--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:17:28 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2454/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -755.33 -758.60
2 -755.26 -758.91
--------------------------------------
TOTAL -755.29 -758.77
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.884746 0.086031 0.362795 1.466667 0.844419 1462.39 1481.70 1.000
r(A<->C){all} 0.170083 0.020969 0.000051 0.457426 0.130541 238.79 297.99 1.000
r(A<->G){all} 0.159006 0.019734 0.000054 0.456830 0.118516 190.92 262.51 1.001
r(A<->T){all} 0.156928 0.018793 0.000040 0.445112 0.119603 171.01 223.37 1.000
r(C<->G){all} 0.176808 0.020989 0.000014 0.461258 0.139451 198.48 276.04 1.000
r(C<->T){all} 0.178124 0.020837 0.000010 0.473373 0.142709 227.20 268.21 1.001
r(G<->T){all} 0.159052 0.018291 0.000019 0.435830 0.125030 293.53 310.39 1.000
pi(A){all} 0.209940 0.000287 0.176773 0.242565 0.209799 1254.53 1313.93 1.000
pi(C){all} 0.290440 0.000365 0.253180 0.327951 0.290599 1228.56 1293.04 1.001
pi(G){all} 0.351754 0.000415 0.312692 0.392191 0.351923 1320.05 1370.31 1.000
pi(T){all} 0.147866 0.000223 0.119611 0.177233 0.147734 1349.17 1355.98 1.000
alpha{1,2} 0.407397 0.225170 0.000103 1.361250 0.244771 1261.36 1283.27 1.000
alpha{3} 0.465577 0.266018 0.000446 1.467284 0.293459 1102.88 1126.87 1.000
pinvar{all} 0.997239 0.000010 0.991339 1.000000 0.998237 773.65 993.16 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -717.724506
Model 2: PositiveSelection -717.724463
Model 0: one-ratio -717.724497
Model 7: beta -717.72458
Model 8: beta&w>1 -717.724512
Model 0 vs 1 1.799999995455437E-5
Model 2 vs 1 8.600000001024455E-5
Model 8 vs 7 1.3599999988400668E-4
>C1
MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
>C2
MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
>C3
MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
>C4
MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
>C5
MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
>C6
MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=188
C1 MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
C2 MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
C3 MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
C4 MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
C5 MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
C6 MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
**************************************************
C1 EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
C2 EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
C3 EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
C4 EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
C5 EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
C6 EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
**************************************************
C1 RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
C2 RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
C3 RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
C4 RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
C5 RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
C6 RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
**************************************************
C1 AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
C2 AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
C3 AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
C4 AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
C5 AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
C6 AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
**************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5640]--->[5640]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.477 Mb, Max= 30.729 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
C2 MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
C3 MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
C4 MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
C5 MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
C6 MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
**************************************************
C1 EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
C2 EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
C3 EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
C4 EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
C5 EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
C6 EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
**************************************************
C1 RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
C2 RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
C3 RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
C4 RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
C5 RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
C6 RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
**************************************************
C1 AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
C2 AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
C3 AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
C4 AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
C5 AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
C6 AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
**************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCTGAAAACCCTAACGTCGACGACCTGCGGGCGCCATTGTTGGCAGC
C2 ATGGCTGAAAACCCTAACGTCGACGACCTGCGGGCGCCATTGTTGGCAGC
C3 ATGGCTGAAAACCCTAACGTCGACGACCTGCGGGCGCCATTGTTGGCAGC
C4 ATGGCTGAAAACCCTAACGTCGACGACCTGCGGGCGCCATTGTTGGCAGC
C5 ATGGCTGAAAACCCTAACGTCGACGACCTGCGGGCGCCATTGTTGGCAGC
C6 ATGGCTGAAAACCCTAACGTCGACGACCTGCGGGCGCCATTGTTGGCAGC
**************************************************
C1 GCTGGGCGCGGCAGACTTGGCCCTGACCACCGTTAATGAGCTGGTCGGCA
C2 GCTGGGCGCGGCAGACTTGGCCCTGACCACCGTTAATGAGCTGGTCGGCA
C3 GCTGGGCGCGGCAGACTTGGCCCTGACCACCGTTAATGAGCTGGTCGGCA
C4 GCTGGGCGCGGCAGACTTGGCCCTGACCACCGTTAATGAGCTGGTCGGCA
C5 GCTGGGCGCGGCAGACTTGGCCCTGACCACCGTTAATGAGCTGGTCGGCA
C6 GCTGGGCGCGGCAGACTTGGCCCTGACCACCGTTAATGAGCTGGTCGGCA
**************************************************
C1 ACATGCGCGAACGTGCCGAAGAAACCCGCATCGATACCCGCAGCCGTGTT
C2 ACATGCGCGAACGTGCCGAAGAAACCCGCATCGATACCCGCAGCCGTGTT
C3 ACATGCGCGAACGTGCCGAAGAAACCCGCATCGATACCCGCAGCCGTGTT
C4 ACATGCGCGAACGTGCCGAAGAAACCCGCATCGATACCCGCAGCCGTGTT
C5 ACATGCGCGAACGTGCCGAAGAAACCCGCATCGATACCCGCAGCCGTGTT
C6 ACATGCGCGAACGTGCCGAAGAAACCCGCATCGATACCCGCAGCCGTGTT
**************************************************
C1 GAGGAGAGCCGCGCTCGCGTGGCAAAACTGCAGGAGGTTCTGCCCGAACA
C2 GAGGAGAGCCGCGCTCGCGTGGCAAAACTGCAGGAGGTTCTGCCCGAACA
C3 GAGGAGAGCCGCGCTCGCGTGGCAAAACTGCAGGAGGTTCTGCCCGAACA
C4 GAGGAGAGCCGCGCTCGCGTGGCAAAACTGCAGGAGGTTCTGCCCGAACA
C5 GAGGAGAGCCGCGCTCGCGTGGCAAAACTGCAGGAGGTTCTGCCCGAACA
C6 GAGGAGAGCCGCGCTCGCGTGGCAAAACTGCAGGAGGTTCTGCCCGAACA
**************************************************
C1 CCTTAGCGAGCTGCGTGAGAAGTTCACCGCCGACGAGTTGCGTAAGGCCG
C2 CCTTAGCGAGCTGCGTGAGAAGTTCACCGCCGACGAGTTGCGTAAGGCCG
C3 CCTTAGCGAGCTGCGTGAGAAGTTCACCGCCGACGAGTTGCGTAAGGCCG
C4 CCTTAGCGAGCTGCGTGAGAAGTTCACCGCCGACGAGTTGCGTAAGGCCG
C5 CCTTAGCGAGCTGCGTGAGAAGTTCACCGCCGACGAGTTGCGTAAGGCCG
C6 CCTTAGCGAGCTGCGTGAGAAGTTCACCGCCGACGAGTTGCGTAAGGCCG
**************************************************
C1 CTGAGGGCTATTTGGAGGCAGCGACCAACCGGTACAACGAGCTAGTCGAG
C2 CTGAGGGCTATTTGGAGGCAGCGACCAACCGGTACAACGAGCTAGTCGAG
C3 CTGAGGGCTATTTGGAGGCAGCGACCAACCGGTACAACGAGCTAGTCGAG
C4 CTGAGGGCTATTTGGAGGCAGCGACCAACCGGTACAACGAGCTAGTCGAG
C5 CTGAGGGCTATTTGGAGGCAGCGACCAACCGGTACAACGAGCTAGTCGAG
C6 CTGAGGGCTATTTGGAGGCAGCGACCAACCGGTACAACGAGCTAGTCGAG
**************************************************
C1 CGCGGCGAGGCCGCCCTGGAGCGGTTACGCAGCCGGCCGGTTTTCGAAGA
C2 CGCGGCGAGGCCGCCCTGGAGCGGTTACGCAGCCGGCCGGTTTTCGAAGA
C3 CGCGGCGAGGCCGCCCTGGAGCGGTTACGCAGCCGGCCGGTTTTCGAAGA
C4 CGCGGCGAGGCCGCCCTGGAGCGGTTACGCAGCCGGCCGGTTTTCGAAGA
C5 CGCGGCGAGGCCGCCCTGGAGCGGTTACGCAGCCGGCCGGTTTTCGAAGA
C6 CGCGGCGAGGCCGCCCTGGAGCGGTTACGCAGCCGGCCGGTTTTCGAAGA
**************************************************
C1 TGCGTCGGCACGTGCCGAGGGTTACGTGGACCAGGCTGTCGAGTTGACTC
C2 TGCGTCGGCACGTGCCGAGGGTTACGTGGACCAGGCTGTCGAGTTGACTC
C3 TGCGTCGGCACGTGCCGAGGGTTACGTGGACCAGGCTGTCGAGTTGACTC
C4 TGCGTCGGCACGTGCCGAGGGTTACGTGGACCAGGCTGTCGAGTTGACTC
C5 TGCGTCGGCACGTGCCGAGGGTTACGTGGACCAGGCTGTCGAGTTGACTC
C6 TGCGTCGGCACGTGCCGAGGGTTACGTGGACCAGGCTGTCGAGTTGACTC
**************************************************
C1 AGGAGGCGCTGGGTACTGTCGCGTCGCAGACCCGCGCGGTTGGCGGGCGT
C2 AGGAGGCGCTGGGTACTGTCGCGTCGCAGACCCGCGCGGTTGGCGGGCGT
C3 AGGAGGCGCTGGGTACTGTCGCGTCGCAGACCCGCGCGGTTGGCGGGCGT
C4 AGGAGGCGCTGGGTACTGTCGCGTCGCAGACCCGCGCGGTTGGCGGGCGT
C5 AGGAGGCGCTGGGTACTGTCGCGTCGCAGACCCGCGCGGTTGGCGGGCGT
C6 AGGAGGCGCTGGGTACTGTCGCGTCGCAGACCCGCGCGGTTGGCGGGCGT
**************************************************
C1 GCAGCCAAACTGGTCGGCATCGAGCTACCCAAGAAGGCGGCGGCGCCTGC
C2 GCAGCCAAACTGGTCGGCATCGAGCTACCCAAGAAGGCGGCGGCGCCTGC
C3 GCAGCCAAACTGGTCGGCATCGAGCTACCCAAGAAGGCGGCGGCGCCTGC
C4 GCAGCCAAACTGGTCGGCATCGAGCTACCCAAGAAGGCGGCGGCGCCTGC
C5 GCAGCCAAACTGGTCGGCATCGAGCTACCCAAGAAGGCGGCGGCGCCTGC
C6 GCAGCCAAACTGGTCGGCATCGAGCTACCCAAGAAGGCGGCGGCGCCTGC
**************************************************
C1 GAGGAAGGCTCCGGCCAAGAAGGCGCCTGCGAAGAAGGCTCCGGCCAAGA
C2 GAGGAAGGCTCCGGCCAAGAAGGCGCCTGCGAAGAAGGCTCCGGCCAAGA
C3 GAGGAAGGCTCCGGCCAAGAAGGCGCCTGCGAAGAAGGCTCCGGCCAAGA
C4 GAGGAAGGCTCCGGCCAAGAAGGCGCCTGCGAAGAAGGCTCCGGCCAAGA
C5 GAGGAAGGCTCCGGCCAAGAAGGCGCCTGCGAAGAAGGCTCCGGCCAAGA
C6 GAGGAAGGCTCCGGCCAAGAAGGCGCCTGCGAAGAAGGCTCCGGCCAAGA
**************************************************
C1 AGGTCACACAGAAA
C2 AGGTCACACAGAAA
C3 AGGTCACACAGAAA
C4 AGGTCACACAGAAA
C5 AGGTCACACAGAAA
C6 AGGTCACACAGAAA
**************
>C1
ATGGCTGAAAACCCTAACGTCGACGACCTGCGGGCGCCATTGTTGGCAGC
GCTGGGCGCGGCAGACTTGGCCCTGACCACCGTTAATGAGCTGGTCGGCA
ACATGCGCGAACGTGCCGAAGAAACCCGCATCGATACCCGCAGCCGTGTT
GAGGAGAGCCGCGCTCGCGTGGCAAAACTGCAGGAGGTTCTGCCCGAACA
CCTTAGCGAGCTGCGTGAGAAGTTCACCGCCGACGAGTTGCGTAAGGCCG
CTGAGGGCTATTTGGAGGCAGCGACCAACCGGTACAACGAGCTAGTCGAG
CGCGGCGAGGCCGCCCTGGAGCGGTTACGCAGCCGGCCGGTTTTCGAAGA
TGCGTCGGCACGTGCCGAGGGTTACGTGGACCAGGCTGTCGAGTTGACTC
AGGAGGCGCTGGGTACTGTCGCGTCGCAGACCCGCGCGGTTGGCGGGCGT
GCAGCCAAACTGGTCGGCATCGAGCTACCCAAGAAGGCGGCGGCGCCTGC
GAGGAAGGCTCCGGCCAAGAAGGCGCCTGCGAAGAAGGCTCCGGCCAAGA
AGGTCACACAGAAA
>C2
ATGGCTGAAAACCCTAACGTCGACGACCTGCGGGCGCCATTGTTGGCAGC
GCTGGGCGCGGCAGACTTGGCCCTGACCACCGTTAATGAGCTGGTCGGCA
ACATGCGCGAACGTGCCGAAGAAACCCGCATCGATACCCGCAGCCGTGTT
GAGGAGAGCCGCGCTCGCGTGGCAAAACTGCAGGAGGTTCTGCCCGAACA
CCTTAGCGAGCTGCGTGAGAAGTTCACCGCCGACGAGTTGCGTAAGGCCG
CTGAGGGCTATTTGGAGGCAGCGACCAACCGGTACAACGAGCTAGTCGAG
CGCGGCGAGGCCGCCCTGGAGCGGTTACGCAGCCGGCCGGTTTTCGAAGA
TGCGTCGGCACGTGCCGAGGGTTACGTGGACCAGGCTGTCGAGTTGACTC
AGGAGGCGCTGGGTACTGTCGCGTCGCAGACCCGCGCGGTTGGCGGGCGT
GCAGCCAAACTGGTCGGCATCGAGCTACCCAAGAAGGCGGCGGCGCCTGC
GAGGAAGGCTCCGGCCAAGAAGGCGCCTGCGAAGAAGGCTCCGGCCAAGA
AGGTCACACAGAAA
>C3
ATGGCTGAAAACCCTAACGTCGACGACCTGCGGGCGCCATTGTTGGCAGC
GCTGGGCGCGGCAGACTTGGCCCTGACCACCGTTAATGAGCTGGTCGGCA
ACATGCGCGAACGTGCCGAAGAAACCCGCATCGATACCCGCAGCCGTGTT
GAGGAGAGCCGCGCTCGCGTGGCAAAACTGCAGGAGGTTCTGCCCGAACA
CCTTAGCGAGCTGCGTGAGAAGTTCACCGCCGACGAGTTGCGTAAGGCCG
CTGAGGGCTATTTGGAGGCAGCGACCAACCGGTACAACGAGCTAGTCGAG
CGCGGCGAGGCCGCCCTGGAGCGGTTACGCAGCCGGCCGGTTTTCGAAGA
TGCGTCGGCACGTGCCGAGGGTTACGTGGACCAGGCTGTCGAGTTGACTC
AGGAGGCGCTGGGTACTGTCGCGTCGCAGACCCGCGCGGTTGGCGGGCGT
GCAGCCAAACTGGTCGGCATCGAGCTACCCAAGAAGGCGGCGGCGCCTGC
GAGGAAGGCTCCGGCCAAGAAGGCGCCTGCGAAGAAGGCTCCGGCCAAGA
AGGTCACACAGAAA
>C4
ATGGCTGAAAACCCTAACGTCGACGACCTGCGGGCGCCATTGTTGGCAGC
GCTGGGCGCGGCAGACTTGGCCCTGACCACCGTTAATGAGCTGGTCGGCA
ACATGCGCGAACGTGCCGAAGAAACCCGCATCGATACCCGCAGCCGTGTT
GAGGAGAGCCGCGCTCGCGTGGCAAAACTGCAGGAGGTTCTGCCCGAACA
CCTTAGCGAGCTGCGTGAGAAGTTCACCGCCGACGAGTTGCGTAAGGCCG
CTGAGGGCTATTTGGAGGCAGCGACCAACCGGTACAACGAGCTAGTCGAG
CGCGGCGAGGCCGCCCTGGAGCGGTTACGCAGCCGGCCGGTTTTCGAAGA
TGCGTCGGCACGTGCCGAGGGTTACGTGGACCAGGCTGTCGAGTTGACTC
AGGAGGCGCTGGGTACTGTCGCGTCGCAGACCCGCGCGGTTGGCGGGCGT
GCAGCCAAACTGGTCGGCATCGAGCTACCCAAGAAGGCGGCGGCGCCTGC
GAGGAAGGCTCCGGCCAAGAAGGCGCCTGCGAAGAAGGCTCCGGCCAAGA
AGGTCACACAGAAA
>C5
ATGGCTGAAAACCCTAACGTCGACGACCTGCGGGCGCCATTGTTGGCAGC
GCTGGGCGCGGCAGACTTGGCCCTGACCACCGTTAATGAGCTGGTCGGCA
ACATGCGCGAACGTGCCGAAGAAACCCGCATCGATACCCGCAGCCGTGTT
GAGGAGAGCCGCGCTCGCGTGGCAAAACTGCAGGAGGTTCTGCCCGAACA
CCTTAGCGAGCTGCGTGAGAAGTTCACCGCCGACGAGTTGCGTAAGGCCG
CTGAGGGCTATTTGGAGGCAGCGACCAACCGGTACAACGAGCTAGTCGAG
CGCGGCGAGGCCGCCCTGGAGCGGTTACGCAGCCGGCCGGTTTTCGAAGA
TGCGTCGGCACGTGCCGAGGGTTACGTGGACCAGGCTGTCGAGTTGACTC
AGGAGGCGCTGGGTACTGTCGCGTCGCAGACCCGCGCGGTTGGCGGGCGT
GCAGCCAAACTGGTCGGCATCGAGCTACCCAAGAAGGCGGCGGCGCCTGC
GAGGAAGGCTCCGGCCAAGAAGGCGCCTGCGAAGAAGGCTCCGGCCAAGA
AGGTCACACAGAAA
>C6
ATGGCTGAAAACCCTAACGTCGACGACCTGCGGGCGCCATTGTTGGCAGC
GCTGGGCGCGGCAGACTTGGCCCTGACCACCGTTAATGAGCTGGTCGGCA
ACATGCGCGAACGTGCCGAAGAAACCCGCATCGATACCCGCAGCCGTGTT
GAGGAGAGCCGCGCTCGCGTGGCAAAACTGCAGGAGGTTCTGCCCGAACA
CCTTAGCGAGCTGCGTGAGAAGTTCACCGCCGACGAGTTGCGTAAGGCCG
CTGAGGGCTATTTGGAGGCAGCGACCAACCGGTACAACGAGCTAGTCGAG
CGCGGCGAGGCCGCCCTGGAGCGGTTACGCAGCCGGCCGGTTTTCGAAGA
TGCGTCGGCACGTGCCGAGGGTTACGTGGACCAGGCTGTCGAGTTGACTC
AGGAGGCGCTGGGTACTGTCGCGTCGCAGACCCGCGCGGTTGGCGGGCGT
GCAGCCAAACTGGTCGGCATCGAGCTACCCAAGAAGGCGGCGGCGCCTGC
GAGGAAGGCTCCGGCCAAGAAGGCGCCTGCGAAGAAGGCTCCGGCCAAGA
AGGTCACACAGAAA
>C1
MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
>C2
MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
>C3
MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
>C4
MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
>C5
MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
>C6
MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 564 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579857372
Setting output file names to "/data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 802276519
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5250567552
Seed = 678630564
Swapseed = 1579857372
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1262.259039 -- -24.965149
Chain 2 -- -1262.259039 -- -24.965149
Chain 3 -- -1262.259039 -- -24.965149
Chain 4 -- -1262.259039 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1262.258967 -- -24.965149
Chain 2 -- -1262.258967 -- -24.965149
Chain 3 -- -1262.258967 -- -24.965149
Chain 4 -- -1262.258967 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1262.259] (-1262.259) (-1262.259) (-1262.259) * [-1262.259] (-1262.259) (-1262.259) (-1262.259)
500 -- (-774.301) [-768.296] (-788.236) (-801.045) * (-779.871) (-777.032) [-761.576] (-777.854) -- 0:00:00
1000 -- (-763.543) (-765.781) [-762.380] (-777.619) * (-770.395) (-767.537) [-758.893] (-768.209) -- 0:00:00
1500 -- [-764.922] (-770.917) (-769.139) (-770.059) * (-767.106) (-767.949) (-764.569) [-765.459] -- 0:00:00
2000 -- (-759.206) (-767.778) [-768.302] (-760.386) * (-761.372) (-762.940) [-760.595] (-764.348) -- 0:00:00
2500 -- (-766.841) [-760.185] (-768.001) (-766.690) * (-773.140) (-760.934) [-760.544] (-768.794) -- 0:00:00
3000 -- (-761.542) (-764.428) [-762.512] (-766.216) * [-764.006] (-772.167) (-764.626) (-767.350) -- 0:00:00
3500 -- [-761.912] (-767.040) (-770.334) (-767.349) * [-763.392] (-765.995) (-766.302) (-767.303) -- 0:00:00
4000 -- (-762.051) (-761.806) [-759.964] (-762.055) * (-767.902) [-765.835] (-763.856) (-771.341) -- 0:00:00
4500 -- (-761.492) (-764.344) [-763.875] (-769.408) * (-765.275) (-776.455) [-761.973] (-774.136) -- 0:00:00
5000 -- [-765.530] (-762.272) (-765.180) (-761.531) * (-774.873) (-775.104) [-762.881] (-768.617) -- 0:00:00
Average standard deviation of split frequencies: 0.085710
5500 -- [-761.823] (-769.910) (-771.561) (-763.405) * (-771.799) [-758.556] (-766.971) (-780.656) -- 0:00:00
6000 -- (-764.095) [-764.707] (-761.633) (-767.435) * (-767.173) [-766.088] (-756.569) (-768.222) -- 0:00:00
6500 -- (-759.181) (-770.917) [-769.095] (-781.452) * (-768.453) (-766.074) [-762.696] (-765.440) -- 0:00:00
7000 -- [-766.043] (-770.779) (-767.009) (-767.307) * [-763.402] (-759.545) (-764.397) (-773.992) -- 0:00:00
7500 -- (-763.259) (-764.243) [-760.647] (-767.687) * [-761.262] (-767.011) (-766.741) (-766.365) -- 0:00:00
8000 -- [-760.734] (-762.799) (-767.197) (-769.033) * [-759.644] (-768.952) (-770.135) (-766.092) -- 0:00:00
8500 -- [-763.493] (-768.216) (-760.469) (-768.565) * [-763.944] (-770.658) (-764.960) (-761.331) -- 0:00:00
9000 -- (-769.358) (-771.851) [-756.346] (-764.159) * [-767.508] (-767.005) (-764.132) (-771.926) -- 0:00:00
9500 -- (-772.024) [-764.149] (-757.033) (-781.611) * (-762.589) (-771.689) (-766.737) [-759.504] -- 0:00:00
10000 -- (-767.038) [-761.751] (-755.707) (-764.334) * (-767.389) (-767.924) (-762.844) [-762.266] -- 0:00:00
Average standard deviation of split frequencies: 0.065239
10500 -- (-769.774) (-760.384) [-758.844] (-763.206) * [-764.284] (-765.000) (-762.532) (-762.208) -- 0:00:00
11000 -- (-768.022) [-762.470] (-756.362) (-761.050) * (-764.244) (-757.718) [-761.456] (-771.155) -- 0:00:00
11500 -- (-757.126) [-763.885] (-755.487) (-763.064) * (-770.700) [-755.427] (-767.346) (-767.378) -- 0:00:00
12000 -- (-758.729) (-766.097) [-754.878] (-769.138) * (-771.372) (-760.386) (-762.310) [-758.150] -- 0:00:00
12500 -- (-754.681) (-769.366) (-754.982) [-767.455] * (-772.559) [-759.981] (-773.967) (-764.122) -- 0:00:00
13000 -- (-757.218) (-764.390) [-757.176] (-764.169) * (-770.557) (-756.988) [-764.680] (-760.335) -- 0:00:00
13500 -- (-756.758) [-766.714] (-757.454) (-759.730) * (-764.399) (-756.806) (-765.285) [-760.847] -- 0:00:00
14000 -- (-756.142) (-762.134) [-758.334] (-763.115) * (-763.073) (-754.932) (-763.708) [-763.088] -- 0:00:00
14500 -- (-754.810) [-761.911] (-756.433) (-770.224) * (-769.110) [-757.322] (-766.356) (-771.076) -- 0:00:00
15000 -- (-755.453) [-764.663] (-754.341) (-770.754) * (-763.908) [-755.129] (-762.944) (-766.537) -- 0:01:05
Average standard deviation of split frequencies: 0.057192
15500 -- (-757.054) (-767.029) [-754.330] (-765.136) * (-764.040) (-756.117) (-766.413) [-768.372] -- 0:01:03
16000 -- (-755.757) (-765.870) [-754.156] (-766.970) * [-770.835] (-754.560) (-767.131) (-767.492) -- 0:01:01
16500 -- [-755.854] (-765.074) (-758.776) (-771.722) * (-761.234) [-755.996] (-767.191) (-768.315) -- 0:00:59
17000 -- (-756.083) (-763.024) (-755.803) [-763.809] * (-769.277) (-754.099) (-765.953) [-763.358] -- 0:00:57
17500 -- (-755.972) [-765.665] (-755.439) (-765.221) * (-761.843) (-753.685) (-762.914) [-761.936] -- 0:00:56
18000 -- (-754.838) (-773.519) [-756.768] (-762.044) * (-763.157) [-755.778] (-766.091) (-762.658) -- 0:00:54
18500 -- [-756.536] (-771.885) (-757.975) (-772.955) * (-772.818) (-755.878) (-763.158) [-766.926] -- 0:00:53
19000 -- (-761.028) (-767.623) [-755.427] (-767.873) * (-767.566) [-754.408] (-764.389) (-765.641) -- 0:00:51
19500 -- (-759.902) (-767.703) (-755.325) [-759.307] * (-772.822) (-755.230) [-768.708] (-763.974) -- 0:00:50
20000 -- (-760.835) [-766.393] (-754.738) (-761.182) * (-762.313) (-754.312) [-764.825] (-762.614) -- 0:00:49
Average standard deviation of split frequencies: 0.054744
20500 -- (-755.406) (-773.071) (-754.827) [-760.502] * (-763.460) (-755.001) (-763.656) [-761.545] -- 0:00:47
21000 -- (-758.904) (-766.126) [-755.153] (-760.390) * (-764.590) [-761.279] (-764.725) (-762.619) -- 0:00:46
21500 -- (-758.561) (-786.803) [-755.064] (-767.595) * [-767.126] (-758.068) (-764.027) (-768.175) -- 0:00:45
22000 -- (-756.829) (-766.776) [-753.803] (-760.831) * (-758.879) [-754.089] (-774.174) (-762.871) -- 0:00:44
22500 -- (-757.497) (-757.979) (-756.144) [-760.214] * (-765.122) [-755.491] (-765.915) (-775.699) -- 0:00:43
23000 -- (-759.362) (-754.230) (-754.513) [-759.835] * (-763.985) (-757.340) [-764.221] (-763.431) -- 0:00:42
23500 -- (-756.140) (-755.903) (-754.757) [-774.845] * [-761.089] (-757.906) (-768.600) (-764.664) -- 0:00:41
24000 -- (-755.588) (-759.158) [-754.667] (-765.368) * [-760.557] (-756.083) (-766.914) (-765.535) -- 0:00:40
24500 -- (-757.363) (-753.887) [-754.982] (-766.772) * (-765.315) (-757.847) [-765.198] (-770.992) -- 0:00:39
25000 -- (-761.016) (-755.677) (-756.333) [-763.993] * (-761.140) [-758.340] (-761.684) (-774.445) -- 0:00:39
Average standard deviation of split frequencies: 0.049213
25500 -- (-754.768) [-756.330] (-754.562) (-765.922) * (-764.710) (-755.841) [-764.286] (-767.601) -- 0:00:38
