- 0:00:31
      489500 -- (-689.232) (-688.411) (-691.605) [-687.432] * (-690.682) [-686.606] (-686.081) (-688.861) -- 0:00:31
      490000 -- [-689.064] (-688.920) (-691.128) (-688.424) * (-688.402) (-687.012) (-689.214) [-686.935] -- 0:00:32

      Average standard deviation of split frequencies: 0.009159

      490500 -- (-687.834) (-686.618) [-687.598] (-688.690) * (-687.343) (-686.359) [-688.650] (-689.238) -- 0:00:32
      491000 -- (-686.914) (-689.244) (-687.381) [-688.924] * (-688.337) (-694.183) [-690.079] (-688.660) -- 0:00:32
      491500 -- (-691.808) (-690.790) (-687.894) [-687.502] * (-687.883) (-688.764) [-687.924] (-687.370) -- 0:00:32
      492000 -- (-691.013) (-686.851) (-689.377) [-687.723] * (-688.039) (-689.796) (-686.436) [-689.352] -- 0:00:32
      492500 -- (-689.964) [-689.922] (-687.625) (-687.051) * (-692.597) (-689.661) [-687.586] (-687.608) -- 0:00:31
      493000 -- (-686.883) (-688.326) [-687.606] (-687.017) * (-691.329) (-689.150) [-687.247] (-693.143) -- 0:00:31
      493500 -- [-690.911] (-697.142) (-686.492) (-687.488) * (-686.344) [-688.978] (-691.376) (-686.343) -- 0:00:31
      494000 -- (-697.666) (-695.622) (-688.689) [-688.829] * (-687.322) (-689.744) (-689.510) [-686.924] -- 0:00:31
      494500 -- (-690.108) (-691.120) [-687.027] (-687.579) * [-688.548] (-689.131) (-687.722) (-694.167) -- 0:00:31
      495000 -- [-688.559] (-689.906) (-688.163) (-687.925) * (-686.604) (-691.052) [-690.246] (-689.434) -- 0:00:31

      Average standard deviation of split frequencies: 0.009187

      495500 -- (-689.666) [-687.111] (-689.288) (-688.037) * (-686.540) (-689.697) (-692.898) [-688.205] -- 0:00:31
      496000 -- (-687.989) (-688.426) [-687.592] (-688.568) * [-687.724] (-688.230) (-687.962) (-688.325) -- 0:00:31
      496500 -- (-687.765) (-692.416) (-696.596) [-688.285] * (-688.107) (-689.473) (-690.056) [-687.788] -- 0:00:31
      497000 -- (-688.077) (-688.386) [-689.603] (-687.733) * (-689.151) (-690.573) (-688.284) [-687.288] -- 0:00:31
      497500 -- (-693.450) (-687.293) [-687.245] (-689.814) * (-687.785) (-689.002) [-686.700] (-686.951) -- 0:00:31
      498000 -- (-686.559) [-686.364] (-687.493) (-688.343) * (-689.464) (-687.121) [-690.655] (-688.889) -- 0:00:31
      498500 -- (-687.823) (-689.102) [-686.776] (-687.635) * (-688.020) [-687.234] (-689.726) (-687.608) -- 0:00:31
      499000 -- [-687.256] (-688.265) (-688.066) (-686.731) * (-688.901) (-687.337) [-687.923] (-686.173) -- 0:00:31
      499500 -- (-688.876) (-689.388) (-687.739) [-688.444] * (-688.124) [-689.079] (-686.164) (-687.622) -- 0:00:31
      500000 -- (-686.489) (-689.030) [-687.954] (-687.836) * [-690.015] (-686.915) (-688.328) (-691.572) -- 0:00:31

      Average standard deviation of split frequencies: 0.008600

      500500 -- (-686.199) (-686.593) [-690.140] (-686.870) * (-690.664) (-688.994) [-689.526] (-691.410) -- 0:00:30
      501000 -- (-689.167) (-690.717) [-686.905] (-687.452) * [-688.434] (-688.120) (-686.572) (-685.875) -- 0:00:30
      501500 -- (-687.175) (-686.255) [-688.335] (-688.083) * (-686.945) (-686.986) (-690.807) [-685.920] -- 0:00:30
      502000 -- [-692.478] (-688.441) (-691.436) (-686.545) * (-688.463) (-686.406) (-688.350) [-688.709] -- 0:00:30
      502500 -- (-687.743) (-688.443) (-688.333) [-687.925] * [-687.537] (-686.359) (-689.769) (-687.314) -- 0:00:30
      503000 -- [-691.312] (-686.737) (-688.629) (-687.556) * (-687.992) (-686.214) (-690.010) [-687.184] -- 0:00:30
      503500 -- (-691.983) (-686.869) [-687.507] (-688.557) * (-687.648) [-686.214] (-686.912) (-687.197) -- 0:00:30
      504000 -- [-688.074] (-687.237) (-690.468) (-690.027) * (-690.179) (-689.953) [-686.271] (-687.797) -- 0:00:30
      504500 -- (-689.137) (-689.526) (-686.852) [-687.216] * [-687.619] (-686.806) (-686.968) (-687.835) -- 0:00:30
      505000 -- (-686.894) (-686.553) (-686.828) [-690.607] * (-686.255) (-686.943) (-694.322) [-687.294] -- 0:00:30

      Average standard deviation of split frequencies: 0.008633

      505500 -- (-686.951) [-687.944] (-691.898) (-688.727) * [-687.438] (-687.916) (-688.714) (-687.396) -- 0:00:30
      506000 -- [-686.575] (-689.301) (-694.845) (-686.372) * [-689.903] (-692.221) (-686.559) (-687.164) -- 0:00:30
      506500 -- (-687.441) [-687.340] (-692.085) (-686.938) * (-687.944) [-687.703] (-692.080) (-688.358) -- 0:00:31
      507000 -- (-687.105) (-689.285) [-692.351] (-691.095) * [-688.907] (-687.571) (-690.638) (-689.687) -- 0:00:31
      507500 -- (-688.001) (-688.627) (-690.702) [-686.264] * (-687.754) [-689.502] (-686.653) (-689.797) -- 0:00:31
      508000 -- (-687.793) (-692.574) [-693.916] (-689.913) * [-685.951] (-686.984) (-687.076) (-687.410) -- 0:00:30
      508500 -- (-688.294) [-693.887] (-688.118) (-687.507) * [-688.326] (-689.794) (-686.777) (-690.926) -- 0:00:30
      509000 -- (-687.155) [-689.450] (-689.885) (-688.298) * (-687.184) (-690.524) (-690.232) [-687.854] -- 0:00:30
      509500 -- (-687.228) [-687.094] (-693.121) (-691.175) * (-691.532) (-691.106) (-688.620) [-686.475] -- 0:00:30
      510000 -- (-687.564) (-688.141) (-693.447) [-688.224] * [-687.371] (-689.183) (-687.330) (-687.923) -- 0:00:30

      Average standard deviation of split frequencies: 0.008739

      510500 -- (-687.227) (-686.412) (-689.260) [-688.244] * (-688.517) [-689.572] (-687.985) (-688.416) -- 0:00:30
      511000 -- (-687.333) [-687.744] (-689.213) (-687.896) * (-686.651) (-689.617) [-686.313] (-686.839) -- 0:00:30
      511500 -- (-690.147) (-691.087) [-688.488] (-687.512) * (-687.131) (-688.339) (-687.995) [-688.142] -- 0:00:30
      512000 -- (-687.727) [-688.041] (-687.460) (-688.395) * (-690.296) [-687.534] (-691.002) (-687.035) -- 0:00:30
      512500 -- (-690.080) [-687.533] (-689.209) (-690.595) * (-687.541) [-687.490] (-690.342) (-687.355) -- 0:00:30
      513000 -- (-689.067) (-686.933) [-688.069] (-687.486) * [-690.378] (-687.563) (-690.742) (-686.423) -- 0:00:30
      513500 -- (-687.931) (-686.522) [-686.826] (-687.528) * [-688.294] (-687.640) (-687.618) (-686.855) -- 0:00:30
      514000 -- (-689.571) (-687.155) (-686.551) [-687.289] * (-688.376) [-686.967] (-692.359) (-689.117) -- 0:00:30
      514500 -- [-688.582] (-688.324) (-689.007) (-687.081) * (-692.456) (-689.615) (-692.729) [-688.309] -- 0:00:30
      515000 -- (-687.750) (-689.164) [-687.734] (-688.341) * (-688.889) (-688.627) [-687.780] (-687.887) -- 0:00:30

      Average standard deviation of split frequencies: 0.008527

      515500 -- (-686.703) [-690.145] (-688.389) (-686.677) * (-690.591) (-688.616) (-689.851) [-686.576] -- 0:00:30
      516000 -- (-692.677) (-687.114) (-689.831) [-688.281] * (-688.814) (-687.200) (-688.639) [-688.524] -- 0:00:30
      516500 -- (-691.958) [-689.241] (-686.414) (-688.724) * (-688.477) (-688.855) (-686.662) [-690.630] -- 0:00:29
      517000 -- (-691.255) [-689.891] (-686.990) (-690.547) * (-687.268) [-687.129] (-686.768) (-690.436) -- 0:00:29
      517500 -- (-690.613) (-686.338) [-688.626] (-687.772) * [-690.355] (-688.867) (-687.931) (-687.918) -- 0:00:29
      518000 -- (-688.449) (-688.315) [-686.720] (-690.764) * (-689.346) (-689.965) (-687.199) [-688.672] -- 0:00:29
      518500 -- (-689.172) [-688.185] (-687.696) (-687.269) * (-689.539) (-689.435) [-686.954] (-689.387) -- 0:00:29
      519000 -- (-687.365) [-687.867] (-688.641) (-686.300) * [-689.253] (-688.618) (-686.973) (-692.893) -- 0:00:29
      519500 -- (-689.967) [-687.876] (-689.714) (-688.433) * (-687.959) (-692.753) [-686.729] (-692.242) -- 0:00:29
      520000 -- (-689.210) [-688.462] (-688.944) (-690.147) * [-689.478] (-691.790) (-688.584) (-689.472) -- 0:00:29