26000 -- (-755.570) (-755.944) (-755.305) [-763.378] * (-769.532) (-760.966) (-767.418) [-763.491] -- 0:00:37
26500 -- (-755.283) (-755.525) [-759.156] (-765.995) * (-760.891) (-755.786) [-767.460] (-768.721) -- 0:00:36
27000 -- [-756.148] (-754.652) (-759.287) (-756.389) * (-763.434) [-755.758] (-768.569) (-766.424) -- 0:00:36
27500 -- (-755.741) (-754.767) (-755.868) [-754.797] * (-774.031) (-757.307) (-771.500) [-764.123] -- 0:00:35
28000 -- (-755.290) [-754.037] (-759.405) (-754.900) * [-761.847] (-755.200) (-761.343) (-757.851) -- 0:00:34
28500 -- (-759.622) [-753.675] (-758.500) (-754.861) * (-766.704) (-759.167) (-768.724) [-761.683] -- 0:00:34
29000 -- (-755.502) [-756.115] (-755.732) (-755.236) * (-776.300) (-756.275) [-769.293] (-756.899) -- 0:00:33
29500 -- (-758.593) [-757.446] (-757.178) (-754.319) * (-769.285) (-756.531) [-773.712] (-754.977) -- 0:00:32
30000 -- (-760.694) (-758.606) (-754.698) [-753.839] * [-765.220] (-755.145) (-764.670) (-755.926) -- 0:00:32
Average standard deviation of split frequencies: 0.049352
30500 -- (-758.773) [-755.242] (-755.650) (-759.226) * (-769.235) (-757.569) [-763.778] (-755.329) -- 0:00:31
31000 -- (-758.813) (-759.108) [-756.082] (-757.366) * (-763.757) (-755.032) [-761.235] (-755.138) -- 0:00:31
31500 -- [-754.982] (-758.607) (-756.638) (-757.403) * (-778.421) (-755.818) [-763.210] (-756.796) -- 0:01:01
32000 -- [-754.984] (-755.455) (-753.870) (-758.021) * (-770.808) (-755.727) (-760.712) [-756.649] -- 0:01:00
32500 -- (-755.130) (-763.870) [-755.012] (-755.651) * [-762.976] (-756.101) (-771.283) (-757.076) -- 0:00:59
33000 -- [-754.468] (-757.447) (-754.357) (-753.782) * (-761.241) [-754.907] (-763.791) (-756.237) -- 0:00:58
33500 -- (-754.908) (-757.473) (-755.245) [-754.494] * [-761.406] (-758.772) (-762.523) (-754.665) -- 0:00:57
34000 -- [-755.088] (-758.706) (-754.751) (-754.317) * (-774.310) (-755.328) [-760.160] (-755.628) -- 0:00:56
34500 -- (-756.744) (-756.905) [-754.083] (-755.985) * [-763.089] (-756.040) (-763.624) (-756.786) -- 0:00:55
35000 -- (-755.047) (-759.345) (-754.231) [-756.182] * (-773.124) (-755.336) [-759.319] (-754.998) -- 0:00:55
Average standard deviation of split frequencies: 0.041248
35500 -- (-755.949) (-758.156) (-755.363) [-755.060] * (-763.119) (-754.798) [-766.621] (-755.873) -- 0:00:54
36000 -- (-754.517) (-756.266) [-754.890] (-755.297) * (-769.704) (-755.498) [-763.315] (-756.066) -- 0:00:53
36500 -- [-754.767] (-754.716) (-755.084) (-755.705) * (-760.930) [-756.398] (-766.534) (-756.436) -- 0:00:52
37000 -- (-756.274) [-754.172] (-753.702) (-755.940) * [-768.276] (-757.414) (-763.386) (-755.468) -- 0:00:52
37500 -- (-759.749) (-754.007) (-760.577) [-757.211] * (-762.420) (-757.554) (-767.166) [-758.921] -- 0:00:51
38000 -- [-756.117] (-755.705) (-761.819) (-758.179) * [-763.429] (-754.762) (-772.873) (-759.001) -- 0:00:50
38500 -- (-758.583) [-754.038] (-757.763) (-756.240) * (-765.996) (-754.428) (-761.629) [-758.966] -- 0:00:49
39000 -- (-754.416) (-754.178) (-754.991) [-754.229] * (-760.133) (-755.511) (-776.139) [-755.521] -- 0:00:49
39500 -- (-763.127) [-755.246] (-755.452) (-757.409) * (-765.400) (-758.942) [-761.441] (-757.375) -- 0:00:48
40000 -- (-754.366) [-755.331] (-755.134) (-758.240) * (-769.774) [-754.649] (-768.455) (-755.581) -- 0:00:48
Average standard deviation of split frequencies: 0.043276
40500 -- [-755.930] (-755.452) (-754.343) (-756.840) * [-764.716] (-755.970) (-754.269) (-758.499) -- 0:00:47
41000 -- (-754.826) [-754.880] (-753.888) (-759.421) * (-763.732) (-755.832) [-757.257] (-757.915) -- 0:00:46
41500 -- (-754.626) (-754.396) (-754.972) [-755.028] * (-760.385) (-758.194) [-757.980] (-755.465) -- 0:00:46
42000 -- (-756.179) [-754.505] (-756.637) (-755.098) * (-765.478) [-755.446] (-754.815) (-755.379) -- 0:00:45
42500 -- (-756.731) (-757.308) [-755.523] (-756.727) * (-763.758) [-755.444] (-755.340) (-758.050) -- 0:00:45
43000 -- (-756.288) (-757.024) (-755.023) [-757.487] * (-771.334) [-756.420] (-757.366) (-757.856) -- 0:00:44
43500 -- (-754.868) [-756.367] (-757.565) (-755.757) * (-769.544) [-757.482] (-759.423) (-758.403) -- 0:00:43
44000 -- (-758.909) (-762.861) (-755.991) [-754.012] * (-760.100) (-760.954) [-755.116] (-758.707) -- 0:00:43
44500 -- [-759.556] (-754.794) (-757.794) (-755.025) * [-763.668] (-754.265) (-755.679) (-755.925) -- 0:00:42
45000 -- (-758.426) [-754.286] (-754.775) (-754.533) * (-766.073) (-755.690) [-757.583] (-758.912) -- 0:00:42
Average standard deviation of split frequencies: 0.035598
45500 -- (-755.644) [-754.936] (-756.513) (-755.468) * [-761.838] (-754.828) (-755.092) (-757.885) -- 0:00:41
46000 -- (-755.656) (-757.582) [-754.125] (-757.204) * (-765.506) [-757.452] (-756.270) (-756.664) -- 0:00:41
46500 -- (-755.180) (-756.072) [-755.111] (-755.358) * (-760.718) (-758.684) [-755.166] (-757.552) -- 0:00:41
47000 -- (-756.581) (-756.910) [-754.975] (-758.356) * [-768.476] (-758.396) (-757.632) (-757.873) -- 0:00:40
47500 -- (-758.188) (-756.234) [-755.203] (-756.765) * (-773.767) [-757.217] (-756.376) (-755.538) -- 0:00:40
48000 -- [-757.952] (-755.588) (-754.663) (-755.986) * (-779.141) (-754.001) (-759.844) [-757.727] -- 0:00:59
48500 -- (-755.126) [-757.847] (-756.653) (-755.397) * (-779.118) (-755.766) (-756.397) [-757.696] -- 0:00:58
49000 -- [-755.113] (-756.557) (-755.963) (-756.784) * (-755.088) [-755.510] (-754.816) (-755.407) -- 0:00:58
49500 -- (-756.806) [-754.800] (-757.161) (-756.667) * (-755.808) (-754.998) (-757.768) [-754.355] -- 0:00:57
50000 -- [-755.722] (-757.445) (-754.952) (-757.272) * (-758.606) [-756.055] (-754.412) (-755.964) -- 0:00:57
Average standard deviation of split frequencies: 0.033495
50500 -- [-755.268] (-758.626) (-754.858) (-756.091) * (-762.396) (-755.777) (-756.969) [-754.946] -- 0:00:56
51000 -- (-756.820) (-755.554) [-754.117] (-755.113) * (-762.951) (-757.274) [-754.960] (-758.205) -- 0:00:55
51500 -- [-755.004] (-756.082) (-755.371) (-756.614) * [-758.282] (-756.724) (-755.254) (-756.331) -- 0:00:55
52000 -- [-753.885] (-758.438) (-756.602) (-754.225) * (-756.607) [-754.267] (-757.090) (-756.905) -- 0:00:54
52500 -- (-755.474) [-755.874] (-758.503) (-755.894) * [-754.742] (-754.680) (-756.171) (-755.881) -- 0:00:54
53000 -- (-754.225) [-757.371] (-755.594) (-755.510) * [-754.945] (-754.924) (-754.846) (-755.359) -- 0:00:53
53500 -- (-754.218) [-758.358] (-756.343) (-755.730) * (-753.816) (-755.222) [-755.878] (-754.841) -- 0:00:53
54000 -- (-757.948) (-764.115) (-754.582) [-757.602] * (-755.203) (-758.940) (-755.280) [-754.384] -- 0:00:52
54500 -- (-757.160) (-756.196) (-757.266) [-756.985] * [-756.784] (-757.753) (-758.880) (-754.347) -- 0:00:52
55000 -- (-756.300) (-755.136) (-754.391) [-756.558] * (-755.234) (-755.838) (-757.110) [-754.257] -- 0:00:51
Average standard deviation of split frequencies: 0.032830
55500 -- (-756.446) (-755.144) (-756.550) [-755.427] * (-755.031) (-756.520) [-756.411] (-754.752) -- 0:00:51
56000 -- (-757.605) (-754.704) [-754.381] (-755.091) * (-754.951) [-755.221] (-758.857) (-755.978) -- 0:00:50
56500 -- (-759.077) (-754.326) (-756.946) [-755.426] * (-761.632) [-756.668] (-757.148) (-755.894) -- 0:00:50
57000 -- (-757.248) (-758.146) [-754.570] (-757.352) * (-756.442) (-757.271) [-755.828] (-763.880) -- 0:00:49
57500 -- (-757.154) (-760.270) [-754.833] (-754.075) * (-755.690) (-758.088) (-755.741) [-754.502] -- 0:00:49
58000 -- (-754.946) (-754.939) (-756.628) [-757.732] * [-756.075] (-758.837) (-755.707) (-755.585) -- 0:00:48
58500 -- (-757.161) (-753.995) (-755.163) [-760.203] * (-756.595) [-755.092] (-757.010) (-754.501) -- 0:00:48
59000 -- (-756.392) (-755.768) [-754.316] (-754.563) * [-755.468] (-755.227) (-755.990) (-754.152) -- 0:00:47
59500 -- (-756.359) [-755.298] (-756.524) (-757.851) * (-756.868) [-754.372] (-757.537) (-754.252) -- 0:00:47
60000 -- (-757.032) (-758.911) (-757.203) [-754.344] * (-756.839) (-755.486) (-756.637) [-756.937] -- 0:00:47
Average standard deviation of split frequencies: 0.033126
60500 -- [-755.769] (-758.345) (-754.127) (-755.964) * [-756.412] (-756.769) (-755.272) (-762.819) -- 0:00:46
61000 -- (-754.433) (-755.085) [-754.754] (-760.375) * (-758.018) (-754.783) [-755.105] (-760.315) -- 0:00:46
61500 -- (-755.164) (-755.238) (-758.325) [-755.551] * [-757.426] (-754.481) (-757.283) (-756.389) -- 0:00:45
62000 -- (-758.895) (-755.880) [-756.651] (-757.408) * (-758.910) [-754.473] (-755.118) (-754.724) -- 0:00:45
62500 -- (-755.297) (-753.939) (-758.289) [-755.194] * (-754.890) (-756.914) [-756.826] (-755.196) -- 0:00:45
63000 -- (-757.892) (-756.617) (-758.002) [-756.225] * (-755.889) (-761.960) [-757.369] (-754.605) -- 0:00:44
63500 -- (-757.496) [-758.090] (-757.794) (-754.220) * [-756.805] (-754.803) (-755.491) (-755.622) -- 0:00:44
64000 -- (-756.423) (-756.227) [-756.584] (-754.331) * (-759.422) (-758.629) [-756.921] (-754.831) -- 0:00:43
64500 -- (-755.965) (-755.469) (-754.733) [-757.335] * (-755.061) (-756.102) (-759.768) [-759.008] -- 0:00:43
65000 -- (-754.706) (-756.343) (-757.980) [-754.352] * [-754.895] (-754.967) (-756.642) (-760.434) -- 0:00:57
Average standard deviation of split frequencies: 0.027856
65500 -- (-759.599) (-759.367) [-754.077] (-755.716) * (-758.477) (-757.425) (-753.987) [-755.960] -- 0:00:57
66000 -- [-755.266] (-756.460) (-754.609) (-756.767) * (-756.912) (-757.430) [-756.500] (-755.868) -- 0:00:56
66500 -- (-756.011) (-757.530) (-763.122) [-756.504] * [-755.214] (-754.489) (-758.999) (-756.302) -- 0:00:56
67000 -- (-757.015) (-756.750) (-756.996) [-755.427] * [-755.095] (-756.163) (-756.687) (-754.711) -- 0:00:55
67500 -- (-755.581) (-757.914) (-757.499) [-758.996] * (-758.616) (-755.749) [-756.268] (-755.955) -- 0:00:55
68000 -- [-754.996] (-757.922) (-759.342) (-755.415) * (-757.604) (-754.515) [-755.214] (-756.485) -- 0:00:54
68500 -- (-755.159) (-759.014) (-755.794) [-756.472] * (-758.409) (-754.687) [-755.353] (-757.298) -- 0:00:54
69000 -- (-757.909) [-755.967] (-755.474) (-756.976) * (-759.425) (-754.390) (-760.498) [-754.278] -- 0:00:53
69500 -- (-756.287) (-757.484) [-760.887] (-755.075) * (-765.028) [-755.788] (-755.044) (-754.324) -- 0:00:53
70000 -- (-754.811) [-754.317] (-760.134) (-756.788) * (-758.038) [-755.186] (-756.993) (-754.117) -- 0:00:53
Average standard deviation of split frequencies: 0.028017
70500 -- (-756.887) (-754.041) (-757.676) [-757.407] * (-755.200) (-754.710) [-755.052] (-760.826) -- 0:00:52
71000 -- (-757.629) (-755.696) [-755.947] (-755.755) * [-756.716] (-754.854) (-755.990) (-755.958) -- 0:00:52
71500 -- (-760.192) (-756.453) (-760.945) [-756.750] * (-757.103) (-757.711) (-755.048) [-754.505] -- 0:00:51
72000 -- (-756.225) (-755.655) [-761.561] (-757.289) * (-755.306) [-759.562] (-755.225) (-758.870) -- 0:00:51
72500 -- (-753.739) (-755.210) (-755.312) [-756.952] * (-754.929) [-755.925] (-754.037) (-756.387) -- 0:00:51
73000 -- (-753.883) [-756.274] (-754.574) (-754.790) * (-756.804) [-755.453] (-754.422) (-755.793) -- 0:00:50
73500 -- (-755.145) [-755.578] (-754.615) (-754.467) * (-755.176) (-759.128) (-754.975) [-754.662] -- 0:00:50
74000 -- (-754.223) [-755.312] (-754.325) (-756.485) * [-755.803] (-756.321) (-757.179) (-754.662) -- 0:00:50
74500 -- [-755.888] (-757.232) (-755.023) (-759.668) * (-757.405) (-754.372) (-757.833) [-754.075] -- 0:00:49
75000 -- (-756.495) [-756.600] (-754.537) (-754.626) * (-754.990) (-756.817) (-759.154) [-756.070] -- 0:00:49
Average standard deviation of split frequencies: 0.029708
75500 -- (-754.978) [-757.607] (-755.416) (-755.149) * (-758.482) [-755.696] (-756.355) (-757.602) -- 0:00:48
76000 -- [-755.931] (-755.522) (-755.903) (-757.782) * (-755.647) [-756.704] (-757.302) (-757.575) -- 0:00:48
76500 -- (-757.079) (-758.239) [-755.351] (-754.666) * (-754.671) (-762.627) [-754.522] (-755.585) -- 0:00:48
77000 -- (-757.404) (-757.705) [-756.685] (-754.034) * (-754.915) [-757.088] (-754.369) (-755.854) -- 0:00:47
77500 -- [-756.433] (-759.552) (-755.682) (-755.415) * (-754.350) (-757.302) (-753.941) [-754.441] -- 0:00:47
78000 -- (-758.083) (-758.333) (-755.101) [-755.904] * (-755.527) (-760.339) (-756.629) [-754.848] -- 0:00:47
78500 -- (-757.991) (-757.869) [-754.175] (-754.266) * (-755.524) (-757.572) [-756.837] (-755.318) -- 0:00:46
79000 -- (-759.989) (-756.711) (-755.220) [-754.136] * (-754.475) [-757.204] (-756.962) (-757.517) -- 0:00:46
79500 -- (-754.598) (-754.719) (-756.838) [-756.329] * [-754.373] (-755.541) (-759.905) (-754.572) -- 0:00:46
80000 -- (-755.213) [-756.202] (-756.363) (-756.147) * [-754.560] (-758.485) (-759.616) (-755.221) -- 0:00:46
Average standard deviation of split frequencies: 0.031372
80500 -- (-755.759) (-755.998) [-763.005] (-757.760) * (-754.516) (-755.921) (-760.226) [-757.410] -- 0:00:45
81000 -- (-756.120) (-756.300) (-760.010) [-756.440] * (-757.472) [-755.471] (-759.399) (-757.106) -- 0:00:45
81500 -- (-754.717) (-755.369) [-757.727] (-756.808) * (-755.875) (-756.717) (-756.034) [-755.584] -- 0:00:56
82000 -- [-755.699] (-755.654) (-756.722) (-757.006) * (-754.402) (-756.195) [-758.192] (-757.032) -- 0:00:55
82500 -- [-755.719] (-757.238) (-757.640) (-754.580) * (-755.021) (-755.477) (-756.190) [-754.864] -- 0:00:55
83000 -- (-755.726) [-756.434] (-756.981) (-755.576) * (-756.680) [-754.967] (-756.771) (-755.334) -- 0:00:55
83500 -- (-754.815) (-754.992) [-755.554] (-762.822) * (-756.361) (-755.890) (-755.610) [-755.278] -- 0:00:54
84000 -- [-754.209] (-764.425) (-756.638) (-756.892) * (-757.686) (-760.042) (-755.030) [-754.831] -- 0:00:54
84500 -- (-755.423) (-754.444) (-757.934) [-756.583] * [-759.482] (-758.133) (-755.922) (-754.979) -- 0:00:54
85000 -- [-759.023] (-754.962) (-755.949) (-755.233) * (-759.479) [-756.454] (-759.666) (-757.137) -- 0:00:53
Average standard deviation of split frequencies: 0.029600
85500 -- (-754.566) (-755.494) [-758.153] (-756.236) * (-754.807) (-756.658) [-755.642] (-754.122) -- 0:00:53
86000 -- (-755.300) [-755.699] (-758.429) (-754.000) * (-754.973) [-756.230] (-755.281) (-754.681) -- 0:00:53
86500 -- (-755.738) (-757.289) [-755.066] (-754.274) * [-754.632] (-754.196) (-754.694) (-755.438) -- 0:00:52
87000 -- (-758.789) [-753.788] (-758.259) (-754.791) * (-755.158) (-753.822) (-760.296) [-755.077] -- 0:00:52
87500 -- (-757.209) (-755.961) (-755.154) [-755.882] * (-755.580) (-756.940) (-756.507) [-755.341] -- 0:00:52
88000 -- (-757.217) (-756.468) [-754.030] (-759.237) * (-754.726) (-755.024) (-755.812) [-756.863] -- 0:00:51
88500 -- [-753.739] (-755.882) (-756.832) (-759.407) * (-754.933) [-754.604] (-755.508) (-755.621) -- 0:00:51
89000 -- (-754.815) (-755.189) (-755.640) [-757.670] * (-760.094) (-757.487) (-758.481) [-754.283] -- 0:00:51
89500 -- [-753.941] (-754.443) (-757.457) (-758.018) * (-756.088) (-766.052) (-758.535) [-756.201] -- 0:00:50
90000 -- [-754.109] (-754.757) (-755.351) (-756.671) * [-756.846] (-761.240) (-757.275) (-756.371) -- 0:00:50
Average standard deviation of split frequencies: 0.028856
90500 -- (-757.702) (-754.180) [-756.177] (-759.274) * (-756.541) (-757.283) (-756.810) [-755.183] -- 0:00:50
91000 -- [-755.638] (-756.499) (-757.575) (-755.264) * [-756.620] (-758.386) (-756.315) (-756.737) -- 0:00:49
91500 -- (-753.786) (-762.221) (-754.691) [-755.367] * (-755.182) (-758.822) (-757.159) [-755.082] -- 0:00:49
92000 -- (-754.918) [-759.011] (-756.334) (-757.481) * [-754.904] (-756.415) (-759.000) (-762.530) -- 0:00:49
92500 -- [-757.953] (-754.874) (-757.005) (-757.587) * [-754.802] (-760.890) (-756.486) (-760.430) -- 0:00:49
93000 -- (-753.981) (-755.597) [-755.958] (-756.438) * [-755.294] (-756.120) (-755.016) (-754.924) -- 0:00:48
93500 -- (-755.947) (-755.213) (-756.000) [-756.312] * [-755.490] (-758.738) (-756.186) (-754.966) -- 0:00:48
94000 -- (-753.657) [-754.646] (-755.987) (-757.632) * (-756.295) (-757.144) [-756.804] (-754.698) -- 0:00:48
94500 -- (-754.409) (-754.992) (-756.419) [-757.751] * (-760.661) (-756.808) (-756.782) [-754.777] -- 0:00:47
95000 -- [-757.297] (-754.704) (-754.570) (-754.395) * (-756.140) (-755.834) [-755.125] (-757.888) -- 0:00:47
Average standard deviation of split frequencies: 0.028687
95500 -- (-755.475) (-755.980) [-756.522] (-758.004) * (-755.072) [-754.254] (-755.791) (-755.460) -- 0:00:47
96000 -- (-755.798) [-754.142] (-755.600) (-755.729) * (-754.402) (-755.798) (-755.272) [-758.579] -- 0:00:47
96500 -- (-756.839) (-760.770) [-755.167] (-756.567) * [-759.117] (-755.808) (-754.085) (-756.775) -- 0:00:46
97000 -- (-756.864) (-755.429) [-756.317] (-755.823) * (-759.606) (-756.650) [-754.042] (-758.179) -- 0:00:46
97500 -- (-755.966) (-755.241) [-758.766] (-757.277) * (-756.381) (-757.791) [-757.733] (-758.986) -- 0:00:46
98000 -- (-756.144) (-756.796) (-758.731) [-754.773] * (-755.854) (-755.056) [-754.246] (-756.823) -- 0:00:46
98500 -- (-755.799) (-755.123) (-755.730) [-756.946] * [-755.068] (-756.302) (-755.688) (-756.872) -- 0:00:54
99000 -- [-755.636] (-755.223) (-754.241) (-758.432) * (-754.437) [-757.649] (-755.516) (-760.322) -- 0:00:54
99500 -- (-757.307) [-758.855] (-754.515) (-756.499) * (-759.802) (-755.728) [-756.475] (-756.209) -- 0:00:54
100000 -- (-758.154) [-760.909] (-754.981) (-755.658) * (-756.700) (-757.847) (-756.640) [-754.931] -- 0:00:54
Average standard deviation of split frequencies: 0.028877
100500 -- (-757.051) [-754.939] (-755.018) (-756.852) * (-758.672) [-758.803] (-757.020) (-754.778) -- 0:00:53
101000 -- (-757.421) (-756.888) [-755.730] (-755.419) * (-756.109) (-757.469) (-755.249) [-755.407] -- 0:00:53
101500 -- (-758.273) (-755.746) (-755.855) [-754.681] * (-754.949) (-755.502) [-761.290] (-757.973) -- 0:00:53
102000 -- (-755.925) [-754.996] (-755.653) (-759.301) * [-760.673] (-757.052) (-757.899) (-755.444) -- 0:00:52
102500 -- (-758.127) (-754.144) (-755.339) [-756.634] * (-761.048) [-758.326] (-758.548) (-756.321) -- 0:00:52
103000 -- (-754.267) (-756.676) [-756.653] (-754.521) * (-756.631) [-756.461] (-756.339) (-755.862) -- 0:00:52
103500 -- [-755.006] (-755.028) (-759.355) (-754.143) * (-756.804) (-756.540) (-757.180) [-754.887] -- 0:00:51
104000 -- [-754.988] (-755.017) (-757.565) (-755.554) * (-756.756) [-755.437] (-754.389) (-758.421) -- 0:00:51
104500 -- [-757.934] (-756.192) (-755.937) (-758.156) * (-755.235) (-755.117) [-754.719] (-759.845) -- 0:00:51
105000 -- [-756.790] (-758.142) (-754.970) (-755.451) * [-756.330] (-755.268) (-756.064) (-755.591) -- 0:00:51
Average standard deviation of split frequencies: 0.023875
105500 -- (-755.294) (-759.263) (-755.573) [-756.531] * (-755.015) (-755.054) (-754.623) [-755.545] -- 0:00:50
106000 -- (-754.786) [-757.089] (-759.504) (-756.581) * (-755.693) (-755.045) [-756.120] (-756.258) -- 0:00:50
106500 -- (-756.514) [-754.849] (-755.321) (-760.097) * (-758.707) (-757.493) [-755.420] (-755.182) -- 0:00:50
107000 -- (-755.491) [-755.177] (-757.029) (-757.137) * (-755.529) [-755.278] (-755.674) (-754.848) -- 0:00:50
107500 -- (-756.489) (-755.264) (-763.344) [-754.275] * [-755.883] (-755.661) (-754.542) (-757.729) -- 0:00:49
108000 -- [-758.665] (-755.478) (-758.418) (-756.939) * (-756.002) [-754.279] (-755.617) (-760.222) -- 0:00:49
108500 -- [-754.619] (-756.344) (-754.763) (-757.762) * (-757.083) (-755.106) (-757.550) [-757.571] -- 0:00:49
109000 -- (-754.241) [-757.942] (-757.468) (-757.644) * (-757.414) (-756.382) [-759.136] (-757.935) -- 0:00:49
109500 -- (-755.934) (-756.615) [-755.814] (-756.575) * (-756.756) [-756.493] (-757.875) (-756.036) -- 0:00:48
110000 -- (-758.016) [-757.624] (-754.714) (-758.755) * (-758.179) (-757.706) [-755.162] (-754.229) -- 0:00:48
Average standard deviation of split frequencies: 0.023540
110500 -- (-755.937) [-757.285] (-754.994) (-756.669) * (-754.607) (-758.519) [-755.748] (-757.790) -- 0:00:48
111000 -- (-755.800) [-755.310] (-754.843) (-756.517) * (-759.773) (-755.167) [-756.101] (-757.585) -- 0:00:48
111500 -- (-757.361) (-755.257) [-755.943] (-754.238) * [-755.989] (-755.940) (-756.609) (-758.716) -- 0:00:47
112000 -- (-758.762) (-757.796) [-754.783] (-754.106) * (-755.054) (-755.219) (-756.746) [-755.085] -- 0:00:47
112500 -- (-754.791) (-756.197) [-754.753] (-756.744) * (-755.140) (-755.971) (-757.513) [-757.612] -- 0:00:47
113000 -- (-755.127) (-762.746) (-755.176) [-755.485] * (-756.054) (-758.848) [-757.033] (-754.942) -- 0:00:47
113500 -- (-755.694) (-761.201) [-756.528] (-757.345) * (-755.149) [-756.742] (-758.139) (-757.811) -- 0:00:46
114000 -- [-755.718] (-758.216) (-760.710) (-755.679) * (-755.528) (-755.059) [-756.078] (-755.913) -- 0:00:46
114500 -- (-755.483) (-756.176) (-757.673) [-755.763] * (-757.873) (-754.064) (-757.149) [-756.434] -- 0:00:46
115000 -- (-754.245) (-755.011) (-754.267) [-754.031] * [-756.043] (-756.978) (-754.139) (-755.041) -- 0:00:53
Average standard deviation of split frequencies: 0.023527
115500 -- (-762.730) (-755.601) (-753.782) [-754.249] * (-755.395) [-755.030] (-753.880) (-755.028) -- 0:00:53
116000 -- (-756.988) (-757.728) [-754.226] (-756.325) * (-755.481) (-754.143) [-754.343] (-757.849) -- 0:00:53
116500 -- (-758.230) (-755.253) (-755.124) [-756.746] * [-756.148] (-755.343) (-757.844) (-754.437) -- 0:00:53
117000 -- (-754.068) [-755.526] (-759.179) (-754.084) * (-761.112) (-756.771) (-758.200) [-755.574] -- 0:00:52
117500 -- [-753.578] (-758.291) (-755.892) (-757.858) * (-756.082) (-756.154) (-756.849) [-756.838] -- 0:00:52
118000 -- (-755.640) (-759.423) (-759.405) [-755.605] * [-756.287] (-754.706) (-755.010) (-758.413) -- 0:00:52
118500 -- [-754.241] (-758.227) (-760.661) (-758.634) * (-755.333) (-756.814) (-755.686) [-755.043] -- 0:00:52
119000 -- (-756.787) [-753.829] (-768.743) (-755.942) * (-758.266) [-755.357] (-756.526) (-755.107) -- 0:00:51
119500 -- [-756.619] (-756.182) (-764.864) (-756.258) * [-760.406] (-757.060) (-755.386) (-757.202) -- 0:00:51
120000 -- (-754.696) (-759.013) [-755.489] (-756.215) * (-757.715) [-760.666] (-760.205) (-756.846) -- 0:00:51
Average standard deviation of split frequencies: 0.023029
120500 -- (-754.407) (-754.701) [-753.718] (-753.613) * [-756.572] (-758.099) (-754.982) (-754.418) -- 0:00:51
121000 -- [-755.791] (-755.485) (-754.337) (-755.159) * (-757.885) (-759.019) [-754.809] (-754.438) -- 0:00:50
121500 -- (-754.512) (-759.055) (-758.872) [-757.789] * (-762.278) (-756.396) [-755.151] (-754.489) -- 0:00:50
122000 -- [-754.732] (-754.577) (-762.536) (-762.526) * (-756.035) (-760.572) (-756.595) [-753.713] -- 0:00:50
122500 -- (-754.691) (-756.597) (-756.349) [-756.810] * [-754.563] (-756.833) (-754.443) (-755.767) -- 0:00:50
123000 -- (-755.513) [-757.188] (-756.971) (-761.100) * (-755.221) [-758.319] (-754.291) (-755.648) -- 0:00:49
123500 -- (-757.790) (-760.845) [-754.256] (-759.495) * (-755.626) (-762.071) (-757.315) [-755.792] -- 0:00:49
124000 -- (-764.850) [-757.390] (-756.118) (-758.610) * [-754.969] (-759.662) (-754.943) (-755.368) -- 0:00:49
124500 -- (-755.872) [-757.707] (-756.631) (-759.418) * (-759.511) (-757.117) (-759.336) [-756.096] -- 0:00:49
125000 -- (-756.622) (-758.394) (-756.579) [-760.245] * (-754.841) [-755.086] (-757.335) (-758.312) -- 0:00:49
Average standard deviation of split frequencies: 0.025254
125500 -- [-760.402] (-758.959) (-757.486) (-756.736) * (-753.960) (-755.385) (-755.423) [-755.871] -- 0:00:48
126000 -- (-755.009) (-756.027) [-753.988] (-762.625) * [-754.822] (-757.918) (-755.325) (-757.603) -- 0:00:48
126500 -- (-758.519) (-755.970) [-754.589] (-759.870) * [-754.506] (-758.936) (-757.232) (-759.074) -- 0:00:48
127000 -- [-755.788] (-756.892) (-754.983) (-755.326) * [-754.031] (-755.741) (-762.924) (-754.882) -- 0:00:48
127500 -- (-759.505) (-760.435) (-755.666) [-754.821] * (-754.614) (-756.686) (-754.857) [-755.737] -- 0:00:47
128000 -- (-755.732) [-754.593] (-759.780) (-755.060) * (-754.964) (-755.432) [-757.071] (-755.389) -- 0:00:47
128500 -- (-756.598) [-754.770] (-757.344) (-754.988) * (-756.699) (-757.771) [-757.369] (-755.283) -- 0:00:47
129000 -- (-754.546) [-754.937] (-754.833) (-761.264) * (-755.137) [-755.954] (-760.341) (-756.304) -- 0:00:47
129500 -- [-754.155] (-755.768) (-755.602) (-755.658) * [-755.326] (-755.954) (-757.391) (-754.834) -- 0:00:47
130000 -- [-755.979] (-756.920) (-757.200) (-758.342) * [-754.746] (-755.102) (-758.062) (-754.536) -- 0:00:46
Average standard deviation of split frequencies: 0.023991
130500 -- [-755.162] (-755.382) (-759.026) (-756.174) * (-758.484) (-755.293) [-755.060] (-757.340) -- 0:00:46
131000 -- (-755.003) (-756.737) [-755.466] (-756.737) * (-759.707) [-754.282] (-755.460) (-753.902) -- 0:00:46
131500 -- (-757.439) [-757.614] (-755.214) (-757.647) * (-758.645) (-756.122) [-762.065] (-755.545) -- 0:00:52
132000 -- (-757.710) (-754.732) [-754.604] (-757.283) * (-756.038) (-753.943) [-756.151] (-759.042) -- 0:00:52
132500 -- [-756.506] (-754.433) (-754.739) (-757.228) * (-757.140) [-753.990] (-755.435) (-756.448) -- 0:00:52
133000 -- (-754.484) (-755.649) (-755.691) [-754.496] * (-755.751) (-755.615) [-757.518] (-755.564) -- 0:00:52
133500 -- (-757.729) (-764.246) [-757.124] (-754.466) * [-754.844] (-756.587) (-756.028) (-754.935) -- 0:00:51
134000 -- (-754.243) (-755.521) [-754.021] (-757.430) * [-754.623] (-757.278) (-762.355) (-754.601) -- 0:00:51
134500 -- (-756.214) (-755.140) (-755.672) [-756.366] * (-755.861) [-756.332] (-756.414) (-755.004) -- 0:00:51
135000 -- (-759.574) (-756.462) [-754.380] (-757.826) * (-756.237) (-755.440) [-754.960] (-756.643) -- 0:00:51
Average standard deviation of split frequencies: 0.023224
135500 -- (-760.302) (-757.254) [-754.622] (-757.547) * [-754.385] (-755.420) (-757.665) (-756.094) -- 0:00:51
136000 -- [-754.842] (-756.838) (-754.365) (-757.578) * (-754.725) [-754.704] (-755.350) (-753.866) -- 0:00:50
136500 -- (-754.021) (-756.361) [-754.914] (-757.043) * (-755.913) [-754.965] (-756.164) (-755.105) -- 0:00:50
137000 -- (-757.472) (-756.745) (-754.989) [-759.036] * (-755.993) (-755.943) (-754.366) [-756.339] -- 0:00:50
137500 -- [-755.864] (-760.114) (-757.270) (-755.903) * (-754.807) [-757.752] (-754.710) (-755.340) -- 0:00:50
138000 -- (-755.485) (-761.985) (-755.619) [-754.337] * (-759.472) [-754.563] (-756.020) (-755.467) -- 0:00:49
138500 -- (-758.577) (-756.747) [-754.019] (-757.072) * (-759.034) (-753.898) (-756.462) [-754.723] -- 0:00:49
139000 -- [-762.077] (-754.796) (-754.184) (-757.261) * (-759.718) [-755.944] (-758.181) (-754.343) -- 0:00:49
139500 -- (-755.918) (-755.514) (-753.950) [-755.504] * (-758.330) [-755.033] (-756.571) (-758.691) -- 0:00:49
140000 -- (-757.024) [-755.496] (-756.134) (-757.562) * (-755.228) [-756.798] (-754.815) (-761.844) -- 0:00:49
Average standard deviation of split frequencies: 0.022956
140500 -- (-756.278) (-759.301) (-758.412) [-757.309] * (-758.572) (-755.256) (-757.469) [-755.110] -- 0:00:48
141000 -- (-755.721) (-754.568) (-754.864) [-757.028] * (-757.033) (-755.689) [-756.548] (-755.417) -- 0:00:48
141500 -- (-757.576) [-755.923] (-755.763) (-756.052) * (-757.256) (-755.623) (-755.947) [-755.893] -- 0:00:48
142000 -- (-757.381) (-759.943) [-754.515] (-755.567) * (-755.536) [-756.865] (-755.945) (-756.105) -- 0:00:48
142500 -- (-757.699) [-756.136] (-758.672) (-754.045) * (-754.832) (-756.315) (-757.314) [-753.870] -- 0:00:48
143000 -- (-759.050) [-755.904] (-761.565) (-756.193) * (-757.373) (-756.054) (-758.149) [-756.068] -- 0:00:47
143500 -- (-756.662) [-755.163] (-759.183) (-758.051) * (-756.571) (-755.402) [-754.981] (-757.758) -- 0:00:47
144000 -- (-756.430) (-757.737) [-756.009] (-754.870) * [-755.555] (-756.183) (-754.992) (-758.539) -- 0:00:47
144500 -- [-757.078] (-755.854) (-758.638) (-756.812) * [-755.632] (-754.602) (-756.620) (-755.952) -- 0:00:47
145000 -- (-756.230) (-757.805) [-754.525] (-757.496) * (-756.020) (-754.805) [-755.011] (-756.439) -- 0:00:47
Average standard deviation of split frequencies: 0.021134
145500 -- (-756.982) (-756.374) (-764.848) [-758.736] * (-760.531) [-755.559] (-754.736) (-758.963) -- 0:00:46
146000 -- [-755.675] (-756.430) (-759.345) (-757.356) * [-756.081] (-754.854) (-755.164) (-757.101) -- 0:00:46
146500 -- [-757.041] (-757.069) (-755.289) (-756.381) * [-757.855] (-754.697) (-755.701) (-757.541) -- 0:00:46
147000 -- (-757.239) [-754.004] (-761.368) (-758.187) * (-755.322) (-755.304) (-754.431) [-754.663] -- 0:00:46
147500 -- [-756.713] (-755.829) (-760.170) (-757.593) * (-757.062) (-755.420) [-756.006] (-755.811) -- 0:00:46
148000 -- (-756.549) (-757.609) [-757.186] (-757.986) * (-756.832) (-757.660) [-755.361] (-756.877) -- 0:00:51
148500 -- (-758.165) (-756.059) [-755.342] (-754.159) * (-756.984) (-759.847) [-755.627] (-756.388) -- 0:00:51
149000 -- (-756.035) [-756.099] (-757.843) (-753.782) * [-758.625] (-756.303) (-754.062) (-757.100) -- 0:00:51
149500 -- (-754.582) (-757.394) (-758.639) [-753.910] * [-757.731] (-758.195) (-754.961) (-756.651) -- 0:00:51
150000 -- [-754.562] (-754.026) (-758.613) (-754.990) * [-756.015] (-764.233) (-756.522) (-756.023) -- 0:00:51
Average standard deviation of split frequencies: 0.020263
150500 -- (-753.824) (-755.088) [-754.701] (-755.002) * (-756.990) (-757.418) (-754.809) [-755.171] -- 0:00:50
151000 -- (-758.242) (-755.175) (-758.225) [-758.144] * (-755.970) [-757.970] (-755.821) (-756.485) -- 0:00:50
151500 -- (-756.381) (-756.685) [-757.166] (-758.770) * (-758.491) (-755.760) (-756.335) [-756.583] -- 0:00:50
152000 -- (-756.388) [-755.098] (-755.171) (-754.931) * [-754.717] (-756.747) (-757.407) (-759.611) -- 0:00:50
152500 -- (-754.993) (-754.782) [-754.767] (-754.139) * (-755.155) (-757.144) [-755.593] (-755.379) -- 0:00:50
153000 -- (-753.797) (-754.884) [-755.182] (-754.703) * [-757.626] (-756.627) (-759.458) (-757.171) -- 0:00:49
153500 -- (-759.312) (-754.328) [-755.965] (-760.485) * (-756.173) (-759.191) [-758.954] (-755.568) -- 0:00:49
154000 -- (-755.196) [-755.685] (-755.917) (-757.912) * (-756.402) (-758.529) (-762.195) [-755.366] -- 0:00:49
154500 -- (-754.572) [-754.928] (-757.314) (-755.413) * [-754.612] (-757.921) (-755.912) (-756.319) -- 0:00:49
155000 -- (-758.007) [-755.841] (-757.079) (-756.037) * (-757.077) [-755.939] (-754.361) (-758.067) -- 0:00:49
Average standard deviation of split frequencies: 0.021002
155500 -- (-754.871) (-757.637) [-754.663] (-754.771) * [-756.879] (-757.627) (-756.766) (-758.484) -- 0:00:48
156000 -- (-754.821) (-756.239) (-754.600) [-755.262] * (-760.516) (-755.027) (-759.432) [-758.275] -- 0:00:48
156500 -- (-754.022) (-762.661) (-754.694) [-755.244] * (-756.658) (-757.277) [-754.902] (-756.720) -- 0:00:48
157000 -- (-755.900) (-757.337) [-755.357] (-757.950) * (-757.434) [-757.814] (-755.797) (-756.888) -- 0:00:48
157500 -- (-756.681) (-756.640) [-755.482] (-758.526) * (-760.458) (-756.969) (-756.959) [-757.734] -- 0:00:48
158000 -- (-754.447) (-757.696) (-754.266) [-755.049] * (-759.275) [-755.789] (-759.229) (-757.226) -- 0:00:47
158500 -- [-755.391] (-758.336) (-754.960) (-754.506) * [-758.057] (-754.977) (-757.885) (-759.090) -- 0:00:47
159000 -- (-758.264) [-754.375] (-755.634) (-755.741) * (-758.606) (-754.225) (-756.681) [-755.307] -- 0:00:47
159500 -- [-756.072] (-756.457) (-756.751) (-754.265) * (-757.984) (-754.886) [-756.657] (-756.317) -- 0:00:47
160000 -- (-759.215) (-756.793) [-755.263] (-754.001) * [-755.312] (-756.795) (-757.265) (-756.810) -- 0:00:47
Average standard deviation of split frequencies: 0.020538
160500 -- (-757.496) [-755.165] (-756.898) (-754.092) * (-755.527) [-757.714] (-755.871) (-755.004) -- 0:00:47
161000 -- (-758.721) (-757.802) (-759.632) [-759.010] * (-756.410) (-753.888) (-755.067) [-755.490] -- 0:00:46
161500 -- (-754.112) [-760.485] (-758.889) (-759.706) * (-758.125) (-754.929) [-755.238] (-755.953) -- 0:00:46
162000 -- [-755.963] (-756.709) (-755.262) (-757.011) * (-759.865) (-757.302) [-754.942] (-757.113) -- 0:00:46
162500 -- (-757.011) (-755.925) [-755.942] (-755.896) * (-755.671) (-756.142) (-757.196) [-761.404] -- 0:00:46
163000 -- (-756.990) (-756.202) (-755.077) [-754.224] * (-754.950) (-758.391) [-756.518] (-759.171) -- 0:00:46
163500 -- (-758.247) (-756.205) [-755.669] (-753.698) * (-755.211) [-755.574] (-756.304) (-757.101) -- 0:00:46
164000 -- (-762.832) (-756.340) (-755.183) [-754.918] * (-756.192) (-755.359) (-756.562) [-755.849] -- 0:00:45
164500 -- (-760.648) (-757.258) (-756.688) [-756.664] * (-760.732) [-753.761] (-760.753) (-755.696) -- 0:00:50
165000 -- (-755.917) [-754.935] (-756.757) (-759.292) * (-758.137) (-757.126) [-754.321] (-756.069) -- 0:00:50
Average standard deviation of split frequencies: 0.021156
165500 -- (-756.252) [-759.094] (-755.746) (-759.070) * (-762.227) (-758.547) [-755.059] (-756.005) -- 0:00:50
166000 -- (-755.266) (-756.929) [-755.452] (-756.970) * (-756.793) (-755.867) [-757.529] (-757.603) -- 0:00:50
166500 -- (-753.930) (-755.921) (-756.491) [-758.733] * (-755.188) (-756.806) (-757.668) [-754.729] -- 0:00:50
167000 -- (-753.886) (-756.647) [-759.414] (-756.161) * (-755.912) [-758.210] (-755.045) (-755.899) -- 0:00:49
167500 -- (-755.672) (-757.938) [-760.174] (-754.318) * (-758.029) (-755.982) (-759.023) [-754.531] -- 0:00:49
168000 -- (-755.624) (-756.358) [-755.245] (-754.664) * (-753.994) (-760.040) [-756.302] (-756.535) -- 0:00:49
168500 -- (-756.490) (-756.527) (-755.058) [-754.689] * (-753.971) (-755.720) [-754.464] (-759.559) -- 0:00:49
169000 -- [-759.078] (-756.436) (-755.774) (-754.800) * (-756.167) [-756.951] (-757.745) (-755.679) -- 0:00:49
169500 -- (-756.179) (-755.135) (-757.928) [-754.514] * (-756.361) [-757.875] (-756.909) (-756.600) -- 0:00:48
170000 -- (-758.282) (-754.821) (-759.313) [-754.157] * (-756.877) (-758.867) [-754.430] (-761.784) -- 0:00:48
Average standard deviation of split frequencies: 0.020025
170500 -- (-758.143) (-754.998) [-755.635] (-759.333) * [-754.846] (-756.688) (-754.617) (-760.075) -- 0:00:48
171000 -- (-757.845) [-754.440] (-755.757) (-754.928) * [-754.277] (-757.311) (-758.458) (-760.294) -- 0:00:48
171500 -- [-757.176] (-756.034) (-757.412) (-755.846) * (-755.825) (-756.712) [-754.792] (-757.669) -- 0:00:48
172000 -- (-761.813) [-753.885] (-754.547) (-755.065) * (-754.787) (-755.809) [-755.509] (-758.675) -- 0:00:48
172500 -- (-755.134) (-755.699) (-756.395) [-754.664] * (-756.825) (-757.930) (-755.109) [-756.804] -- 0:00:47
173000 -- (-756.008) (-754.069) [-756.461] (-757.367) * [-756.512] (-755.891) (-756.774) (-754.896) -- 0:00:47
173500 -- (-758.775) (-755.343) (-760.678) [-756.146] * (-757.104) [-756.311] (-756.691) (-756.712) -- 0:00:47
174000 -- (-758.939) (-755.811) [-756.930] (-757.348) * (-755.205) [-755.079] (-755.239) (-757.160) -- 0:00:47
174500 -- (-755.252) (-754.523) (-755.055) [-756.598] * [-755.805] (-755.197) (-756.161) (-758.783) -- 0:00:47
175000 -- (-754.961) (-754.987) [-756.001] (-754.523) * (-758.728) [-755.289] (-756.210) (-754.537) -- 0:00:47
Average standard deviation of split frequencies: 0.019954
175500 -- (-757.218) (-756.991) [-754.156] (-753.844) * (-758.926) (-755.317) (-758.970) [-754.998] -- 0:00:46
176000 -- [-754.854] (-756.252) (-753.956) (-756.911) * (-757.046) (-755.408) (-756.248) [-754.733] -- 0:00:46
176500 -- (-755.628) (-754.356) (-755.801) [-754.575] * (-757.303) [-756.974] (-761.087) (-756.801) -- 0:00:46
177000 -- (-759.180) [-754.285] (-756.396) (-755.649) * (-756.448) [-754.233] (-754.397) (-759.338) -- 0:00:46
177500 -- (-759.250) [-758.931] (-758.874) (-754.837) * (-757.833) [-753.852] (-754.345) (-755.798) -- 0:00:46
178000 -- [-754.470] (-760.514) (-754.667) (-755.204) * [-755.451] (-755.379) (-753.841) (-758.569) -- 0:00:46
178500 -- (-756.664) (-762.081) (-756.083) [-757.498] * (-761.152) (-755.272) [-754.841] (-757.772) -- 0:00:46
179000 -- (-757.362) [-760.983] (-757.778) (-757.229) * (-756.452) (-757.424) (-755.201) [-757.035] -- 0:00:45
179500 -- (-759.414) (-758.880) [-758.391] (-756.097) * (-758.785) [-754.991] (-754.777) (-757.352) -- 0:00:45
180000 -- (-755.463) (-754.721) [-758.682] (-763.160) * (-759.041) [-762.167] (-759.457) (-755.682) -- 0:00:50
Average standard deviation of split frequencies: 0.018526
180500 -- (-755.878) (-755.926) [-760.084] (-758.050) * (-759.621) (-754.396) (-757.793) [-755.016] -- 0:00:49
181000 -- (-759.652) (-755.661) [-755.001] (-755.535) * (-765.512) (-756.726) [-755.069] (-754.597) -- 0:00:49
181500 -- (-762.479) [-757.506] (-756.314) (-757.111) * [-758.444] (-756.303) (-755.068) (-755.774) -- 0:00:49
182000 -- (-758.175) [-754.739] (-755.669) (-754.521) * (-755.321) [-757.324] (-755.223) (-756.528) -- 0:00:49
182500 -- [-756.833] (-755.269) (-757.921) (-756.141) * (-755.861) (-759.203) (-754.701) [-754.083] -- 0:00:49
183000 -- (-758.357) (-755.072) (-755.920) [-756.469] * (-755.830) (-755.577) [-756.483] (-758.881) -- 0:00:49
183500 -- (-769.971) (-753.870) [-758.037] (-755.371) * (-755.612) (-758.998) [-755.755] (-757.340) -- 0:00:48
184000 -- (-760.577) (-757.233) [-757.268] (-756.976) * (-754.758) (-755.777) (-754.770) [-756.584] -- 0:00:48
184500 -- (-760.346) (-755.138) (-755.187) [-757.385] * (-758.017) (-760.563) (-756.944) [-755.614] -- 0:00:48
185000 -- (-756.714) [-756.122] (-756.987) (-757.421) * (-757.513) (-755.661) (-756.622) [-756.659] -- 0:00:48
Average standard deviation of split frequencies: 0.016854
185500 -- (-754.092) (-754.780) [-755.813] (-756.565) * (-762.074) (-756.100) (-757.351) [-755.072] -- 0:00:48
186000 -- [-755.387] (-757.936) (-756.116) (-755.917) * (-757.118) (-754.596) (-756.749) [-755.703] -- 0:00:48
186500 -- (-756.746) (-755.161) [-755.150] (-756.316) * (-756.018) [-755.719] (-754.902) (-756.161) -- 0:00:47
187000 -- (-754.818) (-756.379) (-755.968) [-755.194] * (-758.111) [-759.236] (-758.121) (-757.508) -- 0:00:47
187500 -- (-753.987) (-754.635) (-754.059) [-757.345] * [-760.247] (-755.634) (-754.999) (-755.255) -- 0:00:47
188000 -- (-754.431) [-755.583] (-754.644) (-756.686) * (-755.940) (-753.734) (-755.538) [-754.838] -- 0:00:47
188500 -- (-754.272) (-757.580) (-759.000) [-755.259] * (-755.149) [-754.064] (-753.884) (-754.088) -- 0:00:47
189000 -- (-755.169) [-756.401] (-757.364) (-756.059) * (-757.060) [-754.420] (-753.944) (-754.962) -- 0:00:47
189500 -- (-760.733) [-755.819] (-754.852) (-754.823) * (-754.594) (-755.945) [-754.576] (-754.637) -- 0:00:47
190000 -- (-759.605) (-755.735) (-756.182) [-753.841] * (-757.077) (-754.869) [-754.535] (-754.086) -- 0:00:46
Average standard deviation of split frequencies: 0.016318
190500 -- (-755.945) [-754.736] (-755.696) (-758.921) * (-756.526) [-758.769] (-754.677) (-754.794) -- 0:00:46
191000 -- (-760.331) [-755.384] (-757.729) (-760.471) * (-758.245) (-755.521) [-756.044] (-757.548) -- 0:00:46
191500 -- (-757.741) (-755.154) (-760.216) [-756.488] * (-754.910) (-755.475) (-761.644) [-757.752] -- 0:00:46
192000 -- (-755.964) [-756.748] (-757.860) (-755.547) * [-760.374] (-757.867) (-757.051) (-759.289) -- 0:00:46
192500 -- (-756.857) [-757.951] (-759.370) (-757.514) * [-755.208] (-757.271) (-755.149) (-755.579) -- 0:00:46
193000 -- (-757.846) (-754.745) [-756.156] (-760.824) * (-754.851) (-758.868) [-755.120] (-755.705) -- 0:00:45
193500 -- (-758.958) [-755.464] (-755.065) (-757.910) * [-756.004] (-757.864) (-754.533) (-757.406) -- 0:00:45
194000 -- (-756.320) (-756.118) [-755.988] (-757.284) * (-755.244) [-755.904] (-754.652) (-756.850) -- 0:00:45
194500 -- (-756.316) [-755.873] (-757.552) (-755.339) * (-757.192) (-758.592) [-755.583] (-758.305) -- 0:00:45
195000 -- (-755.727) (-756.138) [-758.181] (-755.971) * [-754.525] (-761.959) (-758.261) (-757.176) -- 0:00:45
Average standard deviation of split frequencies: 0.016836
195500 -- (-764.579) [-757.087] (-763.454) (-755.329) * [-756.161] (-756.623) (-755.090) (-757.193) -- 0:00:45
196000 -- (-755.129) (-756.639) (-756.328) [-754.587] * (-756.578) [-754.519] (-755.418) (-756.740) -- 0:00:49
196500 -- (-757.747) (-756.525) [-755.132] (-757.061) * (-754.358) (-756.578) (-755.912) [-755.991] -- 0:00:49
197000 -- (-760.230) (-755.986) [-757.990] (-757.718) * (-755.826) (-755.402) [-754.327] (-756.742) -- 0:00:48
197500 -- (-755.799) [-756.618] (-755.661) (-758.952) * (-755.242) (-754.688) [-755.200] (-753.667) -- 0:00:48
198000 -- (-756.018) (-754.819) (-754.932) [-755.625] * (-755.301) (-754.665) [-755.208] (-754.048) -- 0:00:48