      Average standard deviation of split frequencies: 0.008209

      520500 -- (-689.753) (-686.287) (-686.691) [-689.825] * (-687.837) (-693.097) [-687.561] (-689.515) -- 0:00:29
      521000 -- (-689.300) (-687.488) [-689.963] (-687.862) * (-695.601) [-688.415] (-689.249) (-688.936) -- 0:00:29
      521500 -- (-687.505) (-687.540) [-686.402] (-690.001) * (-690.119) (-688.272) (-687.837) [-686.909] -- 0:00:29
      522000 -- (-689.621) [-689.464] (-690.869) (-690.772) * (-688.719) (-688.383) [-686.229] (-687.065) -- 0:00:29
      522500 -- (-687.314) [-686.465] (-692.232) (-689.705) * (-688.675) [-688.279] (-687.174) (-687.316) -- 0:00:29
      523000 -- (-692.023) (-688.089) [-696.063] (-687.439) * (-686.286) (-687.966) [-688.599] (-691.194) -- 0:00:30
      523500 -- (-687.274) (-692.216) (-687.323) [-688.396] * (-686.412) [-688.856] (-688.744) (-692.593) -- 0:00:30
      524000 -- (-687.048) (-694.030) [-689.810] (-688.123) * (-690.384) (-690.295) (-688.643) [-689.609] -- 0:00:29
      524500 -- (-687.170) [-688.476] (-696.516) (-688.222) * (-688.171) (-688.928) [-687.415] (-688.465) -- 0:00:29
      525000 -- (-686.472) (-687.921) (-690.982) [-688.073] * (-688.776) [-687.148] (-691.255) (-688.226) -- 0:00:29

      Average standard deviation of split frequencies: 0.008245

      525500 -- (-689.947) (-690.932) (-690.617) [-693.949] * (-690.754) [-690.045] (-692.526) (-686.954) -- 0:00:29
      526000 -- [-689.064] (-688.966) (-689.154) (-691.302) * (-689.668) (-687.345) (-692.148) [-686.617] -- 0:00:29
      526500 -- (-692.915) [-686.558] (-688.930) (-689.780) * [-690.222] (-687.088) (-688.823) (-686.721) -- 0:00:29
      527000 -- (-688.015) [-687.578] (-692.209) (-687.687) * (-686.878) (-687.354) [-689.053] (-687.156) -- 0:00:29
      527500 -- (-687.114) (-687.862) (-689.205) [-687.833] * (-689.218) (-687.821) [-688.724] (-686.987) -- 0:00:29
      528000 -- [-687.931] (-688.790) (-687.587) (-686.943) * (-688.911) (-689.685) (-687.585) [-688.032] -- 0:00:29
      528500 -- (-686.893) (-687.197) [-687.483] (-686.420) * (-686.289) [-686.988] (-689.173) (-689.358) -- 0:00:29
      529000 -- [-687.039] (-688.863) (-687.222) (-686.590) * (-687.289) (-689.417) (-689.696) [-693.511] -- 0:00:29
      529500 -- [-687.199] (-692.108) (-690.782) (-689.281) * (-686.530) (-688.698) (-686.295) [-692.032] -- 0:00:29
      530000 -- [-686.766] (-689.078) (-687.131) (-689.746) * [-688.513] (-688.326) (-686.299) (-689.188) -- 0:00:29

      Average standard deviation of split frequencies: 0.008350

      530500 -- [-687.530] (-689.117) (-691.130) (-687.702) * (-686.792) (-690.184) (-687.015) [-688.619] -- 0:00:29
      531000 -- (-688.390) [-691.735] (-688.295) (-691.778) * (-691.687) [-692.534] (-688.700) (-688.332) -- 0:00:29
      531500 -- (-688.110) (-687.289) [-686.308] (-688.670) * (-688.601) [-687.076] (-690.466) (-689.221) -- 0:00:29
      532000 -- (-689.879) (-687.768) [-687.151] (-691.890) * [-688.955] (-691.653) (-687.577) (-690.399) -- 0:00:29
      532500 -- (-686.115) [-688.407] (-686.763) (-688.538) * [-687.862] (-687.101) (-691.871) (-692.047) -- 0:00:28
      533000 -- (-686.156) (-689.910) (-690.526) [-687.718] * (-687.942) (-688.292) [-686.789] (-687.708) -- 0:00:28
      533500 -- (-687.176) (-687.610) (-689.280) [-691.946] * (-688.880) [-688.006] (-686.662) (-687.114) -- 0:00:28
      534000 -- (-686.887) (-690.966) (-688.521) [-689.494] * (-691.052) (-687.672) [-688.876] (-687.705) -- 0:00:28
      534500 -- (-689.887) (-687.383) [-689.830] (-689.461) * (-687.944) [-689.216] (-689.643) (-687.956) -- 0:00:28
      535000 -- (-691.831) [-687.159] (-690.889) (-688.495) * (-688.546) (-688.300) [-687.207] (-687.790) -- 0:00:28

      Average standard deviation of split frequencies: 0.008091

      535500 -- (-691.658) [-687.838] (-689.447) (-688.968) * (-688.082) (-688.478) (-687.297) [-691.002] -- 0:00:28
      536000 -- (-690.107) (-688.602) (-687.661) [-686.455] * (-687.851) (-686.584) [-690.327] (-687.192) -- 0:00:28
      536500 -- [-687.127] (-688.957) (-688.130) (-689.476) * [-688.363] (-686.584) (-688.478) (-686.861) -- 0:00:28
      537000 -- (-689.728) (-686.281) (-690.072) [-691.930] * (-687.493) (-689.702) [-687.215] (-687.636) -- 0:00:28
      537500 -- (-686.789) (-687.146) [-688.064] (-688.427) * [-687.135] (-688.647) (-689.286) (-686.592) -- 0:00:28
      538000 -- [-686.444] (-687.855) (-691.069) (-691.012) * [-688.156] (-689.407) (-687.616) (-686.635) -- 0:00:28
      538500 -- (-688.071) (-692.059) [-693.570] (-688.848) * (-690.316) [-688.581] (-688.514) (-686.691) -- 0:00:28
      539000 -- (-688.431) (-689.919) [-691.071] (-691.420) * (-688.359) [-693.091] (-686.489) (-687.961) -- 0:00:28
      539500 -- (-689.264) [-686.012] (-688.638) (-687.540) * (-688.202) (-688.130) [-686.016] (-686.304) -- 0:00:29
      540000 -- [-693.276] (-687.060) (-688.570) (-691.265) * (-687.659) [-687.831] (-686.447) (-687.175) -- 0:00:28

      Average standard deviation of split frequencies: 0.008312

      540500 -- (-688.488) (-687.246) [-688.578] (-687.539) * [-686.824] (-688.224) (-687.153) (-686.773) -- 0:00:28
      541000 -- (-692.177) [-691.045] (-691.453) (-691.551) * [-693.038] (-691.007) (-688.565) (-689.737) -- 0:00:28
      541500 -- (-689.136) (-687.561) (-688.036) [-689.972] * [-685.988] (-687.163) (-686.929) (-690.030) -- 0:00:28
      542000 -- (-692.032) (-687.531) [-686.503] (-686.666) * (-688.666) [-686.579] (-688.503) (-693.515) -- 0:00:28
      542500 -- (-686.737) (-687.641) (-687.696) [-688.129] * (-690.001) [-686.716] (-687.952) (-686.947) -- 0:00:28
      543000 -- [-687.451] (-687.079) (-688.984) (-691.682) * (-689.861) (-688.747) (-686.814) [-686.181] -- 0:00:28
      543500 -- [-687.556] (-690.472) (-689.512) (-691.477) * (-688.583) (-690.875) (-688.015) [-686.099] -- 0:00:28
      544000 -- [-687.369] (-688.890) (-689.797) (-692.223) * (-686.664) (-687.814) [-686.502] (-687.932) -- 0:00:28
      544500 -- (-688.373) (-690.283) [-687.938] (-687.737) * (-688.157) (-687.778) [-686.447] (-688.831) -- 0:00:28
      545000 -- (-690.056) [-689.000] (-687.530) (-687.384) * (-689.623) [-687.679] (-692.164) (-687.101) -- 0:00:28

      Average standard deviation of split frequencies: 0.008806

      545500 -- (-689.467) [-690.439] (-686.912) (-688.293) * (-687.327) (-689.967) [-687.044] (-687.638) -- 0:00:28
      546000 -- (-693.445) [-686.577] (-690.298) (-687.394) * (-694.169) (-686.554) [-688.135] (-688.472) -- 0:00:28
      546500 -- [-688.255] (-688.761) (-688.233) (-687.100) * (-686.204) (-697.297) [-686.797] (-691.057) -- 0:00:28
      547000 -- (-687.841) (-693.124) [-686.806] (-688.495) * (-687.867) (-690.101) (-687.714) [-692.977] -- 0:00:28
      547500 -- [-686.592] (-688.318) (-688.441) (-688.072) * (-686.686) [-689.390] (-688.133) (-689.486) -- 0:00:28
      548000 -- (-687.063) [-696.255] (-688.220) (-688.452) * (-686.765) [-687.196] (-688.733) (-691.627) -- 0:00:28
      548500 -- (-686.170) (-688.267) [-687.596] (-694.961) * (-687.132) (-686.874) [-686.473] (-689.814) -- 0:00:27
      549000 -- (-691.098) [-689.952] (-688.628) (-691.482) * (-689.197) (-686.619) [-686.134] (-689.145) -- 0:00:27
      549500 -- (-688.380) (-688.814) (-687.340) [-687.880] * (-691.137) (-689.672) (-687.226) [-687.401] -- 0:00:27
      550000 -- (-686.826) (-687.063) (-689.410) [-688.046] * (-689.704) (-691.229) [-689.404] (-689.138) -- 0:00:27