198500 -- (-757.986) (-754.630) (-753.728) [-755.323] * (-756.410) [-755.605] (-754.935) (-754.827) -- 0:00:48
199000 -- (-754.864) (-755.820) [-756.397] (-754.997) * (-755.391) (-755.385) (-755.800) [-753.585] -- 0:00:48
199500 -- (-755.741) [-754.817] (-755.498) (-755.426) * (-755.720) (-755.721) [-755.714] (-753.929) -- 0:00:48
200000 -- (-757.201) (-755.633) (-754.859) [-755.513] * (-758.900) (-755.110) (-756.867) [-755.465] -- 0:00:48
Average standard deviation of split frequencies: 0.017063
200500 -- (-756.570) (-755.309) [-754.145] (-757.628) * (-759.566) (-755.239) [-758.213] (-755.925) -- 0:00:47
201000 -- (-756.209) [-754.437] (-754.235) (-758.667) * (-757.338) (-758.046) (-756.652) [-754.910] -- 0:00:47
201500 -- (-756.418) [-756.097] (-756.282) (-756.941) * (-755.526) (-754.670) (-756.432) [-755.205] -- 0:00:47
202000 -- (-755.870) (-761.402) (-758.606) [-759.354] * [-756.455] (-754.031) (-756.276) (-757.051) -- 0:00:47
202500 -- (-754.014) (-761.956) (-755.013) [-754.797] * (-757.616) [-755.270] (-754.173) (-756.532) -- 0:00:47
203000 -- (-755.559) (-760.515) [-755.575] (-755.759) * (-758.433) [-759.019] (-754.717) (-754.722) -- 0:00:47
203500 -- (-758.026) [-756.148] (-757.527) (-755.996) * (-757.232) (-755.692) (-755.669) [-755.471] -- 0:00:46
204000 -- (-758.381) (-754.056) (-755.175) [-754.257] * [-755.062] (-754.896) (-754.815) (-754.436) -- 0:00:46
204500 -- [-758.003] (-754.115) (-754.422) (-754.858) * (-757.023) (-755.245) (-755.818) [-756.335] -- 0:00:46
205000 -- (-757.307) (-756.370) (-755.586) [-755.301] * (-755.485) [-756.551] (-754.572) (-755.334) -- 0:00:46
Average standard deviation of split frequencies: 0.017506
205500 -- (-760.646) (-755.428) (-755.195) [-755.587] * (-758.030) [-759.926] (-754.464) (-756.175) -- 0:00:46
206000 -- (-755.767) (-755.549) [-758.805] (-757.769) * [-757.520] (-763.495) (-754.722) (-762.542) -- 0:00:46
206500 -- [-755.170] (-758.681) (-757.292) (-754.833) * (-757.907) (-758.657) [-755.839] (-761.204) -- 0:00:46
207000 -- (-754.428) (-753.690) (-754.834) [-754.414] * [-755.765] (-756.282) (-757.185) (-754.420) -- 0:00:45
207500 -- (-756.719) (-755.996) (-756.448) [-756.258] * (-756.831) (-757.702) (-754.563) [-757.692] -- 0:00:45
208000 -- [-759.479] (-754.801) (-754.759) (-756.229) * (-754.488) (-758.007) (-757.303) [-761.755] -- 0:00:45
208500 -- (-758.309) [-755.398] (-755.450) (-756.719) * [-756.865] (-758.161) (-756.735) (-755.203) -- 0:00:45
209000 -- [-756.036] (-757.479) (-756.542) (-754.538) * [-754.723] (-754.248) (-755.215) (-758.263) -- 0:00:45
209500 -- (-756.756) (-754.722) [-755.589] (-755.515) * [-755.631] (-755.093) (-756.649) (-758.313) -- 0:00:45
210000 -- (-755.151) (-756.439) [-754.708] (-755.743) * (-755.706) [-756.897] (-757.543) (-758.397) -- 0:00:45
Average standard deviation of split frequencies: 0.017006
210500 -- (-753.929) [-755.991] (-757.673) (-762.939) * (-756.547) (-756.892) (-757.491) [-758.141] -- 0:00:45
211000 -- (-759.091) (-755.407) [-757.756] (-763.094) * (-761.065) (-758.844) (-754.928) [-756.724] -- 0:00:44
211500 -- (-755.700) [-755.307] (-756.045) (-756.897) * (-757.550) [-757.621] (-760.313) (-757.258) -- 0:00:44
212000 -- [-754.231] (-759.013) (-757.488) (-755.166) * (-757.320) (-756.184) [-757.114] (-757.057) -- 0:00:44
212500 -- (-754.698) (-755.769) (-755.252) [-755.118] * (-756.086) [-755.345] (-755.919) (-755.762) -- 0:00:44
213000 -- (-755.417) (-757.379) [-754.234] (-758.517) * (-758.444) (-756.592) [-754.870] (-756.165) -- 0:00:48
213500 -- [-755.625] (-758.206) (-754.970) (-765.928) * (-755.019) (-755.759) (-756.469) [-757.810] -- 0:00:47
214000 -- [-754.717] (-758.529) (-755.859) (-754.125) * (-754.135) [-756.065] (-754.502) (-757.880) -- 0:00:47
214500 -- (-756.127) (-758.713) (-758.236) [-755.740] * [-757.893] (-755.348) (-754.938) (-753.838) -- 0:00:47
215000 -- (-754.401) [-759.451] (-756.932) (-754.329) * (-756.397) [-754.641] (-755.858) (-756.267) -- 0:00:47
Average standard deviation of split frequencies: 0.016770
215500 -- (-753.913) (-755.029) (-755.230) [-754.085] * (-757.023) (-756.986) [-755.584] (-759.058) -- 0:00:47
216000 -- (-758.164) [-754.577] (-755.712) (-755.702) * (-757.730) (-756.557) [-754.325] (-759.490) -- 0:00:47
216500 -- (-759.164) (-754.884) (-755.509) [-756.658] * (-754.582) (-755.973) (-758.251) [-756.104] -- 0:00:47
217000 -- [-755.885] (-757.920) (-755.833) (-756.975) * [-754.873] (-756.292) (-762.583) (-755.086) -- 0:00:46
217500 -- (-757.054) [-755.711] (-754.283) (-755.536) * (-755.765) [-755.011] (-760.611) (-754.617) -- 0:00:46
218000 -- (-758.662) [-757.122] (-757.241) (-755.017) * (-755.948) (-754.734) (-756.075) [-754.205] -- 0:00:46
218500 -- (-756.944) [-757.037] (-755.237) (-755.274) * (-759.633) [-754.817] (-755.444) (-756.485) -- 0:00:46
219000 -- [-755.027] (-758.701) (-755.997) (-756.039) * (-755.178) [-755.350] (-756.210) (-755.371) -- 0:00:46
219500 -- [-755.232] (-756.998) (-757.039) (-754.774) * (-755.792) (-754.608) [-757.904] (-755.860) -- 0:00:46
220000 -- (-754.823) (-755.321) [-761.535] (-760.599) * (-757.497) (-753.922) (-754.216) [-754.988] -- 0:00:46
Average standard deviation of split frequencies: 0.015966
220500 -- (-756.087) (-756.732) [-757.486] (-761.318) * (-756.213) (-754.705) (-754.207) [-756.386] -- 0:00:45
221000 -- (-755.938) [-756.057] (-756.765) (-756.203) * (-759.534) (-754.915) [-754.489] (-755.342) -- 0:00:45
221500 -- [-754.575] (-754.329) (-754.965) (-754.826) * [-756.271] (-756.061) (-756.085) (-755.931) -- 0:00:45
222000 -- (-755.307) (-757.159) [-754.620] (-758.715) * (-756.445) (-757.035) [-754.782] (-755.792) -- 0:00:45
222500 -- (-754.379) (-758.685) [-754.552] (-757.483) * (-761.206) [-754.813] (-755.046) (-755.151) -- 0:00:45
223000 -- (-756.642) (-756.366) [-754.227] (-755.336) * (-758.036) (-756.722) [-754.915] (-757.371) -- 0:00:45
223500 -- (-757.416) [-755.032] (-754.581) (-755.571) * (-757.444) (-756.003) (-755.407) [-760.432] -- 0:00:45
224000 -- (-754.518) (-757.431) [-755.111] (-756.538) * [-754.950] (-756.724) (-757.120) (-762.933) -- 0:00:45
224500 -- (-755.289) [-757.940] (-757.060) (-755.739) * [-754.743] (-757.273) (-756.864) (-759.401) -- 0:00:44
225000 -- (-755.236) (-757.892) [-755.652] (-759.804) * (-755.113) (-756.091) (-757.339) [-755.401] -- 0:00:44
Average standard deviation of split frequencies: 0.014162
225500 -- (-755.476) (-760.011) (-755.594) [-756.767] * (-756.382) (-754.535) (-755.531) [-760.629] -- 0:00:44
226000 -- (-756.575) (-754.828) [-754.883] (-759.285) * (-754.449) (-754.401) (-756.998) [-753.867] -- 0:00:44
226500 -- (-755.932) (-757.074) (-754.361) [-755.340] * [-756.059] (-754.084) (-758.203) (-755.630) -- 0:00:44
227000 -- (-756.135) (-757.428) [-756.642] (-757.694) * (-755.268) [-755.845] (-754.937) (-756.413) -- 0:00:44
227500 -- (-756.665) (-759.865) (-754.731) [-755.087] * (-756.364) [-755.301] (-756.272) (-755.204) -- 0:00:44
228000 -- (-759.183) (-759.026) (-755.753) [-755.321] * (-755.740) [-756.642] (-756.354) (-758.060) -- 0:00:44
228500 -- (-755.718) (-756.949) [-754.714] (-755.188) * (-755.493) [-756.138] (-755.328) (-757.860) -- 0:00:43
229000 -- (-754.482) [-754.175] (-755.114) (-754.994) * (-760.631) [-754.519] (-754.629) (-757.750) -- 0:00:43
229500 -- (-758.348) [-755.234] (-755.631) (-761.479) * (-755.508) (-756.309) (-755.128) [-755.540] -- 0:00:47
230000 -- [-754.561] (-758.862) (-755.514) (-758.818) * (-760.271) [-757.638] (-757.817) (-757.301) -- 0:00:46
Average standard deviation of split frequencies: 0.013983
230500 -- [-754.319] (-755.121) (-757.167) (-754.335) * (-757.980) [-760.057] (-758.336) (-755.456) -- 0:00:46
231000 -- (-754.183) (-756.833) (-758.081) [-755.205] * (-758.007) (-755.381) [-756.473] (-756.205) -- 0:00:46
231500 -- (-756.366) [-754.897] (-756.807) (-754.768) * [-757.875] (-756.962) (-754.659) (-757.710) -- 0:00:46
232000 -- [-758.677] (-754.287) (-757.042) (-755.471) * (-755.696) [-755.831] (-757.210) (-755.012) -- 0:00:46
232500 -- (-755.870) [-754.058] (-755.976) (-756.615) * (-754.452) [-756.018] (-755.533) (-755.376) -- 0:00:46
233000 -- (-755.251) [-756.545] (-754.996) (-758.925) * (-756.428) (-757.139) [-755.506] (-757.458) -- 0:00:46
233500 -- (-757.673) (-756.640) (-757.133) [-756.733] * (-755.648) (-760.670) [-755.751] (-756.272) -- 0:00:45
234000 -- (-757.502) [-758.528] (-755.835) (-754.090) * [-754.391] (-757.631) (-754.714) (-754.992) -- 0:00:45
234500 -- [-755.296] (-755.660) (-756.133) (-753.924) * (-756.069) [-754.591] (-754.053) (-760.197) -- 0:00:45
235000 -- (-759.867) (-756.286) (-756.165) [-756.243] * (-757.090) [-754.962] (-756.913) (-757.941) -- 0:00:45
Average standard deviation of split frequencies: 0.014823
235500 -- (-759.077) (-754.298) (-755.593) [-760.424] * [-757.829] (-760.507) (-758.403) (-756.383) -- 0:00:45
236000 -- (-757.321) (-755.726) (-754.975) [-755.604] * (-756.081) (-757.731) (-757.170) [-755.389] -- 0:00:45
236500 -- (-754.329) [-757.219] (-756.396) (-757.323) * (-755.467) (-756.024) [-756.059] (-756.610) -- 0:00:45
237000 -- [-753.935] (-755.258) (-755.509) (-754.993) * [-756.354] (-754.214) (-757.579) (-755.328) -- 0:00:45
237500 -- (-756.858) [-753.686] (-756.902) (-758.605) * [-755.423] (-754.900) (-757.898) (-756.823) -- 0:00:44
238000 -- [-755.999] (-754.645) (-761.782) (-757.866) * (-756.374) [-754.042] (-756.717) (-754.890) -- 0:00:44
238500 -- (-755.167) (-757.645) (-755.943) [-757.272] * (-756.119) [-757.887] (-757.017) (-755.717) -- 0:00:44
239000 -- (-760.264) [-756.374] (-759.136) (-756.487) * (-762.119) [-756.772] (-767.431) (-758.955) -- 0:00:44
239500 -- (-757.503) (-757.140) (-755.942) [-757.218] * (-755.658) (-757.595) [-755.022] (-755.894) -- 0:00:44
240000 -- (-756.001) [-754.513] (-755.326) (-756.117) * [-756.129] (-756.355) (-754.556) (-759.686) -- 0:00:44
Average standard deviation of split frequencies: 0.013276
240500 -- (-755.183) (-754.905) (-755.730) [-757.033] * [-758.024] (-756.183) (-756.805) (-755.245) -- 0:00:44
241000 -- [-755.391] (-756.728) (-757.362) (-758.356) * (-755.672) [-758.880] (-763.975) (-754.580) -- 0:00:44
241500 -- (-755.038) (-755.229) (-756.805) [-756.041] * (-755.901) [-757.470] (-754.182) (-754.438) -- 0:00:43
242000 -- (-755.036) [-756.856] (-755.044) (-755.979) * (-754.418) (-756.859) [-754.581] (-758.808) -- 0:00:43
242500 -- (-759.094) (-754.271) [-756.743] (-754.737) * (-755.392) (-754.226) [-754.913] (-757.510) -- 0:00:43
243000 -- [-759.697] (-758.234) (-756.866) (-759.179) * [-754.462] (-757.529) (-755.139) (-754.654) -- 0:00:43
243500 -- (-755.434) [-759.611] (-754.839) (-761.327) * [-755.541] (-759.973) (-756.335) (-757.630) -- 0:00:43
244000 -- (-755.222) (-754.835) (-757.664) [-755.601] * [-757.098] (-757.799) (-754.584) (-758.017) -- 0:00:43
244500 -- (-754.139) (-755.020) [-754.453] (-755.756) * (-757.910) (-756.594) [-754.675] (-756.595) -- 0:00:43
245000 -- (-754.188) [-756.496] (-757.496) (-757.573) * (-755.770) [-757.248] (-754.743) (-757.353) -- 0:00:46
Average standard deviation of split frequencies: 0.014523
245500 -- (-758.199) (-758.590) (-755.755) [-755.563] * (-755.770) (-759.900) (-757.933) [-757.421] -- 0:00:46
246000 -- (-756.852) (-759.957) [-755.756] (-755.187) * (-755.335) (-755.369) [-757.585] (-755.222) -- 0:00:45
246500 -- (-756.542) (-761.935) (-757.477) [-756.051] * (-755.446) (-754.805) (-755.859) [-756.568] -- 0:00:45
247000 -- (-759.352) (-758.930) (-759.305) [-756.891] * [-755.986] (-754.040) (-757.977) (-755.749) -- 0:00:45
247500 -- [-757.086] (-762.474) (-756.790) (-759.419) * (-754.988) [-754.099] (-755.821) (-755.669) -- 0:00:45
248000 -- (-755.442) [-754.277] (-757.986) (-754.841) * [-755.012] (-755.268) (-755.212) (-755.852) -- 0:00:45
248500 -- (-759.844) (-755.616) (-755.114) [-756.350] * (-753.737) (-754.520) (-755.055) [-756.516] -- 0:00:45
249000 -- (-755.708) (-756.367) [-755.995] (-755.133) * (-754.835) (-755.821) (-754.411) [-754.037] -- 0:00:45
249500 -- (-754.867) (-756.110) (-755.870) [-756.799] * (-756.446) (-758.985) (-756.599) [-754.084] -- 0:00:45
250000 -- (-755.062) [-754.923] (-754.846) (-755.867) * (-756.434) (-757.058) (-754.655) [-756.099] -- 0:00:45
Average standard deviation of split frequencies: 0.014253
250500 -- (-755.211) (-755.978) (-755.931) [-754.626] * (-753.799) (-754.320) [-755.145] (-758.208) -- 0:00:44
251000 -- (-755.453) [-755.201] (-753.853) (-755.993) * (-755.780) (-757.002) (-754.692) [-755.007] -- 0:00:44
251500 -- (-755.634) (-755.370) [-756.191] (-756.069) * (-755.711) (-755.707) [-754.184] (-755.678) -- 0:00:44
252000 -- (-755.662) (-755.493) [-755.173] (-755.897) * [-756.277] (-755.655) (-757.540) (-756.673) -- 0:00:44
252500 -- (-758.252) (-756.436) [-756.550] (-755.592) * (-755.122) (-754.587) [-755.705] (-757.260) -- 0:00:44
253000 -- (-758.578) (-760.720) (-761.079) [-757.920] * (-758.581) (-754.309) (-754.642) [-758.424] -- 0:00:44
253500 -- [-756.611] (-756.547) (-758.448) (-755.451) * (-757.100) (-754.397) (-754.303) [-756.332] -- 0:00:44
254000 -- (-757.491) [-754.573] (-754.596) (-755.876) * (-757.531) (-756.680) (-755.665) [-758.563] -- 0:00:44
254500 -- (-754.923) (-755.658) (-754.989) [-757.113] * [-755.308] (-756.319) (-756.289) (-755.857) -- 0:00:43
255000 -- (-754.998) (-759.484) (-754.232) [-754.730] * (-754.025) (-756.145) (-755.706) [-757.132] -- 0:00:43
Average standard deviation of split frequencies: 0.013859
255500 -- (-757.471) (-759.152) (-754.042) [-757.347] * (-755.947) [-754.758] (-760.046) (-756.571) -- 0:00:43
256000 -- (-757.821) [-757.659] (-756.624) (-757.106) * (-755.721) (-755.212) [-755.688] (-756.341) -- 0:00:43
256500 -- (-761.229) [-758.124] (-759.387) (-756.996) * (-755.669) (-759.264) (-756.538) [-757.911] -- 0:00:43
257000 -- (-757.428) [-755.547] (-757.227) (-758.331) * [-755.562] (-760.285) (-756.093) (-755.389) -- 0:00:43
257500 -- (-757.639) [-756.316] (-756.637) (-756.670) * (-754.644) (-760.657) [-754.521] (-758.162) -- 0:00:43
258000 -- (-764.955) [-755.903] (-755.398) (-758.679) * [-754.296] (-759.767) (-756.264) (-758.459) -- 0:00:43
258500 -- (-760.007) (-754.932) (-756.076) [-755.486] * (-755.599) [-755.567] (-759.180) (-757.525) -- 0:00:43
259000 -- (-764.120) [-755.381] (-756.457) (-754.586) * [-754.911] (-754.546) (-756.430) (-756.360) -- 0:00:42
259500 -- (-760.957) (-754.591) (-754.916) [-753.902] * [-754.574] (-756.504) (-756.161) (-756.486) -- 0:00:42
260000 -- (-756.475) (-754.797) (-758.701) [-755.104] * (-755.976) [-756.431] (-753.911) (-755.971) -- 0:00:42
Average standard deviation of split frequencies: 0.013421
260500 -- (-754.318) (-760.950) [-756.742] (-757.277) * (-760.556) (-757.017) [-753.660] (-757.978) -- 0:00:42
261000 -- [-754.173] (-755.940) (-755.582) (-757.655) * (-762.363) (-758.961) (-753.752) [-754.610] -- 0:00:42
261500 -- (-754.953) (-757.139) (-754.785) [-754.626] * (-757.228) (-761.516) (-754.306) [-754.010] -- 0:00:45
262000 -- [-762.511] (-755.558) (-757.072) (-762.872) * (-755.940) [-762.563] (-756.082) (-754.767) -- 0:00:45
262500 -- (-759.281) (-755.268) [-759.791] (-757.099) * [-754.520] (-757.655) (-757.956) (-755.607) -- 0:00:44
263000 -- (-756.343) (-756.949) (-755.429) [-755.511] * (-755.570) [-755.001] (-756.232) (-759.028) -- 0:00:44
263500 -- (-757.396) (-758.234) (-755.589) [-756.298] * (-755.542) (-755.851) (-760.513) [-755.653] -- 0:00:44
264000 -- (-754.260) [-758.006] (-755.734) (-756.279) * [-757.833] (-755.472) (-755.166) (-756.206) -- 0:00:44
264500 -- (-754.184) (-757.112) (-755.522) [-756.806] * (-757.897) (-757.158) (-754.971) [-755.195] -- 0:00:44
265000 -- (-757.442) (-756.805) [-757.658] (-758.347) * (-757.788) [-756.681] (-755.093) (-755.400) -- 0:00:44
Average standard deviation of split frequencies: 0.015390
265500 -- (-756.449) (-756.599) [-757.240] (-754.943) * (-756.353) (-754.099) (-760.507) [-755.380] -- 0:00:44
266000 -- (-757.106) (-756.093) [-754.359] (-757.627) * (-755.006) (-754.472) (-758.262) [-755.357] -- 0:00:44
266500 -- (-761.383) (-757.410) (-755.525) [-755.162] * [-754.329] (-759.975) (-757.725) (-755.510) -- 0:00:44
267000 -- (-760.360) (-755.593) (-755.445) [-754.905] * (-755.928) (-755.403) [-760.327] (-757.326) -- 0:00:43
267500 -- (-758.205) (-753.698) [-755.514] (-755.319) * (-756.390) (-755.871) [-760.595] (-756.697) -- 0:00:43
268000 -- (-754.358) [-754.446] (-757.259) (-755.117) * (-754.734) [-755.286] (-754.970) (-756.641) -- 0:00:43
268500 -- (-754.748) (-756.311) [-757.683] (-756.862) * (-758.346) (-759.647) [-754.251] (-757.724) -- 0:00:43
269000 -- (-756.277) (-754.517) [-761.402] (-755.307) * [-756.967] (-758.148) (-755.785) (-759.317) -- 0:00:43
269500 -- (-754.472) [-754.851] (-755.427) (-756.130) * (-756.651) [-756.401] (-754.861) (-756.917) -- 0:00:43
270000 -- (-757.082) (-755.600) [-755.207] (-754.390) * (-758.488) (-755.006) (-756.699) [-756.188] -- 0:00:43
Average standard deviation of split frequencies: 0.015583
270500 -- (-756.499) (-756.713) (-756.494) [-754.582] * (-757.264) (-757.136) (-757.800) [-754.514] -- 0:00:43
271000 -- (-758.095) (-755.858) (-759.344) [-757.776] * (-758.766) [-754.257] (-758.705) (-754.762) -- 0:00:43
271500 -- (-758.405) [-758.122] (-757.993) (-754.755) * (-757.224) [-756.610] (-758.862) (-755.533) -- 0:00:42
272000 -- (-755.139) (-757.250) (-761.747) [-754.874] * (-755.651) (-754.730) (-757.816) [-755.825] -- 0:00:42
272500 -- (-754.525) (-754.358) [-754.717] (-758.648) * (-755.686) (-754.371) [-757.183] (-758.129) -- 0:00:42
273000 -- [-754.873] (-760.238) (-755.937) (-754.461) * (-755.673) (-758.381) [-759.927] (-759.397) -- 0:00:42
273500 -- (-756.319) (-756.782) [-756.495] (-757.429) * (-758.019) [-754.334] (-756.923) (-758.081) -- 0:00:42
274000 -- (-755.594) (-758.848) [-756.574] (-754.876) * (-756.415) [-755.963] (-761.648) (-755.632) -- 0:00:42
274500 -- (-755.629) [-754.915] (-759.082) (-755.953) * (-755.826) [-757.361] (-756.612) (-757.339) -- 0:00:42
275000 -- (-758.333) (-754.398) [-754.641] (-759.637) * (-754.764) (-758.426) (-755.920) [-754.831] -- 0:00:42
Average standard deviation of split frequencies: 0.016181
275500 -- (-758.875) (-754.278) [-756.526] (-757.746) * (-758.417) [-754.852] (-758.111) (-754.558) -- 0:00:42
276000 -- (-758.861) [-753.783] (-756.459) (-753.965) * (-754.272) [-755.486] (-757.853) (-755.850) -- 0:00:41
276500 -- (-756.300) (-760.381) (-761.603) [-754.507] * (-755.630) (-754.652) (-754.696) [-755.742] -- 0:00:41
277000 -- (-753.813) (-758.431) (-760.304) [-755.833] * (-755.058) (-755.574) [-757.431] (-755.525) -- 0:00:41
277500 -- (-753.699) (-754.602) [-755.828] (-754.718) * (-758.858) (-756.529) (-756.448) [-754.094] -- 0:00:41
278000 -- (-759.328) (-754.426) (-756.488) [-755.838] * [-756.140] (-757.270) (-757.131) (-757.002) -- 0:00:41
278500 -- (-754.562) [-755.828] (-757.214) (-757.466) * (-756.915) [-755.086] (-758.930) (-757.553) -- 0:00:44
279000 -- (-754.976) [-754.220] (-754.824) (-754.674) * [-755.560] (-757.381) (-756.891) (-754.404) -- 0:00:43
279500 -- (-757.793) (-755.754) (-754.908) [-755.648] * (-754.014) (-761.878) [-755.971] (-755.739) -- 0:00:43
280000 -- (-754.543) (-754.257) (-755.772) [-755.517] * [-754.014] (-757.454) (-756.153) (-756.005) -- 0:00:43
Average standard deviation of split frequencies: 0.015912
280500 -- [-754.292] (-759.169) (-756.926) (-756.799) * [-755.817] (-755.014) (-762.493) (-758.831) -- 0:00:43
281000 -- (-758.364) [-756.052] (-754.865) (-757.963) * (-756.601) (-756.187) (-756.002) [-753.647] -- 0:00:43
281500 -- [-756.947] (-757.285) (-754.594) (-760.523) * (-755.888) (-760.122) [-753.963] (-753.669) -- 0:00:43
282000 -- (-756.380) [-755.638] (-756.070) (-754.112) * (-755.450) (-758.996) [-756.033] (-754.128) -- 0:00:43
282500 -- (-758.603) (-755.873) [-758.084] (-756.310) * (-759.787) (-757.209) (-758.080) [-754.351] -- 0:00:43
283000 -- (-761.011) [-755.178] (-755.129) (-756.393) * [-754.411] (-756.307) (-755.026) (-755.636) -- 0:00:43
283500 -- [-754.370] (-756.979) (-756.399) (-754.509) * (-754.084) (-755.907) [-754.850] (-755.308) -- 0:00:42
284000 -- (-755.736) (-757.518) [-755.061] (-755.872) * (-755.159) (-755.412) [-754.514] (-757.381) -- 0:00:42
284500 -- (-761.897) (-758.019) (-754.056) [-756.795] * (-755.277) (-756.628) [-760.063] (-760.599) -- 0:00:42
285000 -- (-754.423) [-757.719] (-754.490) (-756.772) * [-757.585] (-753.893) (-756.194) (-757.173) -- 0:00:42
Average standard deviation of split frequencies: 0.015181
285500 -- (-757.048) (-755.628) (-754.874) [-755.253] * (-756.431) (-757.974) [-755.186] (-756.052) -- 0:00:42
286000 -- (-754.436) (-757.100) [-754.821] (-760.214) * (-756.865) (-753.942) [-754.285] (-755.087) -- 0:00:42
286500 -- (-758.657) (-757.568) [-754.843] (-755.211) * (-759.856) (-754.930) (-754.514) [-753.873] -- 0:00:42
287000 -- (-756.944) (-755.016) (-755.929) [-754.550] * (-759.421) [-755.326] (-754.913) (-760.374) -- 0:00:42
287500 -- [-755.788] (-756.905) (-759.063) (-758.864) * (-757.194) [-756.118] (-755.069) (-759.661) -- 0:00:42
288000 -- (-758.069) (-757.308) [-759.216] (-757.897) * (-757.442) [-755.237] (-754.685) (-755.882) -- 0:00:42
288500 -- (-757.574) [-753.613] (-756.863) (-755.345) * (-757.395) (-756.899) (-757.073) [-757.015] -- 0:00:41
289000 -- (-756.066) [-754.963] (-757.203) (-754.578) * [-754.871] (-756.013) (-754.366) (-755.089) -- 0:00:41
289500 -- [-760.666] (-756.880) (-757.956) (-756.317) * (-755.403) [-754.301] (-754.534) (-758.742) -- 0:00:41
290000 -- (-757.057) [-755.325] (-755.266) (-757.817) * [-756.201] (-755.059) (-754.732) (-757.219) -- 0:00:41
Average standard deviation of split frequencies: 0.014938
290500 -- (-755.930) (-755.758) [-754.687] (-760.656) * [-755.988] (-756.769) (-757.422) (-757.585) -- 0:00:41
291000 -- (-755.617) [-755.882] (-759.518) (-761.373) * (-759.600) [-755.450] (-754.629) (-758.996) -- 0:00:41
291500 -- [-758.253] (-756.401) (-755.361) (-756.623) * (-754.771) [-757.760] (-757.779) (-756.638) -- 0:00:41
292000 -- (-758.051) (-756.024) [-755.063] (-755.320) * (-753.913) (-757.410) (-755.858) [-755.192] -- 0:00:41
292500 -- (-755.329) (-756.226) [-755.961] (-756.721) * (-758.667) (-755.130) (-755.511) [-754.626] -- 0:00:41
293000 -- (-755.854) [-756.122] (-754.527) (-761.021) * (-754.841) (-757.264) [-756.457] (-754.965) -- 0:00:41
293500 -- (-757.837) (-756.864) (-755.740) [-757.475] * (-755.601) (-755.501) (-756.810) [-756.632] -- 0:00:40
294000 -- [-758.972] (-756.039) (-759.047) (-759.466) * (-755.119) [-762.439] (-757.842) (-756.129) -- 0:00:40
294500 -- (-759.556) (-756.244) [-756.925] (-755.236) * [-757.766] (-758.985) (-755.967) (-758.719) -- 0:00:40
295000 -- (-761.724) (-754.385) (-755.516) [-754.204] * (-755.424) (-757.060) [-755.806] (-757.571) -- 0:00:43
Average standard deviation of split frequencies: 0.015171
295500 -- (-759.674) (-753.907) [-755.861] (-756.827) * (-755.012) [-756.323] (-754.363) (-758.704) -- 0:00:42
296000 -- (-757.164) (-755.307) (-760.793) [-755.510] * (-757.093) (-758.286) (-755.687) [-754.524] -- 0:00:42
296500 -- (-757.019) (-756.880) [-756.221] (-754.297) * (-754.360) [-756.754] (-756.020) (-756.172) -- 0:00:42
297000 -- (-756.731) (-754.515) (-757.042) [-755.171] * (-756.283) (-756.510) [-755.489] (-755.068) -- 0:00:42
297500 -- [-758.101] (-754.464) (-753.996) (-755.649) * (-757.263) (-757.063) (-756.294) [-756.764] -- 0:00:42
298000 -- (-756.012) [-757.202] (-756.011) (-755.621) * (-766.464) [-756.847] (-755.580) (-754.629) -- 0:00:42
298500 -- (-756.956) [-756.533] (-754.941) (-757.651) * (-754.569) (-755.534) [-757.221] (-755.897) -- 0:00:42
299000 -- (-757.990) [-757.179] (-755.764) (-755.259) * (-756.947) (-756.005) (-758.545) [-755.655] -- 0:00:42
299500 -- (-756.583) (-755.798) (-755.258) [-759.825] * (-756.154) (-760.324) (-754.739) [-754.833] -- 0:00:42
300000 -- [-758.891] (-755.326) (-755.889) (-756.550) * (-756.522) (-759.728) [-758.008] (-754.422) -- 0:00:42
Average standard deviation of split frequencies: 0.015761
300500 -- (-757.844) (-756.047) (-758.863) [-754.515] * [-758.351] (-753.601) (-755.281) (-755.135) -- 0:00:41
301000 -- (-758.418) [-755.724] (-758.101) (-757.912) * (-759.593) (-756.185) [-754.608] (-758.959) -- 0:00:41
301500 -- (-760.587) (-754.352) [-753.781] (-754.965) * (-757.858) (-761.316) [-756.037] (-755.388) -- 0:00:41
302000 -- (-756.392) (-755.275) [-755.052] (-756.506) * [-758.000] (-758.451) (-758.104) (-756.214) -- 0:00:41
302500 -- (-754.527) (-755.503) (-755.132) [-756.131] * (-755.077) (-757.694) [-756.657] (-758.282) -- 0:00:41
303000 -- (-756.076) (-757.066) [-755.572] (-756.716) * (-754.299) [-761.700] (-756.229) (-755.294) -- 0:00:41
303500 -- (-756.078) (-757.347) (-757.312) [-756.415] * (-759.099) [-754.290] (-756.301) (-754.523) -- 0:00:41
304000 -- [-756.359] (-755.308) (-759.035) (-758.583) * (-755.465) (-757.682) [-755.055] (-756.072) -- 0:00:41
304500 -- (-754.146) [-756.080] (-757.233) (-757.814) * (-757.293) (-754.576) [-755.498] (-757.718) -- 0:00:41
305000 -- (-754.322) (-756.791) (-755.539) [-757.586] * [-756.304] (-754.542) (-759.198) (-759.831) -- 0:00:41
Average standard deviation of split frequencies: 0.015833
305500 -- (-754.218) [-759.363] (-754.732) (-756.510) * (-755.379) [-755.553] (-754.407) (-758.223) -- 0:00:40
306000 -- [-754.991] (-756.254) (-756.728) (-756.135) * (-756.777) [-754.060] (-754.357) (-756.532) -- 0:00:40
306500 -- [-757.059] (-756.582) (-758.659) (-758.526) * (-755.254) [-756.296] (-754.092) (-759.749) -- 0:00:40
307000 -- [-757.036] (-755.618) (-759.832) (-755.982) * [-756.127] (-759.148) (-755.957) (-757.299) -- 0:00:40
307500 -- [-757.160] (-756.360) (-758.887) (-756.568) * [-754.523] (-755.702) (-757.179) (-755.382) -- 0:00:40
308000 -- (-758.991) [-756.321] (-765.039) (-754.099) * (-756.493) (-759.929) (-756.601) [-757.967] -- 0:00:40
308500 -- (-758.660) (-755.591) (-759.047) [-755.118] * (-757.308) [-757.172] (-756.333) (-756.260) -- 0:00:40
309000 -- (-758.971) [-758.434] (-758.749) (-756.827) * (-755.340) (-754.597) (-757.603) [-757.083] -- 0:00:40
309500 -- (-756.445) (-757.936) (-761.338) [-757.581] * [-756.674] (-755.660) (-757.714) (-756.395) -- 0:00:40
310000 -- [-755.948] (-756.891) (-756.603) (-761.552) * (-755.127) [-757.537] (-755.179) (-755.910) -- 0:00:40
Average standard deviation of split frequencies: 0.015933
310500 -- (-758.149) (-754.462) (-754.361) [-756.364] * [-756.169] (-755.674) (-754.980) (-755.092) -- 0:00:39
311000 -- (-757.987) [-754.466] (-757.275) (-760.480) * [-756.434] (-754.709) (-754.771) (-756.029) -- 0:00:42
311500 -- (-759.126) (-757.850) [-760.384] (-755.299) * (-758.081) [-754.874] (-755.639) (-755.965) -- 0:00:41
312000 -- (-758.218) (-755.151) (-759.696) [-756.925] * (-756.498) (-756.434) (-755.452) [-755.623] -- 0:00:41
312500 -- (-758.023) (-756.547) [-756.880] (-756.430) * (-758.756) (-755.207) [-755.502] (-756.653) -- 0:00:41
313000 -- (-756.548) (-760.351) [-755.977] (-755.978) * (-758.814) (-756.647) [-753.905] (-755.107) -- 0:00:41
313500 -- (-759.319) (-757.615) [-761.802] (-758.198) * (-757.554) [-755.471] (-754.412) (-755.709) -- 0:00:41
314000 -- [-757.971] (-757.592) (-755.093) (-755.639) * [-754.371] (-753.860) (-755.286) (-754.598) -- 0:00:41
314500 -- [-757.971] (-756.994) (-757.103) (-759.007) * [-758.068] (-761.875) (-755.862) (-759.989) -- 0:00:41
315000 -- [-757.958] (-757.610) (-755.330) (-758.464) * [-754.008] (-754.290) (-757.468) (-757.979) -- 0:00:41
Average standard deviation of split frequencies: 0.015232
315500 -- (-754.243) (-758.508) [-754.540] (-755.727) * [-760.249] (-763.642) (-756.405) (-756.232) -- 0:00:41
316000 -- (-754.720) (-755.164) [-755.769] (-761.066) * (-756.211) [-756.053] (-754.720) (-757.402) -- 0:00:41
316500 -- (-755.939) (-754.828) [-754.576] (-756.367) * (-755.965) (-755.792) [-753.784] (-756.883) -- 0:00:41
317000 -- (-756.945) [-754.638] (-753.961) (-760.552) * (-756.885) [-756.926] (-754.781) (-762.943) -- 0:00:40
317500 -- (-757.729) [-757.398] (-754.941) (-755.039) * (-758.093) (-756.150) (-755.818) [-764.048] -- 0:00:40
318000 -- (-755.580) (-758.265) [-754.681] (-755.621) * (-755.980) (-757.700) [-754.949] (-761.134) -- 0:00:40
318500 -- (-756.931) (-757.512) (-755.499) [-757.360] * (-754.758) (-758.020) (-754.130) [-756.020] -- 0:00:40
319000 -- (-756.598) (-753.943) [-753.701] (-755.182) * (-758.884) (-757.789) [-756.575] (-754.475) -- 0:00:40
319500 -- (-754.798) (-755.956) (-756.923) [-758.554] * (-754.901) [-758.077] (-755.935) (-754.964) -- 0:00:40
320000 -- (-758.875) (-755.905) [-758.002] (-758.549) * (-755.290) (-755.208) (-756.278) [-754.754] -- 0:00:40
Average standard deviation of split frequencies: 0.015027
320500 -- [-755.398] (-757.476) (-759.629) (-760.273) * (-755.466) (-755.432) (-754.794) [-754.631] -- 0:00:40
321000 -- (-754.661) (-755.256) [-755.512] (-759.140) * (-756.075) [-754.098] (-756.496) (-758.389) -- 0:00:40
321500 -- [-754.550] (-754.359) (-758.218) (-762.401) * [-755.671] (-754.366) (-755.614) (-756.652) -- 0:00:40
322000 -- (-755.093) [-754.181] (-754.632) (-760.492) * [-755.011] (-755.169) (-755.143) (-760.921) -- 0:00:40
322500 -- (-755.582) (-759.264) [-755.593] (-760.370) * (-756.537) [-757.874] (-762.454) (-758.833) -- 0:00:39
323000 -- [-754.981] (-756.913) (-755.472) (-757.979) * [-757.329] (-754.083) (-758.597) (-757.365) -- 0:00:39
323500 -- [-755.094] (-757.669) (-756.930) (-757.499) * (-757.472) [-755.706] (-755.632) (-756.929) -- 0:00:39
324000 -- (-755.652) (-756.212) [-756.884] (-755.377) * [-754.438] (-757.295) (-759.502) (-755.543) -- 0:00:39
324500 -- [-756.070] (-754.757) (-756.180) (-756.331) * (-757.020) (-753.833) (-756.956) [-757.710] -- 0:00:39
325000 -- (-756.006) (-755.239) [-756.679] (-757.795) * (-755.723) (-755.661) (-754.560) [-756.089] -- 0:00:39
Average standard deviation of split frequencies: 0.015023
325500 -- (-757.513) (-755.192) (-757.877) [-759.268] * (-755.016) (-759.784) [-755.474] (-755.506) -- 0:00:39
326000 -- (-756.587) (-755.202) [-754.900] (-755.991) * [-755.855] (-756.824) (-755.648) (-756.280) -- 0:00:39
326500 -- (-755.987) (-756.533) (-755.820) [-756.202] * (-755.671) [-756.919] (-756.391) (-755.441) -- 0:00:39
327000 -- (-753.803) [-755.990] (-757.113) (-755.931) * (-757.837) (-760.200) [-756.059] (-756.335) -- 0:00:39
327500 -- (-754.540) (-755.307) (-756.052) [-756.091] * (-756.932) (-755.734) [-756.523] (-758.991) -- 0:00:39
328000 -- (-756.560) (-755.697) (-754.180) [-753.744] * [-756.656] (-757.533) (-754.024) (-754.963) -- 0:00:40
328500 -- (-757.378) (-754.705) [-754.233] (-756.736) * (-756.317) (-756.086) (-754.778) [-754.276] -- 0:00:40
329000 -- [-754.460] (-754.784) (-755.209) (-755.099) * (-754.902) [-755.135] (-759.106) (-755.051) -- 0:00:40
329500 -- (-754.477) [-756.411] (-755.788) (-755.542) * [-755.795] (-756.612) (-756.810) (-760.070) -- 0:00:40
330000 -- (-756.158) (-754.982) [-755.627] (-755.672) * (-755.813) (-755.225) (-759.578) [-756.970] -- 0:00:40
Average standard deviation of split frequencies: 0.015207
330500 -- [-756.243] (-758.980) (-755.937) (-756.571) * (-754.301) [-755.017] (-757.084) (-757.540) -- 0:00:40
331000 -- (-756.754) (-758.715) (-760.630) [-755.008] * [-758.973] (-754.576) (-756.338) (-754.779) -- 0:00:40
331500 -- (-756.183) (-755.046) (-757.134) [-758.237] * (-755.776) (-754.455) [-757.156] (-755.900) -- 0:00:40
332000 -- (-756.008) [-754.688] (-758.642) (-756.852) * [-756.784] (-754.552) (-756.515) (-754.723) -- 0:00:40
332500 -- [-759.343] (-755.119) (-755.836) (-763.351) * (-757.732) [-754.443] (-756.225) (-754.136) -- 0:00:40
333000 -- (-755.710) (-755.869) [-755.512] (-756.163) * [-762.460] (-754.604) (-755.322) (-756.481) -- 0:00:40
333500 -- (-755.715) [-756.118] (-756.401) (-757.468) * (-760.594) (-755.686) (-762.192) [-756.631] -- 0:00:39
334000 -- (-755.690) (-755.327) (-755.172) [-760.803] * (-758.374) (-757.230) (-755.888) [-757.062] -- 0:00:39
334500 -- (-756.313) (-756.320) [-755.232] (-758.545) * (-758.309) (-757.487) (-759.563) [-759.868] -- 0:00:39
335000 -- (-755.265) (-754.734) (-757.336) [-757.125] * (-755.130) (-756.993) (-757.346) [-755.725] -- 0:00:39
Average standard deviation of split frequencies: 0.015199
335500 -- (-755.928) [-755.707] (-754.976) (-757.603) * [-754.912] (-759.563) (-759.269) (-757.920) -- 0:00:39
336000 -- (-753.823) [-755.838] (-754.944) (-759.304) * (-755.303) [-755.996] (-756.168) (-756.676) -- 0:00:39
336500 -- [-754.799] (-754.789) (-756.684) (-763.822) * (-755.964) (-756.872) [-756.850] (-755.217) -- 0:00:39
337000 -- (-755.304) (-754.970) [-757.612] (-755.804) * (-758.376) [-755.665] (-756.015) (-755.634) -- 0:00:39
337500 -- (-756.601) (-754.442) (-761.491) [-754.973] * (-757.385) (-756.430) (-759.065) [-755.192] -- 0:00:39
338000 -- (-757.419) [-754.549] (-763.858) (-754.811) * (-755.108) (-758.019) (-758.022) [-755.957] -- 0:00:39
338500 -- (-754.434) (-754.600) (-760.576) [-754.921] * (-756.458) (-759.112) [-757.984] (-755.148) -- 0:00:39
339000 -- (-753.824) [-755.341] (-761.447) (-754.737) * (-759.595) [-757.450] (-755.247) (-754.708) -- 0:00:38
339500 -- (-757.655) (-758.376) (-756.107) [-753.679] * (-756.958) (-754.876) [-755.466] (-755.420) -- 0:00:38
340000 -- (-755.417) (-755.812) [-754.017] (-757.154) * (-754.591) (-754.132) (-755.402) [-758.218] -- 0:00:38
Average standard deviation of split frequencies: 0.015913
340500 -- (-755.933) [-755.974] (-755.201) (-754.418) * (-755.632) [-754.668] (-755.213) (-757.996) -- 0:00:38
341000 -- (-760.424) [-755.442] (-755.415) (-756.252) * (-756.126) (-756.402) [-756.190] (-757.779) -- 0:00:38
341500 -- (-755.555) (-755.510) [-760.224] (-756.329) * [-755.692] (-755.787) (-756.195) (-754.073) -- 0:00:38
342000 -- (-755.523) (-755.167) (-756.231) [-756.452] * [-757.655] (-755.337) (-756.298) (-754.900) -- 0:00:38
342500 -- (-756.866) [-755.471] (-755.487) (-761.466) * (-754.423) (-755.885) (-754.655) [-755.305] -- 0:00:38
343000 -- (-756.146) [-761.364] (-755.846) (-756.822) * (-754.634) (-754.724) (-755.543) [-756.806] -- 0:00:38
343500 -- (-755.435) (-757.947) (-757.070) [-754.657] * (-756.477) (-756.274) [-755.124] (-756.462) -- 0:00:38
344000 -- (-754.627) (-760.875) [-754.899] (-757.207) * (-757.790) (-757.784) [-754.716] (-756.430) -- 0:00:38
344500 -- (-753.855) (-761.130) (-754.140) [-754.735] * [-757.281] (-755.251) (-755.346) (-757.301) -- 0:00:38
345000 -- (-758.083) (-757.249) (-754.441) [-755.778] * [-755.002] (-754.454) (-755.450) (-755.865) -- 0:00:39
Average standard deviation of split frequencies: 0.014835
345500 -- (-755.663) (-758.561) [-755.094] (-756.917) * (-754.398) (-754.319) [-755.153] (-754.952) -- 0:00:39
346000 -- (-756.677) (-757.093) [-756.602] (-758.165) * (-756.545) (-758.245) (-755.244) [-756.036] -- 0:00:39
346500 -- (-761.447) (-754.822) (-754.106) [-757.000] * (-754.077) (-755.405) (-755.583) [-755.319] -- 0:00:39
347000 -- (-756.646) [-755.018] (-754.126) (-755.612) * (-754.303) (-755.232) [-754.985] (-756.621) -- 0:00:39
347500 -- (-754.281) (-755.663) (-753.792) [-756.816] * [-753.975] (-754.845) (-754.913) (-756.689) -- 0:00:39
348000 -- (-755.869) (-758.794) [-757.256] (-755.142) * (-757.159) (-755.730) (-756.138) [-756.207] -- 0:00:39
348500 -- (-754.759) [-756.367] (-753.849) (-756.979) * (-756.227) (-754.016) (-760.158) [-755.625] -- 0:00:39
349000 -- (-755.703) [-754.201] (-756.141) (-757.125) * [-754.781] (-755.396) (-755.581) (-755.920) -- 0:00:39
349500 -- (-755.994) [-755.320] (-756.259) (-755.376) * (-754.816) (-756.198) (-754.677) [-755.138] -- 0:00:39
350000 -- (-759.460) (-757.439) [-754.166] (-759.140) * (-756.055) (-761.458) [-755.084] (-758.014) -- 0:00:39
Average standard deviation of split frequencies: 0.014414
350500 -- (-757.590) [-760.326] (-753.974) (-755.121) * [-754.799] (-756.010) (-755.527) (-755.862) -- 0:00:38
351000 -- [-755.050] (-757.209) (-757.682) (-756.715) * (-754.545) (-756.010) (-754.885) [-756.674] -- 0:00:38
351500 -- (-755.382) [-754.519] (-758.522) (-761.315) * (-755.770) (-756.216) (-754.887) [-756.410] -- 0:00:38
352000 -- (-755.500) [-756.635] (-756.770) (-756.158) * (-756.525) (-755.518) [-754.842] (-757.877) -- 0:00:38
352500 -- (-758.384) (-755.560) [-755.174] (-754.819) * (-755.760) (-756.265) [-756.850] (-758.376) -- 0:00:38
353000 -- (-757.621) (-755.731) [-754.728] (-754.222) * (-755.427) (-756.546) (-755.221) [-754.685] -- 0:00:38
353500 -- (-755.920) [-754.810] (-756.120) (-757.958) * (-755.422) [-754.372] (-755.894) (-754.306) -- 0:00:38
354000 -- (-756.165) [-754.222] (-754.049) (-761.530) * (-754.392) [-757.493] (-754.241) (-754.868) -- 0:00:38
354500 -- (-755.953) (-756.420) [-755.833] (-760.024) * [-755.023] (-758.728) (-756.155) (-754.762) -- 0:00:38
355000 -- (-757.949) (-754.070) (-758.323) [-756.363] * [-755.195] (-756.435) (-755.030) (-755.871) -- 0:00:38
Average standard deviation of split frequencies: 0.014410
355500 -- (-755.812) (-755.286) [-756.929] (-757.591) * (-755.333) (-754.226) (-756.487) [-757.511] -- 0:00:38
356000 -- (-756.541) (-760.594) (-756.638) [-755.847] * (-755.446) (-755.669) [-756.072] (-758.347) -- 0:00:37
356500 -- (-754.639) [-760.088] (-757.272) (-755.692) * (-758.228) (-756.484) (-754.576) [-757.183] -- 0:00:37
357000 -- [-754.137] (-758.104) (-757.525) (-759.645) * (-755.456) (-754.172) [-757.687] (-758.400) -- 0:00:37
357500 -- (-755.832) (-755.711) (-757.987) [-759.401] * (-756.560) (-756.208) [-754.775] (-755.815) -- 0:00:37
358000 -- [-758.086] (-758.730) (-754.929) (-760.233) * (-757.254) (-755.459) [-754.953] (-755.814) -- 0:00:37
358500 -- (-758.488) (-756.477) [-756.363] (-756.927) * (-754.930) (-755.500) [-755.613] (-757.481) -- 0:00:37
359000 -- (-757.507) [-754.166] (-754.330) (-756.100) * [-756.690] (-755.311) (-755.485) (-754.881) -- 0:00:37
359500 -- (-758.638) (-755.622) [-755.608] (-758.409) * (-755.060) (-754.614) (-754.145) [-754.051] -- 0:00:37
360000 -- (-755.360) (-758.085) (-757.739) [-757.506] * [-755.932] (-755.924) (-757.697) (-753.996) -- 0:00:37
Average standard deviation of split frequencies: 0.012609
360500 -- [-755.337] (-756.659) (-755.167) (-756.693) * [-756.749] (-758.604) (-754.787) (-753.939) -- 0:00:37
361000 -- [-758.282] (-756.781) (-755.863) (-757.502) * (-755.771) [-757.074] (-760.035) (-754.794) -- 0:00:37
361500 -- (-759.689) [-755.192] (-755.351) (-757.060) * [-754.689] (-756.892) (-756.364) (-754.436) -- 0:00:38
362000 -- [-755.506] (-758.780) (-755.516) (-757.372) * (-754.653) (-754.589) (-756.030) [-755.569] -- 0:00:38
362500 -- (-754.606) (-754.868) [-755.586] (-758.536) * (-755.031) (-756.196) (-755.012) [-755.700] -- 0:00:38
363000 -- (-756.978) (-755.231) (-754.862) [-760.206] * (-758.025) [-755.379] (-755.420) (-754.235) -- 0:00:38
363500 -- (-757.190) (-754.714) (-754.967) [-756.433] * [-758.299] (-755.817) (-755.199) (-754.787) -- 0:00:38
364000 -- (-756.047) (-759.083) [-754.648] (-755.372) * (-755.730) (-754.909) (-754.343) [-755.262] -- 0:00:38
364500 -- [-758.002] (-754.471) (-754.778) (-754.786) * [-756.227] (-758.852) (-754.704) (-756.126) -- 0:00:38
365000 -- [-755.360] (-755.022) (-755.354) (-759.385) * (-757.452) [-754.536] (-755.360) (-759.462) -- 0:00:38
Average standard deviation of split frequencies: 0.011743
365500 -- (-755.350) (-754.665) [-754.479] (-755.378) * (-761.084) (-755.210) [-755.914] (-754.516) -- 0:00:38
366000 -- (-755.074) [-754.419] (-756.201) (-755.739) * (-758.826) (-758.647) [-756.718] (-756.282) -- 0:00:38
366500 -- [-755.939] (-754.821) (-755.750) (-756.443) * [-755.758] (-756.694) (-757.923) (-754.814) -- 0:00:38
367000 -- [-755.405] (-760.329) (-754.355) (-760.168) * (-757.259) (-760.669) [-758.443] (-755.633) -- 0:00:37
367500 -- [-756.160] (-758.029) (-754.000) (-757.022) * [-757.373] (-755.903) (-758.395) (-755.990) -- 0:00:37
368000 -- [-755.730] (-753.866) (-754.511) (-754.782) * [-756.367] (-754.886) (-756.014) (-755.989) -- 0:00:37
368500 -- (-754.247) (-753.794) [-757.102] (-760.883) * (-757.237) [-756.655] (-753.630) (-757.776) -- 0:00:37
369000 -- (-754.428) (-757.213) [-758.745] (-756.965) * (-755.375) (-760.792) (-753.990) [-759.963] -- 0:00:37
369500 -- [-755.140] (-755.350) (-757.341) (-755.856) * (-756.165) (-754.330) (-757.240) [-760.421] -- 0:00:37
370000 -- (-753.920) (-754.612) (-760.910) [-756.879] * (-754.724) (-757.990) (-756.105) [-755.669] -- 0:00:37