      Average standard deviation of split frequencies: 0.008789

      550500 -- (-689.455) [-686.752] (-692.578) (-688.403) * [-689.123] (-689.250) (-693.823) (-687.489) -- 0:00:27
      551000 -- (-689.499) [-686.957] (-687.527) (-686.863) * (-686.815) (-687.511) (-687.711) [-686.405] -- 0:00:27
      551500 -- (-688.427) [-686.832] (-688.269) (-690.675) * [-686.330] (-688.275) (-690.275) (-688.920) -- 0:00:27
      552000 -- (-686.419) (-689.318) [-686.763] (-691.386) * [-689.704] (-686.957) (-689.941) (-693.719) -- 0:00:27
      552500 -- (-688.122) (-686.901) (-690.981) [-687.588] * (-687.844) [-687.440] (-687.384) (-689.314) -- 0:00:27
      553000 -- (-687.815) [-686.448] (-689.269) (-691.285) * (-688.664) (-688.178) (-687.740) [-687.690] -- 0:00:27
      553500 -- (-690.340) [-687.069] (-690.175) (-691.301) * [-687.128] (-688.685) (-689.291) (-689.203) -- 0:00:27
      554000 -- (-686.451) [-687.550] (-690.913) (-687.237) * (-687.130) (-688.830) (-686.963) [-687.503] -- 0:00:27
      554500 -- (-687.069) (-691.110) (-687.445) [-688.382] * (-688.615) (-690.074) [-690.314] (-687.751) -- 0:00:27
      555000 -- [-690.111] (-695.659) (-688.450) (-690.004) * (-688.231) (-687.584) [-686.367] (-689.621) -- 0:00:27

      Average standard deviation of split frequencies: 0.008592

      555500 -- (-688.258) (-691.385) (-690.797) [-687.687] * (-690.387) [-687.513] (-686.744) (-689.641) -- 0:00:27
      556000 -- (-688.575) [-687.903] (-687.713) (-690.515) * [-688.161] (-691.293) (-687.987) (-688.388) -- 0:00:27
      556500 -- [-693.478] (-686.865) (-687.488) (-689.723) * (-688.826) [-686.583] (-687.984) (-690.850) -- 0:00:27
      557000 -- (-691.385) (-687.430) [-688.415] (-687.083) * (-690.212) (-688.543) (-687.574) [-688.334] -- 0:00:27
      557500 -- [-687.784] (-687.892) (-689.890) (-688.941) * (-691.807) (-687.626) [-687.370] (-688.761) -- 0:00:27
      558000 -- [-688.860] (-687.060) (-686.223) (-689.283) * (-687.576) (-686.501) [-687.824] (-688.275) -- 0:00:27
      558500 -- (-689.149) (-686.231) (-688.553) [-687.398] * (-686.485) [-691.977] (-687.300) (-693.514) -- 0:00:27
      559000 -- (-688.293) [-686.096] (-689.034) (-686.319) * (-689.737) (-687.859) (-688.782) [-689.851] -- 0:00:27
      559500 -- [-689.624] (-686.614) (-692.631) (-688.148) * (-691.630) (-686.832) [-689.222] (-686.846) -- 0:00:27
      560000 -- (-688.474) (-689.173) (-690.211) [-689.622] * [-690.443] (-686.382) (-689.179) (-688.139) -- 0:00:27

      Average standard deviation of split frequencies: 0.008184

      560500 -- (-689.084) (-687.991) (-692.089) [-688.641] * (-689.327) (-686.286) (-688.813) [-689.444] -- 0:00:27
      561000 -- (-687.597) (-687.667) [-689.117] (-687.427) * (-689.899) [-687.732] (-689.148) (-687.439) -- 0:00:27
      561500 -- [-687.491] (-691.286) (-693.247) (-688.192) * (-690.230) (-688.986) (-687.858) [-690.935] -- 0:00:27
      562000 -- (-688.548) [-690.927] (-690.724) (-693.496) * [-694.494] (-695.669) (-687.611) (-689.893) -- 0:00:27
      562500 -- [-687.254] (-689.406) (-687.859) (-689.509) * (-689.548) (-689.316) (-687.353) [-688.933] -- 0:00:27
      563000 -- (-686.840) (-687.250) [-688.343] (-688.691) * (-687.551) [-687.792] (-686.763) (-689.821) -- 0:00:27
      563500 -- (-686.351) (-686.151) (-688.199) [-687.926] * (-687.329) [-693.522] (-687.513) (-687.886) -- 0:00:27
      564000 -- (-687.299) (-686.889) [-687.099] (-688.569) * [-691.313] (-688.372) (-686.972) (-689.445) -- 0:00:27
      564500 -- (-687.788) (-687.718) [-690.613] (-689.206) * [-688.254] (-688.800) (-687.030) (-690.422) -- 0:00:27
      565000 -- [-687.360] (-687.179) (-686.912) (-688.649) * (-688.306) [-688.802] (-686.900) (-689.159) -- 0:00:26

      Average standard deviation of split frequencies: 0.008717

      565500 -- (-687.122) [-691.914] (-690.005) (-688.920) * (-688.447) [-691.654] (-689.506) (-688.609) -- 0:00:26
      566000 -- (-688.118) [-688.588] (-686.916) (-690.059) * (-689.432) (-688.243) [-686.534] (-686.455) -- 0:00:26
      566500 -- (-693.653) [-689.138] (-687.377) (-688.873) * (-688.726) (-689.836) (-686.890) [-687.731] -- 0:00:26
      567000 -- (-693.860) (-688.033) (-688.806) [-691.574] * (-688.816) (-688.204) [-687.559] (-688.715) -- 0:00:26
      567500 -- (-686.268) [-687.421] (-687.996) (-687.530) * [-688.706] (-689.526) (-687.868) (-687.423) -- 0:00:26
      568000 -- (-686.526) [-689.030] (-688.147) (-687.368) * (-688.832) [-690.499] (-689.762) (-686.335) -- 0:00:26
      568500 -- (-687.987) (-691.619) [-687.214] (-686.954) * (-689.268) (-688.278) (-687.378) [-686.712] -- 0:00:26
      569000 -- (-689.783) [-692.959] (-688.217) (-689.224) * (-689.075) [-687.802] (-692.676) (-686.538) -- 0:00:26
      569500 -- (-686.643) (-691.099) [-689.569] (-691.532) * (-686.712) (-687.651) (-693.509) [-691.514] -- 0:00:26
      570000 -- (-690.209) [-687.611] (-689.295) (-690.765) * [-687.802] (-687.765) (-688.819) (-692.706) -- 0:00:26

      Average standard deviation of split frequencies: 0.008150

      570500 -- (-689.553) [-688.443] (-689.736) (-692.252) * (-687.828) (-686.387) (-695.300) [-690.880] -- 0:00:26
      571000 -- (-693.534) [-688.219] (-692.880) (-689.000) * (-688.038) (-686.391) (-694.289) [-689.973] -- 0:00:26
      571500 -- (-693.554) (-688.396) [-688.576] (-689.557) * (-693.117) (-687.307) [-688.209] (-689.380) -- 0:00:26
      572000 -- [-689.722] (-690.101) (-688.309) (-688.460) * (-689.960) [-689.134] (-687.681) (-689.466) -- 0:00:26
      572500 -- (-688.944) [-687.848] (-690.815) (-687.191) * [-689.793] (-687.418) (-688.071) (-692.729) -- 0:00:26
      573000 -- (-690.446) (-689.168) [-688.107] (-690.891) * [-687.292] (-688.434) (-688.310) (-689.964) -- 0:00:26
      573500 -- (-688.685) (-690.783) (-690.622) [-688.165] * (-687.502) (-687.089) [-687.902] (-690.624) -- 0:00:26
      574000 -- (-688.424) (-688.755) (-686.006) [-687.786] * (-688.224) [-686.305] (-687.743) (-690.707) -- 0:00:26
      574500 -- (-688.977) (-689.129) (-688.854) [-691.111] * [-688.717] (-688.178) (-687.727) (-689.135) -- 0:00:26
      575000 -- (-686.957) (-694.916) [-689.084] (-687.467) * (-689.557) (-687.270) (-688.797) [-688.033] -- 0:00:26

      Average standard deviation of split frequencies: 0.007966

      575500 -- (-688.905) (-687.268) [-689.060] (-688.547) * (-691.506) (-686.685) [-687.453] (-687.933) -- 0:00:26
      576000 -- [-687.171] (-690.050) (-688.308) (-686.413) * (-690.425) (-687.388) [-686.727] (-688.230) -- 0:00:26
      576500 -- (-687.692) (-696.119) [-686.615] (-688.523) * (-690.366) (-687.292) (-694.289) [-687.319] -- 0:00:26
      577000 -- [-687.650] (-691.225) (-686.558) (-688.955) * (-687.056) (-687.056) (-688.515) [-687.352] -- 0:00:26
      577500 -- (-687.418) (-686.938) [-687.097] (-692.340) * (-687.675) (-691.355) (-687.484) [-686.884] -- 0:00:26
      578000 -- (-686.976) (-688.898) [-686.425] (-688.798) * (-688.994) (-691.509) (-688.139) [-686.783] -- 0:00:26
      578500 -- [-691.340] (-691.663) (-688.024) (-686.737) * (-686.834) [-687.520] (-690.578) (-690.263) -- 0:00:26
      579000 -- (-688.514) [-687.419] (-690.442) (-693.541) * [-689.610] (-687.652) (-689.279) (-686.617) -- 0:00:26
      579500 -- [-689.140] (-687.199) (-688.953) (-690.841) * (-688.597) (-687.992) [-687.781] (-687.026) -- 0:00:26
      580000 -- (-687.980) [-687.758] (-689.134) (-693.955) * [-686.379] (-690.769) (-688.406) (-686.264) -- 0:00:26

      Average standard deviation of split frequencies: 0.007956

      580500 -- (-686.610) (-688.004) [-687.173] (-690.228) * (-687.631) (-692.268) [-688.450] (-687.140) -- 0:00:26
      581000 -- [-688.152] (-689.878) (-686.959) (-693.772) * (-689.114) [-687.659] (-691.502) (-686.610) -- 0:00:25
      581500 -- (-688.539) (-689.455) [-687.603] (-686.947) * (-687.935) [-687.803] (-688.833) (-686.544) -- 0:00:25
      582000 -- (-688.086) (-687.505) [-689.244] (-693.421) * (-688.812) (-689.061) (-686.911) [-687.630] -- 0:00:25
      582500 -- (-691.455) [-690.752] (-686.863) (-691.276) * (-692.809) [-693.450] (-686.585) (-688.040) -- 0:00:25
      583000 -- [-691.912] (-689.171) (-686.158) (-697.386) * (-686.946) [-689.898] (-687.094) (-687.857) -- 0:00:25
      583500 -- (-689.189) (-688.132) (-686.623) [-689.192] * [-689.066] (-687.218) (-689.732) (-688.534) -- 0:00:25
      584000 -- (-688.806) (-687.273) [-687.865] (-688.939) * (-687.467) (-687.561) (-693.711) [-687.372] -- 0:00:25
      584500 -- (-687.557) [-687.122] (-686.854) (-689.572) * (-686.947) [-686.526] (-689.272) (-689.967) -- 0:00:25
      585000 -- (-687.879) (-687.767) [-687.250] (-688.531) * (-686.579) (-686.402) [-687.679] (-689.692) -- 0:00:25

      Average standard deviation of split frequencies: 0.007455

      585500 -- [-687.400] (-687.128) (-690.901) (-687.792) * (-687.600) (-688.326) [-688.722] (-687.664) -- 0:00:25
      586000 -- [-689.916] (-686.699) (-688.096) (-695.410) * [-687.582] (-691.651) (-690.437) (-688.530) -- 0:00:25
      586500 -- [-686.377] (-690.641) (-687.641) (-693.460) * (-691.924) (-688.545) [-689.403] (-688.230) -- 0:00:25
      587000 -- [-686.459] (-687.587) (-689.043) (-689.663) * [-690.487] (-690.863) (-688.022) (-689.324) -- 0:00:25
      587500 -- (-686.990) (-690.414) (-691.824) [-688.766] * (-688.978) (-686.420) (-688.510) [-691.026] -- 0:00:25
      588000 -- (-687.344) (-687.526) [-689.197] (-689.202) * (-688.433) [-688.785] (-686.967) (-686.523) -- 0:00:25
      588500 -- (-688.367) [-686.536] (-691.885) (-690.058) * (-690.216) (-692.706) (-689.545) [-687.902] -- 0:00:25
      589000 -- (-686.802) [-689.786] (-693.903) (-689.245) * [-688.293] (-686.806) (-689.610) (-690.596) -- 0:00:25
      589500 -- [-687.981] (-689.928) (-691.686) (-689.527) * [-688.756] (-687.970) (-687.206) (-689.068) -- 0:00:25
      590000 -- [-687.741] (-688.253) (-693.184) (-691.185) * [-686.926] (-688.076) (-687.531) (-689.042) -- 0:00:25

      Average standard deviation of split frequencies: 0.007449

      590500 -- (-687.348) [-687.284] (-690.406) (-690.693) * (-688.600) (-688.628) (-686.799) [-689.305] -- 0:00:25
      591000 -- (-686.551) [-688.289] (-690.417) (-692.940) * (-688.905) [-688.762] (-690.425) (-688.647) -- 0:00:25
      591500 -- (-687.913) (-688.725) (-688.822) [-690.101] * (-686.636) [-687.550] (-686.871) (-687.556) -- 0:00:25
      592000 -- (-688.058) (-686.256) (-687.139) [-688.115] * (-687.508) (-689.008) [-686.748] (-689.687) -- 0:00:25
      592500 -- (-688.404) [-692.722] (-687.333) (-688.100) * [-687.678] (-689.878) (-686.699) (-689.927) -- 0:00:25
      593000 -- (-688.430) (-690.277) (-687.691) [-688.653] * (-688.932) (-687.950) (-687.531) [-686.428] -- 0:00:25
      593500 -- (-688.239) (-688.538) [-687.675] (-687.490) * (-688.165) (-689.563) (-687.371) [-686.299] -- 0:00:25
      594000 -- [-686.269] (-688.250) (-688.450) (-689.233) * [-686.746] (-688.421) (-688.976) (-690.966) -- 0:00:25
      594500 -- (-688.206) (-689.046) [-688.526] (-687.811) * [-687.465] (-687.779) (-687.394) (-692.170) -- 0:00:25
      595000 -- (-687.304) (-687.682) (-690.398) [-688.982] * (-690.412) (-686.987) [-688.196] (-690.774) -- 0:00:25

      Average standard deviation of split frequencies: 0.007593

      595500 -- (-687.507) [-686.788] (-687.889) (-690.602) * (-693.070) [-690.282] (-686.376) (-686.962) -- 0:00:25
      596000 -- (-689.788) (-687.018) [-686.840] (-689.941) * (-689.599) (-689.450) (-689.626) [-686.874] -- 0:00:25
      596500 -- (-688.165) [-686.571] (-691.627) (-691.063) * [-687.266] (-690.439) (-691.816) (-691.589) -- 0:00:25
      597000 -- [-688.294] (-687.446) (-687.331) (-688.509) * (-687.199) (-688.994) [-689.541] (-686.749) -- 0:00:24
      597500 -- [-687.917] (-687.479) (-686.389) (-688.690) * (-689.054) (-688.041) (-686.765) [-686.767] -- 0:00:24
      598000 -- (-687.790) (-688.550) [-690.357] (-689.929) * (-688.670) (-691.616) [-688.099] (-687.801) -- 0:00:24
      598500 -- (-686.938) [-688.268] (-687.588) (-689.279) * [-690.047] (-688.064) (-689.174) (-687.984) -- 0:00:24
      599000 -- (-687.518) [-688.489] (-687.599) (-687.631) * [-687.348] (-690.513) (-688.450) (-688.931) -- 0:00:24
      599500 -- [-687.507] (-687.377) (-687.599) (-686.538) * (-687.657) (-689.526) (-689.669) [-692.091] -- 0:00:24
      600000 -- (-689.194) (-688.049) (-687.723) [-688.426] * [-688.615] (-690.612) (-688.596) (-690.207) -- 0:00:24

      Average standard deviation of split frequencies: 0.007377

      600500 -- (-687.654) (-687.267) (-687.695) [-690.207] * (-689.878) (-688.148) (-688.281) [-686.424] -- 0:00:24
      601000 -- [-687.533] (-688.115) (-687.354) (-693.287) * (-688.819) (-687.957) (-687.541) [-687.510] -- 0:00:24
      601500 -- (-691.140) (-686.497) (-688.438) [-694.615] * (-689.518) (-687.079) (-688.397) [-687.031] -- 0:00:24
      602000 -- [-686.667] (-690.090) (-687.287) (-693.047) * [-688.233] (-688.974) (-686.810) (-688.387) -- 0:00:24
      602500 -- (-687.047) (-691.856) [-686.318] (-693.162) * (-692.079) (-690.455) [-686.921] (-687.279) -- 0:00:24
      603000 -- [-689.191] (-689.511) (-687.130) (-689.310) * (-693.249) (-691.881) (-687.271) [-690.043] -- 0:00:24
      603500 -- (-687.337) (-686.769) [-686.803] (-688.971) * (-688.466) (-689.714) (-686.232) [-687.534] -- 0:00:24
      604000 -- (-689.173) [-687.148] (-690.450) (-687.060) * (-687.937) (-688.778) (-687.398) [-690.803] -- 0:00:24
      604500 -- (-690.783) (-688.782) (-688.520) [-687.662] * (-688.448) (-690.403) [-687.787] (-689.052) -- 0:00:24
      605000 -- (-687.282) (-690.984) (-687.863) [-686.834] * (-686.637) (-686.339) [-688.225] (-688.414) -- 0:00:24

      Average standard deviation of split frequencies: 0.007364

      605500 -- (-688.984) (-688.232) [-687.870] (-687.633) * (-686.841) (-689.852) [-689.647] (-687.679) -- 0:00:24
      606000 -- (-688.900) (-687.389) [-687.103] (-686.774) * (-686.677) (-687.223) (-688.542) [-687.434] -- 0:00:24
      606500 -- (-687.360) [-691.287] (-689.314) (-687.303) * (-686.757) (-687.982) [-688.630] (-690.234) -- 0:00:24
      607000 -- (-690.471) (-686.172) [-689.002] (-688.745) * (-686.769) (-687.637) [-688.907] (-691.674) -- 0:00:24
      607500 -- (-690.540) (-687.529) [-688.888] (-689.321) * (-687.149) (-688.129) (-689.260) [-687.870] -- 0:00:24
      608000 -- (-686.479) (-688.023) [-689.252] (-689.023) * (-687.350) (-689.906) [-686.797] (-687.903) -- 0:00:24
      608500 -- [-687.106] (-692.864) (-686.946) (-686.861) * [-690.627] (-689.643) (-687.239) (-688.135) -- 0:00:24
      609000 -- [-686.882] (-687.802) (-688.153) (-688.770) * [-686.939] (-688.395) (-687.810) (-688.449) -- 0:00:24
      609500 -- [-688.686] (-687.219) (-689.193) (-687.984) * (-686.359) (-687.362) [-689.238] (-687.884) -- 0:00:24
      610000 -- (-690.569) [-686.878] (-687.057) (-688.217) * (-690.855) [-686.953] (-687.294) (-688.097) -- 0:00:24