Average standard deviation of split frequencies: 0.011670
370500 -- (-755.186) [-754.781] (-756.195) (-756.541) * [-756.171] (-756.212) (-754.597) (-757.774) -- 0:00:37
371000 -- [-754.468] (-756.056) (-755.127) (-754.122) * (-756.221) [-757.025] (-756.135) (-757.009) -- 0:00:37
371500 -- (-755.970) (-758.893) [-755.081] (-754.177) * [-754.275] (-757.561) (-760.276) (-757.795) -- 0:00:37
372000 -- [-760.869] (-755.301) (-762.288) (-762.959) * [-754.441] (-755.290) (-754.118) (-755.189) -- 0:00:37
372500 -- (-755.172) (-757.492) [-754.481] (-759.095) * (-755.785) [-753.872] (-758.093) (-755.133) -- 0:00:37
373000 -- (-755.562) (-756.186) (-756.461) [-756.377] * (-756.699) (-753.770) [-755.820] (-759.301) -- 0:00:36
373500 -- [-757.871] (-758.150) (-759.372) (-756.129) * (-754.870) [-754.207] (-758.850) (-759.507) -- 0:00:36
374000 -- (-757.418) (-756.595) (-759.654) [-757.536] * (-757.045) (-755.288) (-758.349) [-756.871] -- 0:00:36
374500 -- (-754.722) (-758.053) (-755.561) [-754.161] * (-756.799) (-760.186) (-755.450) [-754.908] -- 0:00:36
375000 -- (-753.679) [-757.094] (-754.995) (-755.385) * [-756.073] (-754.997) (-757.308) (-756.794) -- 0:00:36
Average standard deviation of split frequencies: 0.012242
375500 -- (-755.532) (-756.119) (-759.052) [-755.737] * (-756.549) (-754.983) (-760.481) [-754.526] -- 0:00:36
376000 -- (-755.437) [-756.680] (-758.926) (-755.897) * (-758.461) (-757.181) [-754.409] (-758.466) -- 0:00:36
376500 -- (-760.325) (-755.436) [-758.987] (-755.466) * [-755.262] (-758.753) (-755.641) (-758.721) -- 0:00:36
377000 -- (-761.902) (-755.471) (-756.910) [-758.243] * (-757.820) [-757.017] (-754.962) (-759.040) -- 0:00:36
377500 -- (-758.605) [-754.740] (-755.982) (-754.640) * (-756.189) (-753.713) [-758.129] (-755.843) -- 0:00:36
378000 -- [-755.990] (-756.862) (-756.524) (-755.555) * (-754.601) [-757.563] (-757.605) (-756.661) -- 0:00:36
378500 -- (-755.882) (-757.752) [-754.840] (-755.671) * [-755.282] (-756.865) (-753.975) (-763.772) -- 0:00:37
379000 -- [-757.622] (-754.939) (-756.580) (-756.495) * (-756.794) (-754.288) [-758.917] (-760.474) -- 0:00:37
379500 -- (-754.805) (-755.053) (-756.930) [-754.734] * (-756.214) (-755.396) [-755.466] (-762.561) -- 0:00:37
380000 -- (-755.534) [-758.973] (-756.353) (-756.934) * (-756.641) [-755.209] (-757.193) (-760.711) -- 0:00:37
Average standard deviation of split frequencies: 0.011510
380500 -- (-755.388) (-754.192) (-755.118) [-755.735] * (-757.200) (-755.072) [-757.428] (-758.653) -- 0:00:37
381000 -- (-762.119) (-753.644) (-758.230) [-756.996] * (-756.838) (-755.125) [-756.315] (-755.709) -- 0:00:37
381500 -- (-762.290) [-755.888] (-758.283) (-755.911) * (-754.380) (-755.430) (-756.610) [-755.687] -- 0:00:37
382000 -- (-758.812) (-757.768) [-757.520] (-758.920) * (-755.439) (-754.683) [-754.237] (-756.344) -- 0:00:37
382500 -- [-755.007] (-758.459) (-756.967) (-756.176) * (-755.734) [-754.864] (-756.036) (-754.817) -- 0:00:37
383000 -- [-754.575] (-755.663) (-755.906) (-758.137) * (-755.083) (-756.726) (-760.969) [-756.236] -- 0:00:37
383500 -- (-754.696) (-755.372) (-757.017) [-757.003] * (-756.732) (-755.742) (-757.872) [-757.403] -- 0:00:36
384000 -- (-755.272) (-754.415) (-754.256) [-757.275] * (-754.831) (-760.622) (-754.299) [-756.457] -- 0:00:36
384500 -- (-754.603) [-755.075] (-756.788) (-755.557) * (-754.323) (-755.775) (-756.227) [-755.161] -- 0:00:36
385000 -- [-754.490] (-754.012) (-754.668) (-755.556) * [-754.287] (-756.195) (-757.495) (-754.882) -- 0:00:36
Average standard deviation of split frequencies: 0.010417
385500 -- (-754.537) (-754.527) (-756.543) [-755.424] * (-755.075) [-756.096] (-758.844) (-756.011) -- 0:00:36
386000 -- (-761.131) [-754.739] (-755.715) (-756.984) * [-755.710] (-756.509) (-759.772) (-755.836) -- 0:00:36
386500 -- (-757.136) (-754.844) (-756.569) [-757.032] * (-757.160) (-757.306) (-757.064) [-754.526] -- 0:00:36
387000 -- (-756.923) [-756.540] (-761.257) (-754.899) * (-755.078) (-755.720) [-754.866] (-754.325) -- 0:00:36
387500 -- (-754.966) [-754.392] (-757.253) (-755.330) * [-754.207] (-755.744) (-755.810) (-758.715) -- 0:00:36
388000 -- (-756.984) (-753.904) [-757.561] (-754.220) * (-754.989) [-755.133] (-755.476) (-758.873) -- 0:00:36
388500 -- (-754.859) (-756.503) (-760.883) [-755.114] * (-753.870) [-754.562] (-755.538) (-757.185) -- 0:00:36
389000 -- [-756.631] (-755.204) (-754.404) (-759.514) * (-755.026) [-754.587] (-756.689) (-757.688) -- 0:00:36
389500 -- (-756.479) (-755.208) [-754.760] (-760.520) * [-755.837] (-754.884) (-755.844) (-756.443) -- 0:00:36
390000 -- (-754.122) (-755.171) (-754.997) [-757.072] * [-754.698] (-760.924) (-757.831) (-754.263) -- 0:00:35
Average standard deviation of split frequencies: 0.010292
390500 -- (-757.080) [-755.340] (-755.868) (-754.378) * (-754.720) (-761.346) (-756.277) [-754.536] -- 0:00:35
391000 -- [-755.050] (-756.072) (-756.417) (-760.508) * (-756.082) (-754.488) [-757.227] (-754.707) -- 0:00:35
391500 -- (-755.670) [-755.935] (-757.581) (-755.836) * (-755.910) [-754.876] (-754.670) (-755.115) -- 0:00:35
392000 -- [-756.776] (-757.334) (-761.273) (-756.202) * (-755.463) [-754.621] (-756.687) (-756.603) -- 0:00:35
392500 -- [-755.564] (-756.346) (-754.642) (-754.784) * (-756.023) [-754.246] (-759.080) (-757.623) -- 0:00:35
393000 -- (-760.146) (-758.605) [-757.951] (-756.824) * (-756.547) (-758.447) [-755.205] (-753.916) -- 0:00:35
393500 -- (-757.018) (-758.049) (-757.187) [-756.001] * (-756.683) (-754.719) (-754.683) [-756.334] -- 0:00:35
394000 -- (-757.411) [-754.120] (-756.992) (-756.265) * (-762.691) [-754.292] (-756.648) (-759.076) -- 0:00:35
394500 -- (-762.462) [-759.090] (-756.260) (-758.586) * (-755.819) (-755.695) (-757.677) [-757.975] -- 0:00:35
395000 -- [-757.921] (-755.389) (-756.560) (-755.934) * (-757.285) (-756.152) (-758.526) [-755.434] -- 0:00:36
Average standard deviation of split frequencies: 0.010574
395500 -- (-757.656) (-754.660) (-756.516) [-754.123] * (-756.624) (-759.265) (-755.750) [-754.981] -- 0:00:36
396000 -- (-760.585) (-755.835) (-759.247) [-757.005] * [-754.889] (-757.725) (-758.213) (-756.344) -- 0:00:36
396500 -- [-758.700] (-754.797) (-757.954) (-756.812) * (-753.743) (-755.544) (-754.383) [-755.795] -- 0:00:36
397000 -- (-756.538) [-754.917] (-761.111) (-754.536) * [-754.120] (-755.537) (-754.602) (-759.264) -- 0:00:36
397500 -- (-754.693) [-754.289] (-757.693) (-757.377) * [-755.227] (-760.795) (-754.268) (-757.995) -- 0:00:36
398000 -- (-754.320) (-757.942) [-757.392] (-761.888) * (-754.845) [-760.718] (-757.455) (-755.831) -- 0:00:36
398500 -- (-757.584) (-756.722) (-754.892) [-754.620] * (-756.217) [-755.846] (-755.497) (-755.146) -- 0:00:36
399000 -- (-757.526) (-757.797) (-755.745) [-756.069] * (-754.668) (-755.027) (-757.964) [-754.375] -- 0:00:36
399500 -- [-755.462] (-753.877) (-756.797) (-756.642) * [-754.650] (-757.140) (-756.296) (-758.314) -- 0:00:36
400000 -- (-756.803) (-756.673) [-755.730] (-754.187) * [-756.446] (-757.040) (-755.333) (-761.650) -- 0:00:36
Average standard deviation of split frequencies: 0.010589
400500 -- (-758.924) (-755.425) [-756.995] (-756.134) * (-755.468) [-754.068] (-758.172) (-756.819) -- 0:00:35
401000 -- [-753.873] (-756.989) (-755.652) (-757.861) * [-754.866] (-756.928) (-754.949) (-755.147) -- 0:00:35
401500 -- (-753.797) (-759.968) [-756.285] (-755.034) * (-758.477) (-756.351) (-754.731) [-755.593] -- 0:00:35
402000 -- (-754.596) (-761.518) (-756.387) [-756.077] * (-755.252) (-757.974) [-757.382] (-757.225) -- 0:00:35
402500 -- (-757.057) (-760.792) (-757.504) [-757.480] * (-754.691) (-760.055) [-756.705] (-755.221) -- 0:00:35
403000 -- [-756.347] (-757.693) (-758.253) (-755.825) * (-754.724) (-755.227) [-756.975] (-754.226) -- 0:00:35
403500 -- (-756.563) (-754.795) (-761.034) [-755.275] * (-757.383) (-758.447) [-758.532] (-762.292) -- 0:00:35
404000 -- (-757.769) [-754.907] (-760.630) (-757.144) * (-756.463) (-757.382) [-758.042] (-757.646) -- 0:00:35
404500 -- (-755.235) [-756.275] (-758.649) (-755.416) * (-756.034) (-755.112) [-756.663] (-754.922) -- 0:00:35
405000 -- [-755.705] (-756.007) (-753.616) (-753.887) * (-755.804) [-757.205] (-757.598) (-755.698) -- 0:00:35
Average standard deviation of split frequencies: 0.010245
405500 -- (-757.786) (-756.557) [-755.792] (-754.744) * [-758.268] (-755.647) (-755.554) (-760.560) -- 0:00:35
406000 -- [-756.533] (-759.807) (-754.198) (-755.106) * (-759.473) (-755.098) [-757.846] (-758.080) -- 0:00:35
406500 -- [-756.652] (-755.150) (-758.010) (-760.173) * (-755.930) (-758.124) [-755.017] (-763.692) -- 0:00:35
407000 -- (-757.849) (-755.119) (-757.061) [-756.892] * (-756.627) (-757.835) [-757.140] (-756.057) -- 0:00:34
407500 -- [-756.694] (-756.458) (-760.445) (-756.744) * (-755.085) (-755.220) (-760.604) [-755.301] -- 0:00:34
408000 -- [-754.974] (-760.842) (-763.273) (-755.545) * (-757.152) [-754.560] (-754.228) (-755.505) -- 0:00:34
408500 -- (-755.687) (-754.481) [-754.768] (-756.186) * (-755.709) (-753.944) [-756.528] (-756.095) -- 0:00:34
409000 -- (-756.984) (-756.169) (-755.440) [-758.646] * [-754.519] (-755.522) (-754.635) (-759.457) -- 0:00:34
409500 -- [-758.672] (-757.423) (-753.858) (-755.001) * (-755.490) (-757.284) (-754.864) [-758.465] -- 0:00:34
410000 -- [-755.685] (-754.709) (-754.858) (-755.674) * (-758.522) [-757.719] (-755.148) (-755.219) -- 0:00:34
Average standard deviation of split frequencies: 0.010264
410500 -- (-757.140) [-754.610] (-757.369) (-757.033) * (-757.794) (-755.259) [-754.906] (-759.708) -- 0:00:34
411000 -- [-754.560] (-755.078) (-756.264) (-756.095) * (-754.723) [-755.426] (-754.700) (-755.711) -- 0:00:34
411500 -- [-754.314] (-756.212) (-757.204) (-753.932) * (-753.942) (-755.315) (-758.570) [-756.529] -- 0:00:35
412000 -- (-758.284) [-756.033] (-756.042) (-755.761) * (-754.689) [-758.412] (-755.065) (-755.112) -- 0:00:35
412500 -- (-756.125) [-757.954] (-755.013) (-754.236) * (-756.054) [-754.549] (-756.385) (-756.092) -- 0:00:35
413000 -- (-755.244) (-755.079) [-756.042] (-755.889) * (-759.041) (-755.649) (-756.464) [-755.440] -- 0:00:35
413500 -- (-754.684) (-754.325) [-756.030] (-755.555) * (-756.093) (-755.534) (-755.815) [-755.426] -- 0:00:35
414000 -- [-754.406] (-757.365) (-758.203) (-755.004) * [-754.987] (-758.980) (-757.355) (-757.681) -- 0:00:35
414500 -- [-755.097] (-754.973) (-755.931) (-754.985) * (-754.636) (-754.408) [-758.274] (-755.517) -- 0:00:35
415000 -- (-754.182) [-759.429] (-756.362) (-758.013) * (-754.453) (-756.798) [-755.242] (-754.957) -- 0:00:35
Average standard deviation of split frequencies: 0.010199
415500 -- (-754.546) (-756.234) [-756.003] (-759.171) * (-754.143) [-755.111] (-756.065) (-757.131) -- 0:00:35
416000 -- [-755.031] (-757.587) (-764.650) (-757.603) * (-754.747) [-755.203] (-759.171) (-755.697) -- 0:00:35
416500 -- [-754.477] (-755.219) (-760.677) (-756.963) * (-756.116) (-756.037) (-755.991) [-755.280] -- 0:00:35
417000 -- (-755.466) (-758.620) [-757.073] (-757.645) * (-754.639) (-755.914) [-755.843] (-755.909) -- 0:00:34
417500 -- (-756.483) [-757.406] (-758.071) (-755.614) * (-754.987) (-757.145) [-755.240] (-755.994) -- 0:00:34
418000 -- [-756.643] (-759.273) (-755.542) (-761.272) * [-755.903] (-758.787) (-755.577) (-756.475) -- 0:00:34
418500 -- [-755.061] (-760.317) (-754.910) (-756.211) * (-755.619) (-757.340) (-754.580) [-756.917] -- 0:00:34
419000 -- (-755.675) (-755.003) [-755.523] (-754.245) * [-757.475] (-759.653) (-754.820) (-756.841) -- 0:00:34
419500 -- [-756.945] (-757.478) (-759.311) (-754.930) * (-755.201) [-755.341] (-754.946) (-755.588) -- 0:00:34
420000 -- (-755.776) (-755.495) (-757.982) [-754.592] * (-754.997) [-755.701] (-754.437) (-755.452) -- 0:00:34
Average standard deviation of split frequencies: 0.010547
420500 -- (-755.391) [-755.375] (-758.251) (-754.710) * (-755.127) (-760.937) [-754.350] (-754.472) -- 0:00:34
421000 -- (-756.177) (-754.987) (-754.973) [-756.529] * (-755.251) [-760.810] (-758.171) (-755.083) -- 0:00:34
421500 -- (-756.424) [-754.840] (-755.050) (-758.721) * (-758.671) [-755.753] (-754.354) (-755.106) -- 0:00:34
422000 -- [-755.435] (-755.388) (-754.694) (-757.910) * (-759.470) (-755.416) [-757.629] (-756.136) -- 0:00:34
422500 -- [-757.678] (-755.756) (-755.897) (-757.201) * (-756.258) [-757.331] (-760.845) (-756.688) -- 0:00:34
423000 -- (-757.055) (-755.223) (-755.456) [-755.839] * (-761.758) (-755.093) (-756.904) [-757.498] -- 0:00:34
423500 -- [-759.853] (-753.908) (-755.400) (-754.940) * [-757.331] (-755.766) (-760.339) (-754.627) -- 0:00:34
424000 -- (-756.500) [-756.778] (-757.095) (-760.573) * (-757.441) (-755.322) [-755.355] (-754.592) -- 0:00:33
424500 -- (-754.168) [-755.310] (-756.946) (-757.142) * (-758.224) (-758.082) [-756.268] (-759.748) -- 0:00:33
425000 -- (-755.588) (-757.876) [-756.653] (-758.697) * (-755.431) [-757.262] (-754.280) (-755.887) -- 0:00:33
Average standard deviation of split frequencies: 0.010805
425500 -- (-756.215) (-754.201) (-756.219) [-754.674] * [-756.518] (-756.862) (-754.428) (-757.279) -- 0:00:33
426000 -- (-754.459) [-755.426] (-757.158) (-754.127) * (-756.613) [-758.521] (-758.411) (-755.377) -- 0:00:33
426500 -- (-754.342) [-754.878] (-755.232) (-754.352) * (-755.776) (-757.338) [-756.545] (-754.278) -- 0:00:33
427000 -- (-755.871) [-755.129] (-760.558) (-758.270) * (-754.169) [-754.318] (-757.329) (-754.646) -- 0:00:33
427500 -- (-759.037) (-758.631) [-754.821] (-759.662) * (-753.905) [-757.517] (-755.152) (-755.794) -- 0:00:33
428000 -- (-758.787) [-754.110] (-754.716) (-756.550) * (-753.979) (-756.662) [-755.266] (-756.186) -- 0:00:34
428500 -- (-758.810) (-757.431) [-756.367] (-753.604) * (-754.104) (-759.077) [-756.044] (-754.589) -- 0:00:34
429000 -- (-761.303) (-755.141) [-755.925] (-758.891) * (-757.997) (-757.537) (-756.264) [-760.628] -- 0:00:34
429500 -- (-758.764) (-754.872) [-759.416] (-761.971) * [-756.223] (-758.589) (-755.243) (-758.249) -- 0:00:34
430000 -- (-759.673) (-755.371) (-754.987) [-757.147] * [-760.206] (-756.293) (-754.533) (-755.172) -- 0:00:34
Average standard deviation of split frequencies: 0.010817
430500 -- (-756.061) (-756.244) (-754.702) [-755.489] * (-756.487) (-756.491) (-756.511) [-757.879] -- 0:00:34
431000 -- [-754.338] (-755.961) (-755.197) (-755.835) * (-756.918) [-755.337] (-758.146) (-759.045) -- 0:00:34
431500 -- (-754.327) (-759.394) (-755.250) [-755.416] * [-756.852] (-754.937) (-756.418) (-756.222) -- 0:00:34
432000 -- [-756.209] (-756.453) (-758.607) (-757.262) * (-756.066) [-757.784] (-756.015) (-755.395) -- 0:00:34
432500 -- (-756.281) [-754.579] (-755.867) (-756.732) * [-757.815] (-755.117) (-756.032) (-757.555) -- 0:00:34
433000 -- (-755.055) (-754.338) (-757.963) [-756.782] * (-753.843) (-759.288) [-753.782] (-757.549) -- 0:00:34
433500 -- [-754.650] (-756.120) (-754.889) (-755.534) * (-755.168) (-756.238) (-754.212) [-756.019] -- 0:00:33
434000 -- (-757.137) (-756.597) [-755.285] (-756.380) * (-755.035) [-760.430] (-756.140) (-756.732) -- 0:00:33
434500 -- [-755.358] (-755.105) (-756.314) (-757.843) * (-754.818) (-753.920) (-756.884) [-755.849] -- 0:00:33
435000 -- (-755.129) (-756.674) [-755.297] (-760.214) * [-756.731] (-759.566) (-759.092) (-757.176) -- 0:00:33
Average standard deviation of split frequencies: 0.010685
435500 -- (-757.045) [-756.082] (-755.843) (-755.341) * (-755.806) (-755.815) (-758.535) [-756.031] -- 0:00:33
436000 -- (-754.649) (-756.265) [-755.556] (-757.598) * (-757.438) (-755.983) [-754.888] (-758.040) -- 0:00:33
436500 -- [-755.936] (-755.042) (-756.264) (-762.205) * (-757.379) [-757.937] (-759.041) (-757.067) -- 0:00:33
437000 -- [-756.313] (-756.618) (-753.760) (-759.809) * (-755.234) (-757.948) [-754.165] (-754.283) -- 0:00:33
437500 -- (-761.279) [-754.484] (-757.440) (-758.970) * [-754.954] (-756.200) (-754.032) (-754.393) -- 0:00:33
438000 -- (-758.835) (-755.803) (-756.073) [-755.892] * (-758.094) (-754.030) (-755.665) [-755.301] -- 0:00:33
438500 -- (-761.003) (-755.684) (-754.144) [-755.075] * (-757.801) (-754.583) [-758.815] (-755.429) -- 0:00:33
439000 -- (-753.749) (-755.147) [-755.543] (-756.367) * (-758.286) (-754.705) (-759.367) [-755.843] -- 0:00:33
439500 -- (-753.906) [-756.833] (-754.540) (-755.723) * (-754.892) (-760.574) (-761.999) [-757.178] -- 0:00:33
440000 -- (-756.708) [-756.798] (-755.323) (-754.496) * (-754.141) (-756.431) [-762.192] (-760.819) -- 0:00:33
Average standard deviation of split frequencies: 0.009439
440500 -- (-758.117) (-757.834) [-755.392] (-755.405) * (-755.520) [-755.146] (-755.758) (-757.530) -- 0:00:33
441000 -- (-755.509) (-757.845) [-755.964] (-756.170) * (-755.090) (-754.159) (-760.586) [-753.856] -- 0:00:32
441500 -- (-755.079) (-757.446) [-755.863] (-755.237) * (-754.332) (-755.406) [-757.076] (-753.962) -- 0:00:32
442000 -- (-758.204) [-757.360] (-755.620) (-754.179) * (-758.034) (-757.148) (-755.256) [-754.471] -- 0:00:32
442500 -- (-763.753) (-755.324) (-756.737) [-755.700] * (-759.731) (-755.891) [-755.647] (-756.975) -- 0:00:32
443000 -- [-756.265] (-756.376) (-754.848) (-755.203) * [-757.009] (-755.677) (-755.469) (-756.154) -- 0:00:32
443500 -- [-756.650] (-754.384) (-756.270) (-759.012) * (-755.990) (-757.348) (-755.662) [-757.533] -- 0:00:32
444000 -- (-759.447) (-754.308) [-762.575] (-758.090) * (-756.944) [-758.239] (-756.862) (-754.616) -- 0:00:32
444500 -- (-760.282) [-754.863] (-755.541) (-755.373) * (-758.075) [-756.106] (-756.401) (-757.912) -- 0:00:33
445000 -- (-762.792) [-756.551] (-756.465) (-755.423) * (-757.217) (-755.773) (-754.713) [-753.804] -- 0:00:33
Average standard deviation of split frequencies: 0.009077
445500 -- (-756.169) (-754.005) (-759.728) [-756.452] * (-755.742) (-755.413) [-757.480] (-755.340) -- 0:00:33
446000 -- (-754.993) [-754.387] (-759.034) (-757.770) * (-754.689) [-754.274] (-755.379) (-756.293) -- 0:00:33
446500 -- (-755.652) [-755.638] (-755.864) (-756.571) * (-755.722) (-757.608) (-759.051) [-755.745] -- 0:00:33
447000 -- (-755.191) (-755.315) [-755.006] (-755.584) * (-755.354) [-757.613] (-757.080) (-757.369) -- 0:00:33
447500 -- [-757.713] (-756.035) (-754.263) (-754.381) * (-754.534) (-754.107) [-756.875] (-758.451) -- 0:00:33
448000 -- [-755.483] (-754.227) (-759.310) (-754.930) * (-754.414) (-755.738) [-756.982] (-755.464) -- 0:00:33
448500 -- [-757.642] (-755.689) (-760.662) (-756.013) * [-754.791] (-759.664) (-755.762) (-756.787) -- 0:00:33
449000 -- [-754.485] (-754.109) (-758.416) (-759.622) * (-755.683) (-760.077) (-756.114) [-756.104] -- 0:00:33
449500 -- [-754.590] (-755.478) (-755.323) (-755.648) * [-755.880] (-758.861) (-755.139) (-755.676) -- 0:00:33
450000 -- (-753.988) (-756.185) [-755.917] (-755.261) * (-757.128) (-757.679) [-755.675] (-754.535) -- 0:00:33
Average standard deviation of split frequencies: 0.009168
450500 -- [-755.385] (-756.078) (-755.822) (-757.087) * [-754.597] (-763.777) (-760.855) (-757.024) -- 0:00:32
451000 -- (-753.810) [-754.277] (-757.471) (-757.008) * [-754.633] (-759.077) (-757.170) (-754.972) -- 0:00:32
451500 -- [-754.123] (-755.745) (-754.420) (-755.430) * (-754.686) [-760.155] (-754.183) (-755.004) -- 0:00:32
452000 -- (-757.296) (-758.617) (-755.017) [-755.468] * (-756.350) (-756.255) [-754.907] (-761.145) -- 0:00:32
452500 -- (-755.529) (-755.439) (-755.163) [-756.351] * (-757.731) (-754.446) [-755.182] (-758.083) -- 0:00:32
453000 -- (-756.335) (-757.243) (-754.565) [-754.515] * [-755.340] (-758.683) (-756.189) (-758.844) -- 0:00:32
453500 -- (-760.142) (-761.309) (-757.992) [-756.368] * (-756.776) [-759.062] (-759.656) (-754.917) -- 0:00:32
454000 -- [-755.429] (-756.848) (-755.551) (-764.950) * (-758.512) [-754.107] (-757.176) (-757.517) -- 0:00:32
454500 -- (-756.976) (-756.525) (-757.465) [-756.750] * (-754.554) (-757.710) (-754.435) [-755.135] -- 0:00:32
455000 -- (-760.266) (-755.115) (-760.399) [-754.587] * [-754.142] (-757.928) (-754.442) (-754.755) -- 0:00:32
Average standard deviation of split frequencies: 0.009304
455500 -- (-756.952) (-756.054) (-755.523) [-754.066] * (-754.704) (-754.532) (-757.570) [-754.605] -- 0:00:32