      Average standard deviation of split frequencies: 0.006896

      610500 -- (-688.431) (-687.048) (-691.772) [-690.532] * (-687.478) (-691.282) (-688.332) [-688.206] -- 0:00:24
      611000 -- (-686.713) (-690.477) [-690.518] (-688.083) * (-689.043) (-686.172) (-688.878) [-687.868] -- 0:00:24
      611500 -- (-687.607) [-690.020] (-689.573) (-687.995) * (-688.412) (-687.605) (-688.874) [-688.613] -- 0:00:24
      612000 -- [-686.953] (-687.670) (-690.680) (-687.444) * [-687.816] (-687.639) (-687.096) (-688.156) -- 0:00:24
      612500 -- (-688.419) [-687.911] (-692.774) (-688.301) * (-689.703) (-691.412) (-688.448) [-687.597] -- 0:00:24
      613000 -- (-687.145) (-687.184) (-687.916) [-689.863] * [-686.648] (-688.586) (-686.859) (-688.592) -- 0:00:23
      613500 -- (-689.036) (-686.123) [-687.656] (-687.700) * (-687.474) (-686.869) (-689.847) [-688.122] -- 0:00:23
      614000 -- (-693.268) (-685.979) [-687.525] (-690.865) * [-688.498] (-688.816) (-688.851) (-689.984) -- 0:00:23
      614500 -- (-689.687) [-687.532] (-691.062) (-692.443) * [-687.450] (-686.819) (-693.186) (-687.364) -- 0:00:23
      615000 -- (-687.270) [-688.326] (-691.449) (-688.237) * (-687.513) (-686.488) (-691.408) [-687.227] -- 0:00:23

      Average standard deviation of split frequencies: 0.006989

      615500 -- (-689.530) (-689.905) [-691.386] (-686.782) * [-687.828] (-686.816) (-686.573) (-686.997) -- 0:00:23
      616000 -- [-689.439] (-691.103) (-692.495) (-689.281) * [-688.025] (-687.932) (-687.703) (-688.766) -- 0:00:23
      616500 -- (-689.483) (-689.267) [-693.099] (-693.149) * (-691.028) (-687.244) [-686.417] (-688.950) -- 0:00:23
      617000 -- [-687.783] (-697.561) (-688.451) (-687.897) * (-688.279) [-687.152] (-687.755) (-687.809) -- 0:00:23
      617500 -- (-688.919) [-688.594] (-686.876) (-687.280) * (-688.864) (-690.486) (-689.318) [-688.541] -- 0:00:23
      618000 -- (-687.319) (-687.711) (-687.563) [-686.951] * (-689.174) (-692.460) (-688.144) [-686.833] -- 0:00:23
      618500 -- [-689.106] (-692.513) (-687.697) (-687.426) * (-689.718) (-689.423) (-686.334) [-686.267] -- 0:00:23
      619000 -- [-687.314] (-689.386) (-687.926) (-688.295) * (-690.626) (-690.906) [-687.367] (-686.118) -- 0:00:23
      619500 -- (-687.866) (-687.882) (-691.063) [-688.367] * (-689.856) (-691.633) [-686.432] (-686.149) -- 0:00:23
      620000 -- (-690.118) [-688.935] (-688.382) (-686.795) * (-688.479) (-688.968) (-690.082) [-687.569] -- 0:00:23

      Average standard deviation of split frequencies: 0.007241

      620500 -- (-689.229) (-691.863) (-687.817) [-688.331] * (-690.619) (-690.071) [-687.667] (-692.140) -- 0:00:23
      621000 -- [-688.782] (-691.117) (-686.364) (-690.467) * (-691.682) (-690.064) [-690.512] (-692.123) -- 0:00:23
      621500 -- [-689.628] (-687.898) (-689.501) (-690.931) * (-690.561) (-687.825) [-688.637] (-694.415) -- 0:00:23
      622000 -- (-688.390) (-689.454) [-687.891] (-689.173) * [-687.078] (-687.231) (-687.650) (-687.364) -- 0:00:23
      622500 -- [-686.541] (-691.468) (-687.781) (-686.662) * (-690.545) (-691.709) [-686.709] (-687.053) -- 0:00:23
      623000 -- (-686.912) [-687.154] (-687.323) (-691.546) * (-687.749) [-690.497] (-687.391) (-686.232) -- 0:00:23
      623500 -- [-686.492] (-689.827) (-686.545) (-688.186) * (-690.534) [-687.139] (-691.295) (-692.049) -- 0:00:23
      624000 -- (-695.387) (-690.323) [-691.837] (-689.883) * (-689.013) (-689.417) [-690.179] (-689.875) -- 0:00:23
      624500 -- (-687.307) (-689.670) [-686.920] (-690.246) * (-694.030) (-687.526) (-689.304) [-688.894] -- 0:00:23
      625000 -- (-691.578) (-687.545) [-691.073] (-689.117) * (-689.933) (-688.565) (-692.144) [-686.764] -- 0:00:23

      Average standard deviation of split frequencies: 0.007330

      625500 -- [-694.668] (-687.203) (-688.212) (-689.675) * [-686.444] (-689.401) (-687.542) (-687.190) -- 0:00:23
      626000 -- [-687.214] (-687.941) (-690.347) (-690.323) * (-686.714) (-687.697) [-688.507] (-688.027) -- 0:00:23
      626500 -- [-686.432] (-690.649) (-688.478) (-692.373) * (-689.667) [-687.280] (-690.215) (-689.472) -- 0:00:23
      627000 -- [-687.164] (-686.614) (-689.060) (-688.870) * (-688.445) (-686.389) (-688.136) [-686.073] -- 0:00:23
      627500 -- (-686.351) (-687.737) [-687.709] (-688.636) * (-686.761) (-688.749) [-686.673] (-687.310) -- 0:00:23
      628000 -- (-687.466) (-691.382) (-688.572) [-688.728] * (-687.741) (-687.582) (-689.244) [-690.126] -- 0:00:23
      628500 -- [-690.186] (-686.807) (-687.545) (-687.887) * (-687.552) (-686.781) [-688.580] (-688.413) -- 0:00:23
      629000 -- (-692.537) (-686.709) (-689.189) [-688.148] * [-686.996] (-688.173) (-691.771) (-687.623) -- 0:00:23
      629500 -- [-688.504] (-686.490) (-689.632) (-687.658) * (-687.370) [-688.005] (-687.388) (-688.909) -- 0:00:22
      630000 -- (-690.161) (-692.083) (-687.205) [-686.706] * (-686.904) [-688.055] (-689.894) (-688.086) -- 0:00:22

      Average standard deviation of split frequencies: 0.007574

      630500 -- (-691.029) (-692.772) (-687.443) [-686.310] * (-688.058) (-687.787) [-688.333] (-690.640) -- 0:00:22
      631000 -- (-695.846) (-688.274) [-688.053] (-688.276) * (-688.283) (-689.002) [-686.688] (-687.751) -- 0:00:22
      631500 -- [-690.705] (-688.685) (-686.282) (-688.527) * (-690.371) (-689.211) [-689.850] (-688.726) -- 0:00:22
      632000 -- (-688.323) [-688.338] (-687.618) (-689.820) * [-688.038] (-687.820) (-688.682) (-692.764) -- 0:00:22
      632500 -- (-688.498) (-696.269) (-693.362) [-690.028] * (-686.940) (-689.176) [-689.692] (-687.077) -- 0:00:22
      633000 -- (-690.817) [-691.221] (-689.065) (-694.238) * [-687.016] (-688.868) (-688.701) (-691.411) -- 0:00:22
      633500 -- (-691.084) (-690.488) (-686.284) [-687.438] * (-688.571) (-690.089) (-690.736) [-689.648] -- 0:00:22
      634000 -- [-690.809] (-686.836) (-686.828) (-687.291) * (-687.789) (-693.327) (-686.801) [-688.110] -- 0:00:22
      634500 -- [-687.560] (-687.571) (-687.419) (-688.885) * (-688.114) [-686.982] (-686.144) (-691.284) -- 0:00:22
      635000 -- (-686.939) [-690.526] (-686.744) (-689.918) * (-691.381) (-691.045) [-686.694] (-686.490) -- 0:00:22

      Average standard deviation of split frequencies: 0.007610

      635500 -- (-686.926) (-692.355) [-688.420] (-691.093) * (-689.508) (-688.156) (-688.329) [-686.340] -- 0:00:22
      636000 -- (-689.489) (-694.042) (-690.914) [-686.521] * (-686.690) (-687.998) [-688.081] (-688.219) -- 0:00:22
      636500 -- (-687.602) (-692.731) [-687.491] (-686.458) * (-686.516) (-690.444) (-686.378) [-686.429] -- 0:00:22
      637000 -- (-687.876) [-686.675] (-686.847) (-690.920) * (-687.689) (-689.324) [-688.563] (-686.413) -- 0:00:22
      637500 -- [-690.382] (-688.856) (-686.813) (-689.319) * (-687.046) (-687.631) [-687.694] (-688.830) -- 0:00:22
      638000 -- (-686.970) (-687.424) (-688.008) [-688.414] * [-688.916] (-687.731) (-691.183) (-688.916) -- 0:00:22
      638500 -- (-687.131) (-689.245) [-687.406] (-687.628) * [-687.971] (-688.142) (-690.346) (-686.233) -- 0:00:22
      639000 -- (-690.624) (-689.762) (-689.599) [-689.189] * (-689.230) (-688.348) (-689.850) [-686.197] -- 0:00:22
      639500 -- (-686.835) (-691.852) [-688.782] (-691.337) * (-688.736) (-691.735) [-686.774] (-689.781) -- 0:00:22
      640000 -- (-691.195) (-691.967) [-687.638] (-691.550) * (-688.241) [-692.610] (-687.127) (-687.230) -- 0:00:22

      Average standard deviation of split frequencies: 0.008094

      640500 -- (-688.227) [-687.938] (-688.481) (-690.106) * (-691.030) [-688.861] (-686.981) (-689.123) -- 0:00:22
      641000 -- (-687.237) (-688.165) (-689.008) [-687.456] * [-686.244] (-687.361) (-689.231) (-688.018) -- 0:00:22
      641500 -- (-687.179) [-687.695] (-689.887) (-686.628) * (-686.399) (-687.644) (-687.469) [-688.188] -- 0:00:22
      642000 -- (-689.051) (-688.671) (-687.537) [-689.659] * (-686.773) (-687.671) [-687.511] (-687.394) -- 0:00:22
      642500 -- (-687.948) (-687.607) (-689.167) [-689.796] * [-687.843] (-688.061) (-687.399) (-687.851) -- 0:00:22
      643000 -- (-686.984) (-687.247) (-691.356) [-691.782] * (-687.571) [-688.643] (-688.584) (-688.388) -- 0:00:22
      643500 -- [-688.412] (-690.047) (-689.812) (-693.455) * [-688.364] (-687.795) (-687.478) (-689.750) -- 0:00:22
      644000 -- (-692.953) [-687.261] (-687.349) (-686.626) * (-688.377) (-687.277) [-688.106] (-686.593) -- 0:00:22
      644500 -- (-693.809) (-687.055) [-687.667] (-692.218) * (-690.083) (-690.189) (-687.565) [-686.381] -- 0:00:22
      645000 -- (-699.663) [-687.294] (-686.769) (-687.936) * (-686.555) (-686.403) (-689.347) [-686.342] -- 0:00:22