456000 -- (-757.246) (-755.911) (-757.430) [-755.751] * (-755.206) [-754.999] (-755.606) (-754.833) -- 0:00:32
456500 -- (-755.909) [-757.615] (-758.775) (-755.987) * [-755.900] (-756.448) (-756.325) (-755.021) -- 0:00:32
457000 -- (-758.684) [-757.575] (-756.209) (-755.537) * (-757.734) [-758.139] (-755.019) (-755.326) -- 0:00:32
457500 -- (-760.163) (-754.883) (-755.495) [-755.792] * (-755.410) (-758.729) [-756.100] (-759.563) -- 0:00:32
458000 -- (-755.846) (-760.725) (-755.979) [-757.735] * (-757.316) (-755.987) (-755.422) [-755.993] -- 0:00:31
458500 -- [-759.366] (-755.116) (-754.408) (-758.534) * (-761.407) [-754.303] (-756.342) (-757.049) -- 0:00:31
459000 -- (-761.644) (-755.810) (-755.707) [-757.823] * [-756.732] (-757.035) (-756.084) (-757.881) -- 0:00:31
459500 -- (-758.012) [-754.567] (-757.745) (-757.481) * (-755.789) (-754.047) (-755.738) [-758.238] -- 0:00:31
460000 -- (-756.559) (-757.708) [-758.202] (-758.286) * [-756.567] (-755.098) (-754.710) (-756.918) -- 0:00:31
Average standard deviation of split frequencies: 0.009691
460500 -- (-756.492) (-755.155) (-765.112) [-753.983] * (-759.045) [-754.366] (-755.406) (-757.280) -- 0:00:31
461000 -- (-757.509) (-756.831) [-756.210] (-757.540) * (-754.024) (-754.596) (-757.369) [-755.898] -- 0:00:31
461500 -- [-756.900] (-758.957) (-756.305) (-756.794) * (-755.818) [-754.952] (-757.401) (-759.078) -- 0:00:32
462000 -- [-755.141] (-762.741) (-756.768) (-757.238) * (-755.188) [-754.993] (-757.423) (-759.232) -- 0:00:32
462500 -- (-761.391) (-763.182) [-756.391] (-758.375) * (-755.812) (-757.800) [-755.015] (-756.352) -- 0:00:32
463000 -- (-757.912) (-757.854) (-756.169) [-759.885] * (-759.920) (-756.978) (-756.369) [-755.797] -- 0:00:32
463500 -- (-756.184) (-757.817) (-760.881) [-765.212] * (-760.506) (-754.162) [-755.668] (-755.234) -- 0:00:32
464000 -- (-757.306) (-756.271) [-756.852] (-757.792) * (-756.696) (-754.758) [-755.130] (-754.404) -- 0:00:32
464500 -- (-756.528) (-759.964) (-767.478) [-754.845] * (-755.972) (-754.925) (-755.185) [-754.252] -- 0:00:32
465000 -- (-754.580) [-754.221] (-760.318) (-755.090) * (-754.577) (-756.299) (-757.052) [-755.998] -- 0:00:32
Average standard deviation of split frequencies: 0.008926
465500 -- (-754.457) (-757.844) (-759.503) [-754.998] * [-758.776] (-757.176) (-756.704) (-754.944) -- 0:00:32
466000 -- (-754.948) (-758.484) (-754.342) [-754.541] * (-754.425) (-757.277) (-755.882) [-756.265] -- 0:00:32
466500 -- [-755.839] (-754.786) (-755.876) (-754.117) * (-753.942) (-757.792) [-755.802] (-757.027) -- 0:00:32
467000 -- (-754.930) (-759.017) (-756.789) [-757.362] * [-758.395] (-756.185) (-759.105) (-758.958) -- 0:00:31
467500 -- [-755.125] (-754.669) (-758.933) (-754.978) * (-756.720) [-756.756] (-759.137) (-756.436) -- 0:00:31
468000 -- (-756.102) (-756.468) (-759.781) [-756.225] * (-758.297) (-754.542) (-760.455) [-757.187] -- 0:00:31
468500 -- (-755.645) (-757.098) [-757.200] (-760.522) * (-757.815) (-755.931) (-755.021) [-756.636] -- 0:00:31
469000 -- [-756.929] (-759.052) (-756.709) (-757.764) * (-759.589) (-755.054) [-754.830] (-757.587) -- 0:00:31
469500 -- [-755.819] (-757.624) (-757.979) (-758.109) * [-754.428] (-753.808) (-757.125) (-756.102) -- 0:00:31
470000 -- (-756.939) [-756.544] (-757.772) (-756.626) * [-757.306] (-760.598) (-754.924) (-754.148) -- 0:00:31
Average standard deviation of split frequencies: 0.009132
470500 -- (-755.615) (-757.081) (-759.218) [-753.728] * (-758.169) (-754.987) [-757.743] (-757.959) -- 0:00:31
471000 -- (-755.321) (-757.633) (-761.747) [-753.998] * (-754.935) (-755.489) (-762.332) [-759.569] -- 0:00:31
471500 -- (-755.913) (-755.259) (-759.255) [-754.759] * (-754.869) [-754.928] (-757.003) (-755.861) -- 0:00:31
472000 -- (-755.933) [-756.877] (-757.044) (-755.927) * (-755.847) (-755.962) [-755.675] (-754.952) -- 0:00:31
472500 -- [-757.867] (-755.860) (-756.893) (-756.319) * (-756.226) (-757.551) (-754.032) [-757.820] -- 0:00:31
473000 -- [-757.183] (-754.844) (-756.529) (-754.854) * (-761.424) (-757.642) [-754.497] (-754.971) -- 0:00:31
473500 -- [-759.627] (-758.879) (-754.963) (-757.303) * (-754.425) (-756.459) (-757.291) [-757.283] -- 0:00:31
474000 -- (-759.614) [-755.282] (-756.652) (-756.000) * (-755.304) (-754.955) (-757.293) [-754.716] -- 0:00:31
474500 -- (-759.924) (-756.752) [-755.220] (-755.961) * (-754.351) (-754.777) (-758.848) [-755.401] -- 0:00:31
475000 -- [-754.734] (-757.621) (-755.048) (-757.733) * [-755.064] (-756.314) (-754.387) (-756.106) -- 0:00:30
Average standard deviation of split frequencies: 0.009470
475500 -- [-754.291] (-756.647) (-755.059) (-756.273) * (-755.086) [-754.188] (-754.148) (-754.480) -- 0:00:30
476000 -- [-755.100] (-755.792) (-755.767) (-756.490) * [-754.590] (-762.080) (-755.451) (-754.775) -- 0:00:30
476500 -- (-755.554) [-754.695] (-755.505) (-759.620) * (-754.506) (-756.517) (-755.370) [-755.037] -- 0:00:30
477000 -- (-756.347) (-756.511) (-755.567) [-757.555] * (-753.827) (-757.574) [-755.719] (-757.171) -- 0:00:30
477500 -- (-760.352) [-754.620] (-756.952) (-759.613) * (-761.887) [-756.258] (-755.362) (-754.812) -- 0:00:30
478000 -- (-756.157) (-757.704) [-755.892] (-756.987) * [-756.952] (-756.836) (-754.540) (-757.805) -- 0:00:30
478500 -- (-755.607) (-756.279) (-757.465) [-753.844] * (-758.175) [-755.972] (-756.441) (-755.063) -- 0:00:31
479000 -- (-756.512) (-755.665) [-756.822] (-754.560) * (-755.482) (-755.011) [-756.800] (-755.160) -- 0:00:31
479500 -- [-755.857] (-759.405) (-755.925) (-755.065) * (-757.480) (-755.450) (-757.697) [-754.262] -- 0:00:31
480000 -- (-755.184) (-757.982) [-755.846] (-756.915) * (-754.838) (-758.246) (-756.918) [-755.533] -- 0:00:31
Average standard deviation of split frequencies: 0.009930
480500 -- (-754.966) (-756.332) (-758.039) [-759.350] * (-757.204) (-755.783) (-754.610) [-753.792] -- 0:00:31
481000 -- (-756.329) [-754.687] (-755.394) (-756.963) * (-753.670) (-754.839) (-758.007) [-759.530] -- 0:00:31
481500 -- [-761.073] (-754.932) (-760.718) (-756.741) * [-755.786] (-755.170) (-755.066) (-757.237) -- 0:00:31
482000 -- (-761.990) (-756.258) [-755.326] (-756.736) * [-754.342] (-757.050) (-756.220) (-755.522) -- 0:00:31
482500 -- (-759.373) (-755.446) (-754.682) [-756.754] * (-759.834) (-754.753) [-753.988] (-758.919) -- 0:00:31
483000 -- (-755.836) (-755.215) (-758.751) [-755.187] * (-760.105) (-755.275) [-758.462] (-754.292) -- 0:00:31
483500 -- (-757.170) [-757.108] (-757.404) (-756.034) * (-756.169) (-755.350) (-754.015) [-755.090] -- 0:00:30
484000 -- [-757.131] (-756.870) (-756.386) (-755.197) * (-756.505) (-755.924) [-757.717] (-757.334) -- 0:00:30
484500 -- (-756.970) (-760.777) [-754.775] (-756.113) * (-756.649) (-758.360) (-755.972) [-755.369] -- 0:00:30
485000 -- [-756.484] (-757.587) (-755.259) (-756.946) * (-758.445) (-759.065) (-754.949) [-756.766] -- 0:00:30
Average standard deviation of split frequencies: 0.009457
485500 -- [-755.867] (-754.975) (-755.633) (-754.370) * (-757.828) (-757.509) (-756.449) [-756.117] -- 0:00:30
486000 -- (-755.529) [-755.428] (-754.766) (-754.837) * (-755.813) (-755.596) [-756.143] (-756.365) -- 0:00:30
486500 -- [-756.584] (-754.619) (-756.515) (-756.085) * [-755.523] (-757.281) (-754.620) (-755.164) -- 0:00:30
487000 -- (-754.459) [-759.048] (-754.508) (-756.938) * (-758.009) (-757.375) [-755.746] (-758.390) -- 0:00:30
487500 -- (-755.122) (-756.549) [-755.904] (-756.969) * (-758.120) (-754.937) (-755.500) [-755.091] -- 0:00:30
488000 -- (-756.781) [-757.266] (-754.803) (-755.303) * (-759.929) (-755.769) (-754.771) [-754.113] -- 0:00:30
488500 -- (-756.375) (-757.429) [-757.129] (-757.370) * (-755.840) [-754.824] (-755.605) (-754.144) -- 0:00:30
489000 -- [-756.681] (-753.719) (-755.371) (-754.661) * [-756.463] (-756.900) (-755.368) (-756.205) -- 0:00:30
489500 -- (-754.963) (-757.616) (-759.850) [-753.860] * (-755.517) [-757.681] (-761.450) (-756.637) -- 0:00:30
490000 -- [-754.084] (-757.367) (-756.348) (-753.662) * (-754.306) [-756.562] (-754.330) (-757.070) -- 0:00:30
Average standard deviation of split frequencies: 0.009547
490500 -- (-755.987) (-759.697) (-760.037) [-753.662] * (-758.111) (-758.491) [-756.884] (-754.357) -- 0:00:30
491000 -- (-755.634) (-755.471) (-755.787) [-758.902] * [-756.401] (-756.477) (-760.227) (-753.804) -- 0:00:30
491500 -- (-756.975) (-761.573) [-755.618] (-755.787) * (-756.960) (-755.306) [-761.285] (-754.648) -- 0:00:30
492000 -- (-757.302) (-754.315) (-754.971) [-755.675] * (-754.340) (-754.603) [-754.632] (-755.450) -- 0:00:29
492500 -- (-757.410) [-755.828] (-755.081) (-759.832) * [-755.007] (-755.345) (-755.213) (-756.582) -- 0:00:29
493000 -- (-754.887) [-755.721] (-756.931) (-756.419) * (-756.686) (-756.623) [-754.596] (-756.443) -- 0:00:29
493500 -- (-755.374) (-757.364) (-759.474) [-758.472] * (-755.649) [-755.738] (-754.314) (-760.361) -- 0:00:29
494000 -- (-755.070) (-756.100) [-761.283] (-754.736) * [-753.748] (-756.813) (-756.580) (-755.012) -- 0:00:29
494500 -- [-754.332] (-757.293) (-757.865) (-755.655) * (-754.323) (-753.932) [-754.641] (-755.495) -- 0:00:29
495000 -- (-753.919) [-754.399] (-755.875) (-755.972) * (-756.398) (-754.014) [-754.338] (-756.425) -- 0:00:30
Average standard deviation of split frequencies: 0.009682
495500 -- (-754.410) [-755.756] (-755.353) (-756.647) * (-756.606) (-756.292) (-755.095) [-754.579] -- 0:00:30
496000 -- (-755.812) (-755.352) [-755.109] (-760.022) * (-759.164) (-754.689) (-756.249) [-754.722] -- 0:00:30
496500 -- (-756.275) (-758.496) (-755.478) [-755.548] * (-757.966) (-754.369) (-756.392) [-756.785] -- 0:00:30
497000 -- [-757.793] (-754.614) (-754.375) (-758.344) * (-756.190) (-756.491) (-755.616) [-755.620] -- 0:00:30
497500 -- (-757.405) (-757.988) [-754.340] (-754.343) * (-757.043) [-754.958] (-755.160) (-756.556) -- 0:00:30
498000 -- (-754.149) (-755.012) (-758.387) [-758.901] * (-757.410) (-755.027) (-754.801) [-754.143] -- 0:00:30
498500 -- (-756.665) [-755.829] (-759.983) (-759.380) * [-755.003] (-757.651) (-756.176) (-758.608) -- 0:00:30
499000 -- [-757.571] (-757.520) (-754.427) (-758.000) * (-755.540) [-755.751] (-757.887) (-763.647) -- 0:00:30
499500 -- (-754.852) [-756.080] (-754.780) (-756.431) * (-754.290) [-753.790] (-755.093) (-755.511) -- 0:00:30
500000 -- (-754.596) (-760.517) (-754.283) [-755.255] * (-757.070) [-754.731] (-756.852) (-754.898) -- 0:00:30
Average standard deviation of split frequencies: 0.009651
500500 -- (-754.352) [-761.362] (-755.076) (-758.255) * (-753.857) [-754.938] (-756.427) (-754.383) -- 0:00:29
501000 -- [-757.346] (-759.597) (-755.591) (-754.459) * [-754.794] (-754.891) (-754.542) (-754.884) -- 0:00:29
501500 -- [-756.248] (-757.066) (-759.092) (-754.599) * [-757.573] (-754.037) (-755.403) (-757.822) -- 0:00:29
502000 -- (-753.935) (-757.514) (-754.546) [-759.023] * (-755.310) (-755.324) [-755.382] (-758.961) -- 0:00:29
502500 -- (-754.235) (-755.532) [-755.159] (-757.059) * (-759.105) (-755.438) (-755.154) [-758.120] -- 0:00:29
503000 -- (-754.212) [-755.145] (-753.957) (-757.346) * (-761.075) (-755.819) [-755.918] (-755.196) -- 0:00:29
503500 -- (-761.205) [-755.914] (-756.311) (-756.047) * (-756.108) (-755.083) [-754.698] (-765.166) -- 0:00:29
504000 -- (-754.349) (-754.740) [-756.609] (-756.041) * (-756.074) (-756.400) [-755.635] (-756.446) -- 0:00:29
504500 -- (-756.760) (-755.130) [-756.003] (-756.336) * (-755.154) [-754.865] (-755.652) (-756.943) -- 0:00:29
505000 -- (-755.289) [-754.055] (-756.166) (-759.814) * (-757.170) (-756.128) (-757.283) [-759.304] -- 0:00:29
Average standard deviation of split frequencies: 0.009666
505500 -- (-758.163) [-757.537] (-756.889) (-756.603) * (-756.918) (-760.636) [-753.948] (-757.481) -- 0:00:29
506000 -- (-754.895) [-755.181] (-759.224) (-756.558) * (-760.976) [-756.701] (-754.108) (-763.204) -- 0:00:29
506500 -- (-757.254) (-755.181) (-760.416) [-755.811] * [-755.972] (-756.079) (-757.141) (-759.598) -- 0:00:29
507000 -- (-757.298) (-757.444) (-755.912) [-756.026] * [-757.814] (-756.872) (-756.512) (-755.746) -- 0:00:29
507500 -- (-756.158) (-756.727) (-755.214) [-754.538] * [-755.842] (-758.913) (-756.115) (-757.604) -- 0:00:29
508000 -- (-755.146) (-759.264) [-756.434] (-754.475) * (-756.482) [-755.656] (-758.810) (-755.836) -- 0:00:29
508500 -- (-755.123) (-756.875) (-757.787) [-755.140] * [-754.378] (-756.485) (-759.373) (-755.750) -- 0:00:28
509000 -- (-754.905) [-756.934] (-758.001) (-754.585) * [-754.246] (-755.261) (-755.165) (-754.438) -- 0:00:28
509500 -- (-754.170) (-758.240) [-755.568] (-758.159) * (-757.660) (-756.267) [-754.400] (-756.862) -- 0:00:28
510000 -- (-756.440) (-756.230) [-755.283] (-754.204) * [-754.849] (-756.796) (-755.545) (-756.440) -- 0:00:28
Average standard deviation of split frequencies: 0.009981
510500 -- (-755.654) (-756.223) [-754.849] (-756.147) * (-756.073) (-755.494) (-756.099) [-754.031] -- 0:00:28
511000 -- (-755.185) (-762.340) (-755.669) [-756.152] * (-754.992) (-756.612) (-755.922) [-754.778] -- 0:00:28
511500 -- (-756.327) [-757.858] (-755.826) (-759.116) * (-755.031) [-755.337] (-755.692) (-755.061) -- 0:00:28
512000 -- (-757.194) (-754.352) [-756.715] (-754.570) * (-755.048) (-755.031) (-755.185) [-755.384] -- 0:00:29
512500 -- (-756.492) [-758.349] (-757.414) (-755.867) * (-756.523) [-756.709] (-758.937) (-757.354) -- 0:00:29
513000 -- [-755.459] (-755.406) (-755.513) (-756.197) * (-758.112) [-757.151] (-758.339) (-759.589) -- 0:00:29
513500 -- [-754.655] (-756.355) (-757.301) (-756.533) * (-755.062) (-754.909) (-754.453) [-757.484] -- 0:00:29
514000 -- [-753.941] (-755.817) (-757.622) (-755.388) * (-757.002) (-755.064) (-755.609) [-759.246] -- 0:00:29
514500 -- (-759.976) [-756.315] (-754.190) (-756.030) * (-757.301) [-757.375] (-755.387) (-754.640) -- 0:00:29
515000 -- (-760.450) (-758.981) [-756.247] (-754.266) * [-754.171] (-755.443) (-755.762) (-761.728) -- 0:00:29
Average standard deviation of split frequencies: 0.009878
515500 -- (-759.227) (-754.111) [-756.466] (-753.795) * (-754.517) (-754.671) (-756.464) [-755.500] -- 0:00:29
516000 -- [-757.565] (-755.191) (-754.653) (-754.399) * (-758.443) (-755.494) [-757.644] (-756.144) -- 0:00:29
516500 -- (-755.770) (-756.355) [-756.545] (-756.459) * (-755.088) (-756.117) [-754.922] (-755.613) -- 0:00:29
517000 -- [-755.978] (-755.263) (-756.793) (-754.357) * [-758.127] (-757.189) (-756.534) (-754.218) -- 0:00:28
517500 -- (-754.817) (-760.608) [-759.052] (-757.038) * [-759.746] (-757.305) (-756.188) (-754.218) -- 0:00:28
518000 -- [-755.427] (-757.872) (-760.937) (-758.717) * (-760.272) (-755.787) (-755.678) [-753.956] -- 0:00:28
518500 -- (-759.319) (-755.651) [-757.901] (-755.513) * (-757.493) (-755.742) [-755.433] (-754.659) -- 0:00:28
519000 -- (-756.146) [-759.121] (-754.374) (-756.743) * [-754.537] (-755.249) (-755.687) (-754.863) -- 0:00:28
519500 -- (-754.649) (-760.186) [-756.535] (-757.412) * [-754.768] (-756.295) (-755.143) (-757.781) -- 0:00:28
520000 -- (-757.582) [-755.815] (-759.586) (-756.781) * (-756.785) [-757.448] (-755.247) (-756.832) -- 0:00:28
Average standard deviation of split frequencies: 0.010744
520500 -- (-756.369) (-758.142) [-757.818] (-758.762) * (-757.460) (-755.265) (-754.824) [-754.931] -- 0:00:28
521000 -- (-754.224) [-755.912] (-758.283) (-756.195) * (-757.215) (-756.055) [-754.706] (-755.059) -- 0:00:28
521500 -- (-755.525) (-755.904) [-758.891] (-757.198) * (-761.183) [-756.016] (-756.760) (-754.435) -- 0:00:28
522000 -- (-755.501) (-758.298) [-754.821] (-756.806) * (-759.737) [-755.107] (-759.521) (-753.773) -- 0:00:28
522500 -- [-758.279] (-755.996) (-754.955) (-755.421) * (-759.249) [-755.632] (-756.778) (-756.108) -- 0:00:28
523000 -- (-760.551) (-756.106) [-756.464] (-755.600) * (-754.996) (-755.070) (-754.890) [-755.110] -- 0:00:28
523500 -- (-756.334) (-757.494) (-757.453) [-755.221] * (-755.232) [-760.400] (-755.661) (-754.065) -- 0:00:28
524000 -- (-754.607) (-758.010) [-759.137] (-753.938) * [-754.388] (-756.955) (-758.729) (-756.560) -- 0:00:28
524500 -- (-754.945) (-756.257) (-759.538) [-754.704] * (-757.936) [-756.758] (-759.678) (-758.217) -- 0:00:28
525000 -- [-754.574] (-757.465) (-757.162) (-756.643) * (-754.764) [-756.804] (-757.989) (-755.656) -- 0:00:28
Average standard deviation of split frequencies: 0.010814
525500 -- (-754.926) (-757.294) [-754.515] (-756.897) * (-757.550) [-758.639] (-756.233) (-753.931) -- 0:00:27
526000 -- (-756.127) (-758.547) (-754.714) [-756.761] * (-754.684) (-757.014) (-757.037) [-755.288] -- 0:00:27
526500 -- (-755.553) [-757.460] (-759.966) (-755.932) * (-754.871) [-757.490] (-754.108) (-755.817) -- 0:00:27
527000 -- (-757.448) [-755.663] (-759.859) (-755.202) * (-754.253) (-762.525) [-754.822] (-754.376) -- 0:00:27
527500 -- (-757.890) (-759.428) (-763.969) [-754.004] * (-758.286) (-756.452) [-756.396] (-755.581) -- 0:00:27
528000 -- (-760.321) [-757.287] (-759.486) (-754.471) * (-755.540) (-755.387) [-754.953] (-757.464) -- 0:00:27
528500 -- (-757.163) [-755.041] (-755.970) (-754.923) * (-757.012) [-756.257] (-754.380) (-756.868) -- 0:00:28
529000 -- [-755.534] (-756.478) (-758.305) (-754.705) * (-754.865) (-754.836) (-754.966) [-753.661] -- 0:00:28
529500 -- (-755.193) (-755.803) (-758.471) [-754.905] * (-754.198) [-755.384] (-754.966) (-755.990) -- 0:00:28
530000 -- (-756.397) [-757.972] (-757.135) (-754.874) * (-754.625) [-756.693] (-756.223) (-756.276) -- 0:00:28
Average standard deviation of split frequencies: 0.011371
530500 -- [-756.103] (-755.061) (-754.334) (-757.445) * (-754.791) (-760.381) (-753.881) [-754.995] -- 0:00:28
531000 -- (-756.526) (-755.138) (-756.258) [-758.397] * (-756.780) [-756.022] (-757.011) (-755.506) -- 0:00:28
531500 -- (-755.053) (-754.924) [-756.457] (-758.830) * (-755.140) [-756.317] (-756.958) (-756.141) -- 0:00:28
532000 -- (-755.723) (-755.599) (-755.374) [-754.405] * (-754.894) (-754.963) (-760.866) [-757.570] -- 0:00:28
532500 -- [-757.874] (-755.531) (-754.348) (-756.434) * (-754.843) (-756.089) [-754.686] (-754.627) -- 0:00:28
533000 -- (-756.636) (-762.586) (-754.305) [-756.606] * (-755.648) (-754.582) (-756.433) [-754.781] -- 0:00:28
533500 -- [-756.311] (-756.148) (-754.424) (-760.799) * (-757.396) (-756.801) [-756.491] (-756.967) -- 0:00:27
534000 -- [-758.811] (-760.774) (-755.903) (-757.182) * [-755.322] (-759.892) (-755.366) (-763.160) -- 0:00:27
534500 -- [-760.799] (-760.325) (-757.653) (-755.168) * (-755.525) (-757.120) [-754.248] (-756.208) -- 0:00:27
535000 -- (-755.814) (-757.354) [-758.756] (-755.140) * (-754.851) (-756.273) (-754.453) [-756.238] -- 0:00:27
Average standard deviation of split frequencies: 0.011082
535500 -- (-755.278) (-756.455) (-757.798) [-754.317] * [-756.088] (-758.463) (-759.004) (-754.361) -- 0:00:27
536000 -- [-754.957] (-759.467) (-754.364) (-754.739) * [-755.690] (-755.505) (-755.734) (-761.716) -- 0:00:27
536500 -- (-755.005) (-756.381) [-755.563] (-755.298) * (-757.018) (-755.466) [-754.135] (-757.859) -- 0:00:27
537000 -- (-756.861) [-754.987] (-757.423) (-755.246) * (-758.482) (-754.091) (-762.498) [-758.140] -- 0:00:27
537500 -- (-755.475) (-757.010) (-761.139) [-754.827] * [-757.245] (-756.814) (-754.974) (-758.497) -- 0:00:27
538000 -- (-754.520) (-757.051) [-758.745] (-755.156) * (-755.427) (-757.364) [-755.147] (-760.627) -- 0:00:27
538500 -- (-754.249) [-755.924] (-758.429) (-754.046) * (-755.112) [-755.560] (-755.966) (-758.068) -- 0:00:27
539000 -- [-754.285] (-754.979) (-756.605) (-756.142) * (-754.295) (-754.150) (-760.442) [-756.879] -- 0:00:27
539500 -- (-754.255) [-757.591] (-754.702) (-756.510) * (-756.183) (-755.677) [-758.325] (-757.219) -- 0:00:27
540000 -- (-754.484) (-755.984) (-755.385) [-756.101] * (-754.372) [-756.414] (-755.027) (-754.530) -- 0:00:27
Average standard deviation of split frequencies: 0.010811
540500 -- (-756.671) [-757.160] (-754.622) (-756.165) * (-754.342) (-754.120) (-756.224) [-754.791] -- 0:00:27
541000 -- (-758.015) (-756.325) [-755.250] (-755.533) * [-754.127] (-756.795) (-755.117) (-756.393) -- 0:00:27
541500 -- (-759.580) (-758.168) [-759.447] (-755.171) * (-756.294) (-754.968) (-757.541) [-755.791] -- 0:00:27