      Average standard deviation of split frequencies: 0.007978

      645500 -- (-692.460) (-686.627) (-689.530) [-686.356] * [-688.403] (-687.851) (-694.025) (-690.774) -- 0:00:21
      646000 -- (-690.086) (-688.945) [-687.345] (-687.580) * (-687.533) (-690.106) (-693.699) [-689.398] -- 0:00:21
      646500 -- [-689.380] (-691.101) (-688.461) (-685.844) * (-688.281) (-687.438) (-687.095) [-689.891] -- 0:00:21
      647000 -- (-688.777) (-690.351) [-687.515] (-686.997) * (-689.328) (-687.389) [-687.547] (-687.210) -- 0:00:21
      647500 -- [-688.524] (-688.510) (-687.225) (-690.048) * (-686.760) [-687.084] (-689.272) (-688.396) -- 0:00:21
      648000 -- (-688.927) [-686.925] (-687.926) (-690.225) * (-690.176) (-687.053) (-687.672) [-688.017] -- 0:00:21
      648500 -- [-689.928] (-686.771) (-686.042) (-688.226) * [-686.523] (-687.406) (-688.455) (-690.082) -- 0:00:21
      649000 -- (-688.810) [-686.440] (-687.730) (-689.607) * [-687.714] (-686.852) (-689.115) (-686.994) -- 0:00:21
      649500 -- [-689.126] (-687.309) (-686.635) (-687.411) * (-688.991) (-687.447) (-687.279) [-686.331] -- 0:00:21
      650000 -- (-689.811) (-688.698) [-686.355] (-687.275) * (-687.574) (-688.183) [-688.881] (-688.345) -- 0:00:21

      Average standard deviation of split frequencies: 0.008066

      650500 -- [-687.386] (-692.379) (-686.928) (-689.390) * [-686.251] (-687.932) (-688.362) (-689.250) -- 0:00:21
      651000 -- (-688.570) (-689.780) [-687.360] (-690.831) * (-688.757) (-686.841) (-687.376) [-695.016] -- 0:00:21
      651500 -- (-687.163) (-688.036) [-689.751] (-686.947) * (-688.561) [-690.294] (-688.217) (-686.399) -- 0:00:21
      652000 -- (-688.115) (-690.932) [-687.017] (-687.472) * (-687.848) [-689.615] (-686.560) (-689.578) -- 0:00:21
      652500 -- (-688.280) (-686.243) (-692.806) [-689.460] * (-687.001) (-688.362) [-688.890] (-688.315) -- 0:00:21
      653000 -- (-688.221) [-689.329] (-691.757) (-692.873) * (-690.135) [-687.343] (-687.128) (-689.114) -- 0:00:21
      653500 -- (-690.002) (-689.193) [-688.484] (-686.487) * (-687.420) (-689.473) (-688.842) [-687.894] -- 0:00:21
      654000 -- [-690.945] (-688.993) (-687.746) (-688.576) * [-688.897] (-690.975) (-688.842) (-689.793) -- 0:00:21
      654500 -- [-686.466] (-688.469) (-686.959) (-687.424) * (-686.576) (-691.286) (-687.752) [-689.242] -- 0:00:21
      655000 -- (-686.351) [-686.156] (-685.920) (-687.330) * (-688.466) (-687.270) (-696.514) [-687.962] -- 0:00:21

      Average standard deviation of split frequencies: 0.008527

      655500 -- (-689.439) [-687.422] (-688.045) (-689.579) * (-686.741) (-690.301) (-688.168) [-687.836] -- 0:00:21
      656000 -- (-686.346) (-691.162) (-688.676) [-687.644] * (-686.776) [-687.398] (-686.487) (-688.511) -- 0:00:21
      656500 -- [-686.901] (-687.163) (-687.248) (-687.579) * (-688.048) (-687.131) (-688.031) [-686.897] -- 0:00:21
      657000 -- (-688.342) [-687.083] (-686.477) (-688.739) * (-692.850) (-687.804) (-686.935) [-688.401] -- 0:00:21
      657500 -- (-687.919) (-687.270) (-687.582) [-688.159] * (-686.883) [-690.399] (-686.370) (-690.213) -- 0:00:21
      658000 -- (-693.222) (-690.488) [-686.650] (-690.375) * (-688.025) (-688.141) (-686.684) [-688.315] -- 0:00:21
      658500 -- (-690.563) [-688.678] (-688.546) (-688.025) * (-688.967) (-689.755) (-686.721) [-687.365] -- 0:00:21
      659000 -- (-691.118) (-688.510) (-689.986) [-688.125] * (-688.346) (-688.257) [-687.613] (-688.792) -- 0:00:21
      659500 -- (-689.623) [-686.988] (-691.101) (-689.781) * (-687.516) (-690.867) [-687.127] (-692.840) -- 0:00:21
      660000 -- [-686.300] (-686.943) (-689.732) (-690.718) * [-686.573] (-688.510) (-687.029) (-687.204) -- 0:00:21

      Average standard deviation of split frequencies: 0.008229

      660500 -- (-687.577) (-688.052) (-688.611) [-688.316] * [-686.838] (-687.826) (-691.148) (-690.934) -- 0:00:21
      661000 -- (-688.032) [-687.423] (-688.797) (-687.846) * (-688.532) [-687.158] (-690.359) (-691.123) -- 0:00:21
      661500 -- [-688.562] (-688.668) (-690.239) (-693.166) * [-688.273] (-696.556) (-687.707) (-687.162) -- 0:00:20
      662000 -- (-688.403) [-688.275] (-687.788) (-690.551) * (-690.414) (-690.604) [-688.750] (-686.766) -- 0:00:20
      662500 -- (-689.870) [-690.398] (-689.088) (-689.299) * [-689.917] (-687.163) (-686.977) (-687.200) -- 0:00:20
      663000 -- [-688.676] (-689.497) (-687.151) (-687.068) * (-689.455) (-687.196) [-686.669] (-687.697) -- 0:00:20
      663500 -- (-688.967) (-687.220) [-687.463] (-686.993) * (-687.584) (-687.217) (-688.071) [-692.244] -- 0:00:20
      664000 -- (-688.045) (-690.925) [-687.094] (-687.128) * (-690.581) [-689.754] (-687.452) (-690.452) -- 0:00:20
      664500 -- [-687.422] (-690.408) (-689.396) (-686.931) * (-687.923) (-690.019) (-686.605) [-689.806] -- 0:00:20
      665000 -- (-687.844) (-687.361) (-687.430) [-688.274] * [-686.701] (-689.229) (-692.004) (-687.957) -- 0:00:20

      Average standard deviation of split frequencies: 0.008494

      665500 -- (-687.362) (-687.740) (-687.058) [-687.291] * (-689.923) (-687.586) [-690.319] (-688.771) -- 0:00:20
      666000 -- (-687.426) (-689.211) [-687.882] (-688.955) * (-688.591) [-689.883] (-688.456) (-688.712) -- 0:00:20
      666500 -- [-687.844] (-687.237) (-687.268) (-686.093) * (-691.376) (-689.407) [-686.413] (-689.356) -- 0:00:20
      667000 -- (-689.041) [-688.280] (-687.308) (-688.006) * (-689.252) [-688.480] (-687.204) (-690.631) -- 0:00:20
      667500 -- [-688.603] (-686.691) (-686.258) (-686.635) * (-689.035) (-688.072) (-687.096) [-687.749] -- 0:00:20
      668000 -- (-688.114) (-688.216) [-686.659] (-688.002) * [-687.312] (-688.974) (-691.377) (-686.901) -- 0:00:20
      668500 -- [-687.247] (-688.496) (-689.418) (-692.869) * [-689.192] (-690.310) (-687.887) (-686.227) -- 0:00:20
      669000 -- (-686.218) (-686.818) (-693.204) [-688.042] * (-690.834) (-688.742) [-687.680] (-691.620) -- 0:00:20
      669500 -- [-686.808] (-687.769) (-688.015) (-694.159) * (-687.286) [-688.338] (-687.282) (-689.404) -- 0:00:20
      670000 -- (-688.738) [-687.611] (-692.872) (-686.859) * (-687.286) (-691.604) [-688.133] (-687.963) -- 0:00:20

      Average standard deviation of split frequencies: 0.008669

      670500 -- [-688.473] (-687.807) (-691.620) (-689.800) * (-688.531) (-690.331) (-688.490) [-688.615] -- 0:00:20
      671000 -- (-688.306) (-689.701) [-688.315] (-689.563) * (-686.519) (-689.486) (-687.891) [-688.492] -- 0:00:20
      671500 -- [-686.369] (-688.568) (-697.994) (-689.688) * [-686.566] (-688.283) (-688.755) (-687.423) -- 0:00:20
      672000 -- (-687.508) (-686.712) [-686.336] (-690.202) * (-686.137) [-690.631] (-689.600) (-687.074) -- 0:00:20
      672500 -- (-688.404) (-685.996) (-689.200) [-687.682] * [-686.224] (-687.687) (-688.714) (-688.780) -- 0:00:20
      673000 -- (-686.820) [-690.216] (-686.848) (-688.720) * (-686.224) [-693.176] (-686.908) (-687.749) -- 0:00:20
      673500 -- [-687.494] (-691.578) (-687.086) (-686.981) * [-687.030] (-691.064) (-686.721) (-692.020) -- 0:00:20
      674000 -- (-689.499) (-690.880) (-689.319) [-687.054] * (-688.497) (-687.937) (-689.507) [-693.015] -- 0:00:20
      674500 -- (-694.155) (-687.907) (-688.826) [-687.629] * (-690.906) (-692.695) (-686.694) [-689.893] -- 0:00:20
      675000 -- [-686.636] (-688.264) (-688.490) (-688.071) * (-691.243) [-686.992] (-687.814) (-688.013) -- 0:00:20

      Average standard deviation of split frequencies: 0.008833

      675500 -- (-686.714) (-687.621) (-689.929) [-689.003] * (-691.429) (-686.819) (-687.896) [-688.687] -- 0:00:20
      676000 -- (-687.325) (-688.384) [-687.549] (-687.223) * (-687.482) (-686.959) [-689.230] (-688.398) -- 0:00:20
      676500 -- [-686.497] (-688.478) (-687.459) (-688.178) * (-688.030) [-689.245] (-686.455) (-689.446) -- 0:00:20
      677000 -- [-688.831] (-688.448) (-690.213) (-687.957) * (-687.055) [-688.655] (-688.748) (-687.877) -- 0:00:20
      677500 -- (-688.288) (-695.396) (-689.025) [-687.259] * (-687.467) (-690.218) (-689.393) [-687.612] -- 0:00:19
      678000 -- (-690.224) (-689.953) [-686.707] (-686.900) * (-686.822) (-690.301) [-688.705] (-687.927) -- 0:00:19
      678500 -- (-690.912) (-689.227) (-688.696) [-686.859] * (-691.285) (-689.269) [-687.506] (-687.913) -- 0:00:19
      679000 -- (-687.440) (-690.571) [-689.558] (-688.328) * [-689.057] (-686.927) (-692.723) (-688.626) -- 0:00:19
      679500 -- (-687.864) [-689.800] (-693.505) (-687.353) * [-688.590] (-688.657) (-691.195) (-688.818) -- 0:00:19
      680000 -- (-691.813) [-686.750] (-694.073) (-687.585) * (-687.799) [-688.850] (-690.751) (-688.681) -- 0:00:19

      Average standard deviation of split frequencies: 0.009142

      680500 -- (-690.016) (-688.213) [-688.738] (-692.716) * (-693.444) (-688.338) [-686.422] (-693.258) -- 0:00:19
      681000 -- (-686.144) (-690.637) (-686.260) [-687.733] * (-686.391) (-687.012) (-691.822) [-688.735] -- 0:00:19
      681500 -- (-688.440) (-688.732) [-686.555] (-691.031) * [-686.638] (-687.789) (-689.050) (-690.165) -- 0:00:19
      682000 -- [-688.434] (-686.641) (-686.711) (-690.403) * [-688.684] (-686.237) (-689.705) (-692.919) -- 0:00:19
      682500 -- (-688.230) (-687.278) [-691.971] (-689.226) * (-688.438) (-688.707) (-689.804) [-688.202] -- 0:00:19
      683000 -- [-687.208] (-687.914) (-686.689) (-688.586) * (-688.512) (-686.513) (-689.596) [-689.464] -- 0:00:19
      683500 -- (-686.760) [-690.854] (-690.111) (-689.984) * (-690.442) [-686.919] (-687.590) (-687.148) -- 0:00:19
      684000 -- [-688.644] (-686.227) (-689.404) (-689.236) * (-687.826) [-689.277] (-688.068) (-688.873) -- 0:00:19
      684500 -- [-686.590] (-693.864) (-688.021) (-689.514) * (-688.410) (-690.849) [-687.301] (-688.561) -- 0:00:19
      685000 -- (-687.149) [-686.727] (-691.321) (-690.083) * (-688.259) (-691.218) (-686.642) [-689.465] -- 0:00:19

      Average standard deviation of split frequencies: 0.009025

      685500 -- [-686.876] (-686.956) (-689.464) (-688.167) * [-688.359] (-686.779) (-689.491) (-689.082) -- 0:00:19
      686000 -- [-688.237] (-687.032) (-690.553) (-688.655) * (-688.060) (-687.565) [-687.733] (-689.419) -- 0:00:19
      686500 -- (-695.113) [-687.885] (-690.226) (-687.101) * (-686.097) [-688.023] (-687.703) (-691.051) -- 0:00:19
      687000 -- (-689.655) [-688.244] (-687.193) (-686.247) * (-686.709) (-687.119) (-687.586) [-690.118] -- 0:00:19
      687500 -- (-692.500) [-689.015] (-693.852) (-686.673) * [-686.837] (-687.386) (-689.149) (-687.089) -- 0:00:19
      688000 -- (-690.061) [-688.125] (-690.803) (-687.698) * (-686.776) [-687.142] (-689.269) (-690.249) -- 0:00:19
      688500 -- (-690.448) [-686.650] (-686.938) (-687.528) * (-689.630) [-686.648] (-688.467) (-688.528) -- 0:00:19
      689000 -- (-690.880) (-690.793) [-691.701] (-689.400) * (-686.608) (-689.574) (-688.824) [-688.624] -- 0:00:19
      689500 -- (-689.963) [-687.396] (-690.850) (-688.399) * (-688.335) [-687.177] (-691.995) (-689.458) -- 0:00:19
      690000 -- (-689.013) (-686.044) [-687.967] (-688.391) * (-687.454) (-686.619) [-687.448] (-688.709) -- 0:00:19

      Average standard deviation of split frequencies: 0.008691

      690500 -- (-689.120) (-686.152) [-686.997] (-689.444) * (-695.639) (-687.778) [-687.388] (-688.495) -- 0:00:19
      691000 -- [-687.507] (-690.861) (-687.777) (-687.455) * [-693.230] (-688.934) (-688.372) (-689.763) -- 0:00:19
      691500 -- (-686.627) (-688.929) [-686.447] (-688.981) * (-689.657) (-688.493) [-686.729] (-691.410) -- 0:00:19
      692000 -- [-689.264] (-691.187) (-688.294) (-689.089) * (-689.873) (-689.328) [-687.260] (-687.982) -- 0:00:19
      692500 -- [-686.906] (-687.914) (-690.425) (-689.591) * (-688.658) (-688.121) [-687.221] (-688.522) -- 0:00:19
      693000 -- [-688.181] (-688.151) (-689.332) (-689.245) * [-687.929] (-690.690) (-688.423) (-688.259) -- 0:00:19
      693500 -- [-687.182] (-688.723) (-687.276) (-687.239) * (-687.077) (-687.009) (-687.306) [-686.348] -- 0:00:19
      694000 -- [-689.075] (-686.833) (-686.970) (-687.624) * (-687.062) [-686.611] (-688.228) (-687.063) -- 0:00:18
      694500 -- (-691.137) (-686.492) [-688.021] (-686.928) * (-687.996) (-686.307) (-686.122) [-687.602] -- 0:00:18
      695000 -- (-688.976) (-688.650) [-686.787] (-691.257) * [-688.110] (-686.598) (-686.121) (-690.997) -- 0:00:18

      Average standard deviation of split frequencies: 0.008670

      695500 -- (-687.898) [-690.206] (-688.518) (-690.485) * [-688.004] (-690.319) (-687.286) (-692.425) -- 0:00:18
      696000 -- (-687.004) (-687.969) [-690.178] (-689.313) * [-690.385] (-691.982) (-689.350) (-692.545) -- 0:00:18
      696500 -- (-686.753) [-687.645] (-689.548) (-690.121) * (-687.936) [-691.256] (-689.691) (-689.964) -- 0:00:18
      697000 -- (-687.730) (-688.408) [-688.366] (-689.094) * (-688.113) (-690.508) [-688.281] (-690.513) -- 0:00:18
      697500 -- (-686.786) [-688.790] (-688.365) (-687.656) * (-687.684) (-687.810) [-688.578] (-690.108) -- 0:00:18
      698000 -- [-686.653] (-687.970) (-687.938) (-687.490) * (-688.504) [-687.765] (-688.539) (-689.419) -- 0:00:18
      698500 -- [-688.918] (-689.779) (-687.950) (-688.551) * (-690.039) [-687.914] (-688.793) (-690.198) -- 0:00:18
      699000 -- (-688.907) [-695.435] (-690.735) (-686.091) * (-687.929) (-686.441) [-686.447] (-687.963) -- 0:00:18
      699500 -- [-689.782] (-688.934) (-691.779) (-685.851) * (-690.895) [-686.324] (-688.231) (-687.082) -- 0:00:18
      700000 -- (-687.941) [-691.270] (-689.534) (-686.215) * (-689.782) [-687.738] (-689.372) (-688.071) -- 0:00:18

      Average standard deviation of split frequencies: 0.009105

      700500 -- (-690.005) (-687.794) (-688.422) [-686.524] * [-690.087] (-688.302) (-687.841) (-687.803) -- 0:00:18
      701000 -- [-688.514] (-688.183) (-687.214) (-688.408) * (-689.241) (-688.412) [-686.770] (-692.745) -- 0:00:18
      701500 -- [-689.140] (-689.091) (-686.571) (-686.631) * [-687.446] (-688.823) (-688.208) (-692.452) -- 0:00:18
      702000 -- [-688.862] (-689.958) (-687.552) (-688.923) * (-686.915) [-686.491] (-687.129) (-688.103) -- 0:00:18
      702500 -- [-689.491] (-686.495) (-688.317) (-688.544) * (-687.995) [-686.974] (-687.133) (-687.820) -- 0:00:18
      703000 -- (-689.970) (-689.384) [-687.326] (-690.234) * [-690.601] (-686.226) (-686.672) (-687.669) -- 0:00:18
      703500 -- (-688.218) (-690.926) [-687.265] (-692.905) * (-687.283) (-686.959) [-686.119] (-689.445) -- 0:00:18
      704000 -- (-687.584) (-687.696) [-688.831] (-688.716) * (-690.810) [-688.255] (-687.281) (-687.311) -- 0:00:18
      704500 -- [-687.564] (-690.429) (-686.263) (-692.731) * [-689.621] (-690.469) (-688.291) (-687.000) -- 0:00:18
      705000 -- (-690.125) [-688.319] (-688.202) (-693.092) * (-687.881) (-686.449) [-687.558] (-691.327) -- 0:00:18

      Average standard deviation of split frequencies: 0.008458

      705500 -- (-687.093) (-689.480) [-686.176] (-693.926) * (-693.030) (-688.667) [-686.835] (-688.883) -- 0:00:18
      706000 -- (-688.296) [-688.968] (-688.500) (-687.167) * (-694.109) (-687.580) [-685.908] (-687.840) -- 0:00:18
      706500 -- (-690.553) [-687.037] (-688.237) (-687.363) * (-689.285) [-688.025] (-689.839) (-688.268) -- 0:00:18
      707000 -- [-689.404] (-687.655) (-690.870) (-689.901) * (-689.180) [-688.358] (-688.890) (-689.327) -- 0:00:18
      707500 -- (-689.074) (-686.903) (-686.385) [-687.906] * [-691.570] (-687.894) (-689.472) (-687.223) -- 0:00:18
      708000 -- (-687.105) (-686.728) [-686.092] (-689.470) * [-689.789] (-685.983) (-690.496) (-688.085) -- 0:00:18
      708500 -- (-688.290) (-686.999) [-686.990] (-689.330) * (-688.048) (-687.794) [-690.211] (-688.289) -- 0:00:18
      709000 -- (-691.086) (-688.648) (-687.284) [-688.834] * [-687.957] (-687.635) (-687.677) (-689.411) -- 0:00:18
      709500 -- (-689.048) [-690.488] (-689.663) (-687.546) * [-687.360] (-687.101) (-687.299) (-689.604) -- 0:00:18
      710000 -- [-686.356] (-689.154) (-692.283) (-687.374) * (-686.602) (-688.004) (-687.554) [-691.829] -- 0:00:17

      Average standard deviation of split frequencies: 0.008137

      710500 -- [-688.229] (-690.585) (-691.599) (-690.843) * (-687.670) (-689.384) [-687.968] (-688.470) -- 0:00:17
      711000 -- [-688.785] (-697.556) (-690.437) (-688.913) * [-686.634] (-692.462) (-689.804) (-691.314) -- 0:00:17
      711500 -- (-690.941) (-692.804) [-688.097] (-686.299) * [-688.517] (-691.647) (-690.281) (-690.784) -- 0:00:17
      712000 -- [-689.411] (-688.646) (-691.630) (-687.148) * (-687.833) (-690.949) [-693.410] (-688.879) -- 0:00:17
      712500 -- [-689.879] (-688.537) (-689.529) (-687.368) * [-687.751] (-691.465) (-691.156) (-689.539) -- 0:00:17
      713000 -- [-689.643] (-688.208) (-688.802) (-692.246) * [-686.741] (-689.073) (-689.451) (-688.202) -- 0:00:17
      713500 -- (-693.272) (-687.084) (-690.333) [-689.924] * (-688.684) (-688.589) [-690.993] (-687.207) -- 0:00:17
      714000 -- [-686.995] (-691.107) (-689.595) (-688.810) * [-688.012] (-689.497) (-692.208) (-688.240) -- 0:00:17
      714500 -- [-687.479] (-687.406) (-689.000) (-687.128) * (-690.221) (-686.881) [-688.799] (-687.415) -- 0:00:17
      715000 -- (-689.894) (-691.699) [-687.221] (-687.865) * (-687.074) (-691.412) (-689.941) [-688.443] -- 0:00:17

      Average standard deviation of split frequencies: 0.008296

      715500 -- (-687.322) [-688.988] (-688.480) (-687.716) * [-687.791] (-687.522) (-688.647) (-686.333) -- 0:00:17
      716000 -- (-686.188) (-690.762) (-689.909) [-687.471] * (-688.968) (-686.425) [-691.237] (-687.274) -- 0:00:17
      716500 -- (-690.019) [-687.408] (-688.958) (-689.869) * (-688.510) (-691.067) [-690.802] (-688.549) -- 0:00:17
      717000 -- [-690.334] (-686.031) (-689.280) (-689.469) * [-688.684] (-687.781) (-688.196) (-689.603) -- 0:00:17
      717500 -- (-694.730) (-687.547) (-687.679) [-688.131] * (-689.255) (-688.277) [-691.315] (-688.700) -- 0:00:17
      718000 -- (-687.860) (-689.033) [-687.463] (-686.828) * (-687.539) (-688.158) [-688.132] (-686.632) -- 0:00:17
      718500 -- (-687.488) (-690.247) (-688.541) [-687.408] * [-687.115] (-687.472) (-690.602) (-688.322) -- 0:00:17
      719000 -- (-689.701) [-690.503] (-690.107) (-686.501) * [-688.216] (-687.180) (-687.855) (-692.643) -- 0:00:17
      719500 -- (-688.559) (-690.717) [-686.133] (-686.390) * [-687.700] (-688.753) (-687.872) (-689.877) -- 0:00:17
      720000 -- (-689.051) (-688.956) (-688.940) [-686.783] * (-688.247) [-689.293] (-691.289) (-688.325) -- 0:00:17

      Average standard deviation of split frequencies: 0.007675

      720500 -- [-688.246] (-688.403) (-687.341) (-686.928) * (-686.591) (-691.038) (-690.217) [-689.390] -- 0:00:17
      721000 -- (-687.130) (-693.595) (-687.217) [-686.087] * (-687.393) (-691.867) (-687.427) [-687.358] -- 0:00:17
      721500 -- (-687.579) (-688.675) (-688.131) [-686.091] * (-687.619) (-691.333) [-687.985] (-690.229) -- 0:00:17
      722000 -- (-686.077) (-689.940) (-689.622) [-688.428] * [-686.617] (-691.867) (-687.910) (-694.378) -- 0:00:17
      722500 -- (-692.332) [-689.118] (-688.294) (-688.407) * [-687.966] (-689.203) (-687.350) (-690.623) -- 0:00:17
      723000 -- (-688.127) [-686.868] (-687.248) (-689.229) * [-688.531] (-687.548) (-686.943) (-688.269) -- 0:00:17
      723500 -- (-687.450) (-687.835) [-688.431] (-690.085) * (-688.196) [-687.711] (-686.550) (-689.666) -- 0:00:17
      724000 -- (-686.881) (-691.155) [-687.092] (-689.145) * (-688.135) (-688.671) (-693.351) [-687.556] -- 0:00:17
      724500 -- [-689.050] (-690.450) (-688.590) (-688.868) * [-689.353] (-687.913) (-688.396) (-688.927) -- 0:00:17
      725000 -- (-686.660) (-687.908) (-687.602) [-686.383] * (-691.042) [-687.117] (-688.949) (-689.226) -- 0:00:17

      Average standard deviation of split frequencies: 0.007489

      725500 -- (-686.754) [-688.061] (-687.918) (-687.495) * (-688.909) [-691.539] (-690.246) (-687.144) -- 0:00:17
      726000 -- (-688.746) (-687.094) (-686.940) [-686.971] * (-688.374) [-689.063] (-686.700) (-686.858) -- 0:00:16
      726500 -- [-688.627] (-686.787) (-687.139) (-687.013) * [-686.831] (-688.230) (-688.930) (-690.991) -- 0:00:16
      727000 -- [-687.891] (-687.799) (-687.683) (-692.075) * [-686.537] (-689.690) (-687.830) (-692.511) -- 0:00:16
      727500 -- (-689.183) (-691.807) [-689.691] (-691.118) * (-691.230) (-687.639) [-687.997] (-688.903) -- 0:00:16
      728000 -- (-688.258) (-689.272) (-691.837) [-688.027] * (-689.327) [-688.750] (-688.850) (-689.920) -- 0:00:16
      728500 -- (-689.491) (-686.973) [-686.253] (-690.768) * [-690.814] (-687.867) (-687.095) (-686.482) -- 0:00:16
      729000 -- (-688.309) (-689.506) (-690.256) [-690.828] * (-689.586) (-687.780) [-688.678] (-686.103) -- 0:00:16
      729500 -- (-686.875) (-687.909) (-687.898) [-690.646] * (-689.586) (-689.211) [-689.698] (-689.046) -- 0:00:16
      730000 -- (-686.838) (-692.471) [-686.845] (-688.193) * [-687.079] (-689.501) (-688.505) (-686.286) -- 0:00:16

      Average standard deviation of split frequencies: 0.007527

      730500 -- (-685.954) (-692.524) (-687.742) [-689.689] * [-686.609] (-687.390) (-689.497) (-688.960) -- 0:00:16
      731000 -- (-687.488) (-690.822) [-687.419] (-688.470) * (-687.526) (-687.013) [-688.902] (-688.342) -- 0:00:16
      731500 -- (-687.358) (-687.786) [-686.710] (-687.968) * (-687.937) (-689.274) (-686.799) [-686.398] -- 0:00:16
      732000 -- [-687.398] (-688.152) (-686.771) (-688.910) * (-688.800) (-686.326) [-687.965] (-691.679) -- 0:00:16
      732500 -- (-689.062) (-687.605) [-687.424] (-688.136) * (-687.042) (-688.731) (-691.140) [-692.256] -- 0:00:16
      733000 -- (-687.117) (-690.095) [-688.094] (-688.018) * [-688.626] (-687.007) (-689.555) (-692.045) -- 0:00:16
      733500 -- (-686.870) (-690.441) (-687.745) [-688.233] * (-689.299) (-687.287) (-686.683) [-687.563] -- 0:00:16
      734000 -- [-688.960] (-691.154) (-687.817) (-687.668) * [-691.222] (-692.637) (-688.968) (-690.289) -- 0:00:16
      734500 -- (-688.028) (-689.656) (-687.227) [-686.941] * (-688.223) [-689.889] (-689.105) (-688.444) -- 0:00:16
      735000 -- (-688.589) [-689.016] (-690.243) (-689.073) * (-689.307) (-692.837) [-688.109] (-686.514) -- 0:00:16

      Average standard deviation of split frequencies: 0.007686

      735500 -- (-686.498) (-687.145) (-690.767) [-688.130] * (-688.210) (-690.004) [-686.931] (-68