542000 -- (-755.219) (-754.201) [-754.852] (-753.945) * (-755.164) (-757.650) (-756.399) [-757.930] -- 0:00:27
542500 -- (-755.125) (-757.932) [-756.078] (-753.975) * [-755.276] (-756.255) (-757.105) (-755.534) -- 0:00:26
543000 -- (-755.091) [-756.276] (-755.810) (-754.774) * (-757.883) (-755.474) [-754.681] (-755.961) -- 0:00:26
543500 -- [-756.089] (-754.241) (-755.103) (-755.943) * (-760.079) (-755.552) [-755.855] (-755.315) -- 0:00:26
544000 -- [-755.115] (-759.507) (-759.196) (-757.194) * (-755.926) (-758.830) (-756.622) [-756.303] -- 0:00:26
544500 -- (-759.554) (-753.857) (-756.224) [-755.528] * (-756.712) [-758.702] (-755.869) (-753.964) -- 0:00:26
545000 -- (-758.695) [-754.033] (-754.478) (-754.666) * (-754.540) (-757.369) (-757.927) [-756.473] -- 0:00:26
Average standard deviation of split frequencies: 0.010476
545500 -- (-755.975) (-755.806) [-755.392] (-754.511) * (-755.476) [-757.599] (-760.709) (-754.450) -- 0:00:27
546000 -- (-754.220) (-753.791) [-754.053] (-757.280) * [-754.162] (-759.156) (-760.511) (-755.259) -- 0:00:27
546500 -- (-754.707) [-753.889] (-756.848) (-754.303) * (-758.922) [-757.683] (-755.757) (-756.876) -- 0:00:27
547000 -- (-753.674) [-754.924] (-756.408) (-754.669) * (-754.957) [-755.140] (-755.347) (-755.341) -- 0:00:27
547500 -- (-756.673) [-756.581] (-757.358) (-754.709) * (-757.772) [-754.788] (-755.963) (-757.303) -- 0:00:27
548000 -- (-755.205) [-755.614] (-754.798) (-755.313) * (-755.350) [-759.439] (-754.290) (-756.063) -- 0:00:27
548500 -- (-753.694) [-756.714] (-758.001) (-757.357) * (-757.029) (-757.037) (-756.156) [-756.972] -- 0:00:27
549000 -- (-754.238) (-758.430) (-755.320) [-754.939] * [-755.613] (-754.426) (-756.730) (-756.625) -- 0:00:27
549500 -- (-755.959) [-757.918] (-755.892) (-754.938) * (-755.077) (-754.739) (-756.757) [-759.734] -- 0:00:27
550000 -- (-753.955) (-758.792) (-757.461) [-754.337] * (-757.972) (-759.997) (-754.779) [-756.409] -- 0:00:27
Average standard deviation of split frequencies: 0.010615
550500 -- [-754.859] (-756.141) (-755.459) (-754.440) * [-761.268] (-760.689) (-757.685) (-754.650) -- 0:00:26
551000 -- [-754.917] (-757.545) (-756.262) (-754.963) * [-754.533] (-760.625) (-756.797) (-754.462) -- 0:00:26
551500 -- [-756.786] (-758.060) (-754.076) (-760.954) * (-756.506) (-754.886) (-755.383) [-754.909] -- 0:00:26
552000 -- (-758.263) (-757.523) (-756.867) [-758.774] * (-756.069) (-755.505) (-757.817) [-755.743] -- 0:00:26
552500 -- (-756.291) (-757.719) [-753.911] (-756.325) * [-755.263] (-760.228) (-759.541) (-758.502) -- 0:00:26
553000 -- (-757.359) (-760.543) [-755.246] (-759.856) * [-757.163] (-755.069) (-755.926) (-755.541) -- 0:00:26
553500 -- (-754.776) (-756.647) (-754.915) [-753.980] * (-758.271) (-756.652) [-756.537] (-755.778) -- 0:00:26
554000 -- [-756.820] (-758.743) (-755.222) (-755.537) * [-756.223] (-755.321) (-756.955) (-756.760) -- 0:00:26
554500 -- (-756.368) [-756.460] (-756.254) (-756.554) * (-757.225) [-759.928] (-761.285) (-755.116) -- 0:00:26
555000 -- (-760.905) (-760.060) (-754.593) [-759.199] * (-761.907) (-757.862) (-757.549) [-756.321] -- 0:00:26
Average standard deviation of split frequencies: 0.011135
555500 -- (-757.557) (-757.981) (-754.556) [-757.276] * (-758.076) (-761.800) [-754.124] (-756.824) -- 0:00:26
556000 -- (-760.617) (-754.664) [-755.513] (-756.622) * (-762.305) [-756.304] (-756.535) (-755.304) -- 0:00:26
556500 -- [-754.768] (-757.984) (-757.617) (-754.895) * (-758.367) (-755.008) [-755.907] (-755.433) -- 0:00:26
557000 -- (-755.628) (-757.038) (-760.915) [-757.524] * [-753.670] (-755.996) (-758.271) (-755.500) -- 0:00:26
557500 -- [-754.156] (-755.384) (-757.997) (-757.975) * [-756.506] (-758.536) (-754.784) (-756.540) -- 0:00:26
558000 -- (-753.852) (-754.034) (-757.842) [-755.506] * (-755.751) [-757.949] (-757.766) (-755.214) -- 0:00:26
558500 -- (-758.845) (-756.001) [-755.405] (-756.154) * (-758.910) [-755.548] (-755.420) (-755.261) -- 0:00:26
559000 -- (-760.398) (-757.588) (-756.485) [-755.763] * [-754.349] (-756.469) (-755.242) (-755.305) -- 0:00:26
559500 -- (-755.052) [-756.631] (-755.486) (-755.951) * [-756.439] (-756.715) (-755.356) (-755.191) -- 0:00:25
560000 -- (-755.194) (-756.132) [-755.496] (-757.299) * (-758.235) [-755.968] (-758.101) (-757.774) -- 0:00:25
Average standard deviation of split frequencies: 0.011379
560500 -- (-755.383) (-756.550) (-754.139) [-754.351] * (-756.886) (-755.328) [-757.096] (-755.024) -- 0:00:25
561000 -- (-761.825) [-757.812] (-757.761) (-758.790) * [-755.740] (-754.649) (-754.560) (-756.022) -- 0:00:25
561500 -- (-756.614) (-760.675) (-755.489) [-755.458] * (-755.638) (-759.544) (-756.551) [-755.906] -- 0:00:25
562000 -- (-757.394) (-757.551) [-755.300] (-757.328) * [-754.535] (-757.382) (-755.112) (-755.923) -- 0:00:26
562500 -- (-758.824) (-754.507) (-756.925) [-754.471] * (-757.271) (-754.674) [-755.731] (-755.169) -- 0:00:26
563000 -- (-757.804) (-757.934) (-758.474) [-754.798] * (-757.801) (-761.521) [-757.794] (-755.440) -- 0:00:26
563500 -- (-756.107) (-758.057) (-758.257) [-754.759] * [-756.621] (-756.115) (-757.301) (-755.851) -- 0:00:26
564000 -- (-756.697) (-754.628) [-756.444] (-754.495) * [-754.428] (-756.004) (-757.382) (-755.445) -- 0:00:26
564500 -- (-756.057) (-756.438) [-757.438] (-756.349) * (-755.487) [-756.205] (-755.633) (-758.755) -- 0:00:26
565000 -- [-755.635] (-756.388) (-756.183) (-755.310) * (-760.065) (-757.443) [-754.317] (-754.495) -- 0:00:26
Average standard deviation of split frequencies: 0.011244
565500 -- [-754.705] (-754.709) (-756.458) (-756.283) * [-759.107] (-756.089) (-757.326) (-759.567) -- 0:00:26
566000 -- (-755.228) (-756.502) (-756.530) [-757.650] * [-760.052] (-755.398) (-758.635) (-755.079) -- 0:00:26
566500 -- (-757.707) (-759.435) (-754.505) [-755.613] * [-755.901] (-756.199) (-755.568) (-755.197) -- 0:00:26
567000 -- (-758.305) (-755.634) (-757.562) [-757.023] * (-761.020) (-755.441) (-757.145) [-757.680] -- 0:00:25
567500 -- (-757.135) [-753.787] (-755.526) (-757.123) * (-757.922) [-755.548] (-754.232) (-758.298) -- 0:00:25
568000 -- (-754.940) (-755.475) [-754.394] (-760.331) * (-755.450) (-757.647) [-757.919] (-755.236) -- 0:00:25
568500 -- (-754.453) (-760.586) [-754.655] (-756.291) * (-753.908) [-755.561] (-755.680) (-756.195) -- 0:00:25
569000 -- (-754.490) (-762.832) [-754.728] (-753.956) * (-755.279) (-756.118) (-756.992) [-754.864] -- 0:00:25
569500 -- (-756.403) (-760.199) (-755.740) [-756.134] * (-755.366) [-754.487] (-758.101) (-761.051) -- 0:00:25
570000 -- (-754.999) [-756.211] (-758.920) (-754.910) * (-754.946) [-754.559] (-757.533) (-761.101) -- 0:00:25
Average standard deviation of split frequencies: 0.012171
570500 -- (-756.597) (-755.947) (-754.613) [-757.764] * (-754.896) (-755.808) (-757.555) [-755.871] -- 0:00:25
571000 -- (-757.271) (-758.074) (-753.805) [-757.801] * (-754.322) [-757.703] (-756.644) (-758.121) -- 0:00:25
571500 -- (-755.757) (-754.851) [-754.689] (-757.621) * [-755.738] (-756.839) (-758.491) (-754.979) -- 0:00:25
572000 -- (-754.692) (-762.048) [-755.823] (-755.501) * (-756.524) [-755.567] (-755.274) (-757.032) -- 0:00:25
572500 -- (-756.933) (-755.109) (-755.534) [-757.047] * [-756.849] (-756.037) (-757.649) (-759.834) -- 0:00:25
573000 -- (-755.685) (-753.975) (-758.149) [-754.953] * (-755.815) [-758.746] (-760.399) (-757.714) -- 0:00:25
573500 -- (-754.925) [-756.121] (-755.207) (-759.161) * (-754.959) (-756.933) [-758.302] (-755.811) -- 0:00:25
574000 -- (-758.755) [-756.556] (-759.549) (-760.900) * (-755.137) (-761.294) (-754.164) [-754.421] -- 0:00:25
574500 -- (-759.655) [-755.729] (-755.404) (-769.506) * (-755.750) (-754.405) (-754.142) [-754.958] -- 0:00:25
575000 -- (-761.250) [-755.667] (-758.557) (-761.324) * (-755.743) [-754.931] (-757.607) (-756.701) -- 0:00:25
Average standard deviation of split frequencies: 0.011185
575500 -- (-755.486) (-754.721) [-758.263] (-755.124) * [-754.247] (-754.776) (-757.191) (-755.111) -- 0:00:25
576000 -- (-759.579) (-756.522) [-754.015] (-758.851) * [-756.072] (-755.136) (-756.010) (-754.994) -- 0:00:25
576500 -- (-756.353) (-754.348) (-758.524) [-754.590] * (-757.180) [-757.823] (-762.247) (-755.885) -- 0:00:24
577000 -- [-758.216] (-754.254) (-757.006) (-754.417) * (-756.350) (-758.407) (-754.280) [-755.390] -- 0:00:24
577500 -- (-754.545) (-755.273) (-754.703) [-754.461] * (-757.034) [-756.335] (-754.390) (-756.875) -- 0:00:24
578000 -- (-755.630) (-754.825) (-755.300) [-756.612] * (-755.749) (-756.989) [-754.660] (-756.157) -- 0:00:24
578500 -- (-761.068) (-755.697) [-755.363] (-759.016) * [-758.173] (-759.861) (-755.127) (-756.944) -- 0:00:24
579000 -- [-755.378] (-754.261) (-755.470) (-755.605) * (-755.699) (-755.972) (-755.762) [-755.065] -- 0:00:25
579500 -- (-761.193) (-754.268) (-753.710) [-756.109] * (-753.943) (-754.938) (-754.768) [-756.478] -- 0:00:25
580000 -- (-755.013) (-754.399) [-755.223] (-756.921) * (-759.482) (-757.906) [-754.099] (-755.791) -- 0:00:25
Average standard deviation of split frequencies: 0.011041
580500 -- (-757.313) (-754.563) [-753.816] (-756.642) * (-758.395) [-754.142] (-755.301) (-754.715) -- 0:00:25
581000 -- (-757.008) (-753.672) [-754.364] (-754.446) * (-755.028) [-754.551] (-755.385) (-755.517) -- 0:00:25
581500 -- (-755.971) (-760.526) (-755.745) [-754.848] * (-757.148) (-755.782) [-755.147] (-756.293) -- 0:00:25
582000 -- (-757.890) [-756.345] (-757.641) (-755.111) * [-755.589] (-757.527) (-757.985) (-759.262) -- 0:00:25
582500 -- (-756.792) (-754.262) [-756.362] (-760.645) * [-758.145] (-755.945) (-756.365) (-757.618) -- 0:00:25
583000 -- (-756.579) [-754.888] (-754.205) (-756.166) * [-759.394] (-756.395) (-759.616) (-755.778) -- 0:00:25
583500 -- (-757.576) (-753.860) [-755.278] (-755.352) * [-764.226] (-759.421) (-760.890) (-755.890) -- 0:00:24
584000 -- (-761.025) [-756.877] (-760.622) (-755.655) * [-754.807] (-755.108) (-757.477) (-756.531) -- 0:00:24
584500 -- (-760.055) (-760.258) (-757.851) [-757.132] * (-754.983) [-756.291] (-755.875) (-754.929) -- 0:00:24
585000 -- (-756.101) (-760.671) [-755.944] (-757.247) * (-756.725) (-753.580) [-755.352] (-756.051) -- 0:00:24
Average standard deviation of split frequencies: 0.010887
585500 -- [-760.304] (-759.536) (-754.813) (-755.707) * [-756.669] (-753.719) (-757.448) (-756.775) -- 0:00:24
586000 -- (-759.488) [-757.908] (-755.235) (-755.144) * (-755.868) (-755.871) [-757.764] (-758.281) -- 0:00:24
586500 -- (-756.002) (-757.293) (-755.527) [-755.932] * (-757.396) (-756.215) (-755.024) [-756.439] -- 0:00:24
587000 -- (-754.053) [-755.446] (-755.176) (-754.070) * (-755.497) (-756.414) [-755.673] (-758.324) -- 0:00:24
587500 -- (-754.258) (-755.315) (-754.780) [-753.733] * (-756.659) [-757.040] (-755.304) (-754.281) -- 0:00:24
588000 -- (-756.338) (-754.552) (-755.143) [-755.306] * [-757.677] (-757.204) (-755.954) (-758.880) -- 0:00:24
588500 -- (-756.823) (-754.989) [-754.756] (-755.666) * (-754.810) (-755.414) [-755.947] (-756.999) -- 0:00:24
589000 -- [-755.069] (-755.806) (-756.066) (-755.639) * (-755.879) (-755.230) (-754.516) [-755.474] -- 0:00:24
589500 -- (-755.607) (-757.290) (-754.539) [-759.358] * (-755.497) (-755.103) (-754.253) [-756.664] -- 0:00:24
590000 -- (-756.959) (-754.857) (-760.699) [-756.425] * (-758.054) [-756.616] (-755.055) (-757.525) -- 0:00:24
Average standard deviation of split frequencies: 0.009790
590500 -- (-758.556) [-754.862] (-757.310) (-755.741) * (-756.133) (-755.700) [-757.794] (-757.080) -- 0:00:24
591000 -- (-756.039) [-759.375] (-757.191) (-755.950) * [-755.514] (-754.055) (-756.177) (-755.518) -- 0:00:24
591500 -- (-754.972) [-754.645] (-756.003) (-756.197) * (-761.767) (-755.487) [-754.780] (-755.476) -- 0:00:24
592000 -- (-758.378) (-753.980) (-756.162) [-759.006] * (-759.429) (-756.444) (-756.599) [-754.850] -- 0:00:24
592500 -- (-757.088) (-755.163) (-754.752) [-757.624] * (-760.635) (-756.055) [-753.994] (-757.421) -- 0:00:24
593000 -- (-759.230) (-757.243) (-754.884) [-754.604] * [-754.386] (-756.044) (-755.749) (-755.082) -- 0:00:24
593500 -- (-754.247) (-755.680) [-755.000] (-755.331) * (-754.981) (-756.562) [-760.866] (-760.378) -- 0:00:23
594000 -- (-754.941) (-756.435) [-754.645] (-755.347) * (-754.059) (-755.551) [-758.173] (-763.454) -- 0:00:23
594500 -- (-755.919) (-757.745) (-754.187) [-756.168] * (-754.675) (-757.665) [-757.505] (-764.719) -- 0:00:23
595000 -- (-759.335) (-757.700) [-755.265] (-756.254) * [-760.155] (-761.999) (-757.163) (-761.066) -- 0:00:23
Average standard deviation of split frequencies: 0.010388
595500 -- (-756.619) [-759.295] (-755.314) (-755.030) * [-758.404] (-755.943) (-755.177) (-756.465) -- 0:00:24
596000 -- [-754.167] (-756.368) (-755.063) (-758.203) * (-755.778) (-759.227) [-759.321] (-755.430) -- 0:00:24
596500 -- (-754.765) [-755.232] (-760.026) (-755.755) * (-756.197) (-756.276) [-754.979] (-755.569) -- 0:00:24
597000 -- (-755.590) (-756.373) [-757.769] (-756.699) * (-755.544) [-754.511] (-755.223) (-757.856) -- 0:00:24
597500 -- (-756.809) (-754.706) (-758.021) [-757.214] * [-756.359] (-755.262) (-755.533) (-754.839) -- 0:00:24
598000 -- (-755.566) (-755.048) [-758.528] (-757.320) * (-754.809) [-754.815] (-754.718) (-755.097) -- 0:00:24
598500 -- [-755.697] (-756.977) (-757.054) (-758.922) * (-759.163) (-754.542) [-756.107] (-757.497) -- 0:00:24
599000 -- (-757.334) (-759.265) [-757.095] (-757.960) * (-764.485) [-756.480] (-755.723) (-756.379) -- 0:00:24
599500 -- (-754.191) (-759.710) [-755.314] (-756.397) * (-756.103) (-755.341) (-757.131) [-755.478] -- 0:00:24
600000 -- (-755.428) [-755.037] (-754.597) (-754.894) * (-757.398) [-758.955] (-755.830) (-757.635) -- 0:00:24
Average standard deviation of split frequencies: 0.010150
600500 -- (-755.203) [-756.368] (-754.536) (-754.043) * (-755.279) (-756.830) (-754.423) [-758.747] -- 0:00:23
601000 -- [-756.335] (-756.001) (-758.517) (-762.116) * (-761.310) (-755.304) [-754.356] (-755.630) -- 0:00:23
601500 -- (-757.052) (-755.613) (-758.320) [-760.247] * [-754.455] (-754.941) (-754.347) (-755.432) -- 0:00:23
602000 -- (-756.188) (-755.432) [-755.793] (-757.732) * [-757.655] (-754.323) (-756.905) (-754.311) -- 0:00:23
602500 -- (-756.705) (-754.628) [-756.286] (-756.522) * [-757.862] (-756.046) (-757.998) (-756.286) -- 0:00:23
603000 -- (-758.746) (-756.300) [-760.461] (-758.958) * (-755.169) (-756.282) [-757.180] (-754.188) -- 0:00:23
603500 -- [-754.463] (-755.561) (-754.379) (-758.506) * [-758.213] (-754.424) (-760.599) (-758.195) -- 0:00:23
604000 -- (-757.219) (-756.791) (-754.204) [-755.533] * (-756.318) (-755.216) [-756.604] (-755.430) -- 0:00:23
604500 -- (-757.602) (-759.556) [-754.399] (-757.641) * (-754.859) (-757.714) [-755.819] (-754.590) -- 0:00:23
605000 -- [-758.006] (-755.602) (-757.972) (-754.532) * [-757.198] (-753.983) (-755.778) (-758.794) -- 0:00:23
Average standard deviation of split frequencies: 0.010424
605500 -- (-755.283) (-756.567) [-755.183] (-754.777) * (-755.898) (-756.279) [-756.187] (-773.898) -- 0:00:23
606000 -- [-754.131] (-758.774) (-759.983) (-756.322) * (-756.942) (-757.126) [-755.152] (-756.095) -- 0:00:23
606500 -- [-757.693] (-754.413) (-758.330) (-757.128) * (-757.801) (-755.890) (-755.685) [-756.075] -- 0:00:23
607000 -- [-755.484] (-754.804) (-756.963) (-755.334) * (-757.376) (-757.029) (-755.303) [-755.185] -- 0:00:23
607500 -- (-755.731) [-758.311] (-754.697) (-757.604) * (-757.866) (-755.433) [-756.240] (-754.753) -- 0:00:23
608000 -- (-756.684) (-758.502) (-754.829) [-755.312] * (-758.191) (-755.221) (-755.196) [-754.514] -- 0:00:23
608500 -- (-755.913) [-758.307] (-755.391) (-756.216) * (-755.279) (-755.999) [-756.772] (-756.963) -- 0:00:23
609000 -- (-754.757) [-757.182] (-753.665) (-762.180) * (-756.160) (-760.484) [-755.103] (-756.891) -- 0:00:23
609500 -- [-755.192] (-754.623) (-760.682) (-757.304) * (-754.233) (-755.629) (-754.079) [-755.128] -- 0:00:23
610000 -- (-755.412) [-757.472] (-757.193) (-756.561) * [-755.929] (-755.432) (-753.648) (-756.020) -- 0:00:23
Average standard deviation of split frequencies: 0.010447
610500 -- [-756.135] (-757.297) (-758.024) (-757.040) * [-758.609] (-755.423) (-759.270) (-755.419) -- 0:00:22
611000 -- [-756.042] (-756.869) (-760.256) (-756.129) * (-763.491) (-760.299) (-756.075) [-759.390] -- 0:00:22
611500 -- [-755.487] (-758.551) (-760.710) (-756.615) * [-755.003] (-755.363) (-754.370) (-757.598) -- 0:00:22
612000 -- (-755.360) (-756.704) (-757.202) [-755.202] * [-754.742] (-755.034) (-760.071) (-755.275) -- 0:00:22
612500 -- (-754.726) (-756.573) (-755.509) [-757.245] * (-754.599) (-757.512) (-763.597) [-756.042] -- 0:00:23
613000 -- (-757.737) (-756.143) [-755.555] (-754.491) * (-756.079) (-755.392) (-755.467) [-753.634] -- 0:00:23
613500 -- (-759.003) (-756.865) [-756.108] (-754.357) * (-755.045) (-754.825) (-755.666) [-754.787] -- 0:00:23
614000 -- (-755.395) (-754.127) [-757.193] (-756.976) * (-755.712) (-755.767) [-755.187] (-755.474) -- 0:00:23
614500 -- [-756.385] (-758.051) (-759.785) (-755.244) * [-755.614] (-756.060) (-759.373) (-755.391) -- 0:00:23
615000 -- [-757.047] (-755.776) (-758.766) (-756.190) * (-754.133) (-757.969) (-753.717) [-755.944] -- 0:00:23
Average standard deviation of split frequencies: 0.010255
615500 -- [-755.550] (-755.300) (-755.943) (-757.154) * [-754.262] (-758.102) (-755.630) (-756.376) -- 0:00:23
616000 -- (-756.509) (-754.552) (-755.377) [-756.413] * (-756.435) (-761.157) (-754.242) [-754.890] -- 0:00:23
616500 -- (-759.866) [-754.919] (-757.228) (-762.288) * (-754.074) (-757.936) [-755.181] (-757.869) -- 0:00:23
617000 -- [-758.320] (-754.475) (-758.267) (-757.831) * (-756.692) [-754.791] (-757.201) (-759.686) -- 0:00:22
617500 -- (-756.294) [-754.366] (-755.416) (-755.414) * (-756.548) (-754.303) (-758.297) [-754.210] -- 0:00:22
618000 -- (-754.594) [-755.918] (-754.640) (-756.463) * (-755.287) (-754.324) (-757.225) [-754.271] -- 0:00:22
618500 -- (-755.680) [-754.615] (-754.844) (-756.446) * (-755.463) [-754.492] (-755.756) (-754.101) -- 0:00:22
619000 -- (-759.980) (-756.574) [-758.691] (-755.192) * (-756.899) (-754.544) [-756.363] (-757.891) -- 0:00:22
619500 -- (-755.027) [-757.351] (-758.875) (-755.421) * (-757.770) (-755.658) (-758.031) [-755.350] -- 0:00:22
620000 -- (-755.664) (-754.855) [-756.720] (-754.348) * [-755.852] (-757.080) (-756.264) (-756.536) -- 0:00:22
Average standard deviation of split frequencies: 0.010481
620500 -- [-756.829] (-756.641) (-756.720) (-755.068) * (-755.834) (-755.786) (-756.159) [-756.772] -- 0:00:22
621000 -- (-758.090) (-758.495) (-755.306) [-755.917] * (-760.191) (-755.350) (-756.871) [-755.330] -- 0:00:22
621500 -- (-755.343) [-757.849] (-755.869) (-757.280) * (-759.788) [-757.576] (-758.205) (-755.238) -- 0:00:22
622000 -- (-755.713) (-755.201) (-756.202) [-754.363] * (-755.872) (-756.634) (-756.352) [-756.023] -- 0:00:22
622500 -- (-757.356) (-757.317) (-754.573) [-756.177] * (-759.183) (-756.026) (-754.360) [-760.150] -- 0:00:22
623000 -- (-755.034) (-755.863) (-757.189) [-755.655] * (-755.955) (-755.654) [-754.493] (-759.600) -- 0:00:22
623500 -- [-756.286] (-754.259) (-756.177) (-760.364) * (-757.600) [-758.862] (-757.821) (-757.962) -- 0:00:22
624000 -- (-755.679) (-756.887) (-754.854) [-754.719] * (-755.297) (-759.711) [-759.881] (-756.690) -- 0:00:22
624500 -- (-758.224) (-756.541) (-756.639) [-755.439] * (-755.649) [-756.659] (-755.458) (-757.117) -- 0:00:22
625000 -- [-755.378] (-757.941) (-754.371) (-755.773) * (-758.187) [-755.289] (-756.650) (-758.914) -- 0:00:22
Average standard deviation of split frequencies: 0.010693
625500 -- [-755.600] (-755.495) (-756.324) (-754.831) * (-755.379) (-756.367) [-754.009] (-756.157) -- 0:00:22
626000 -- (-755.797) [-755.055] (-755.863) (-755.867) * [-755.488] (-755.261) (-757.079) (-755.686) -- 0:00:22
626500 -- (-755.891) (-756.355) (-754.022) [-755.632] * (-756.559) (-755.003) [-757.452] (-756.154) -- 0:00:22
627000 -- (-755.258) [-755.207] (-755.568) (-754.688) * (-758.702) [-754.612] (-754.077) (-755.386) -- 0:00:22
627500 -- (-757.675) (-754.985) [-757.128] (-761.026) * [-756.613] (-754.590) (-759.948) (-755.557) -- 0:00:21
628000 -- (-757.932) [-754.883] (-756.063) (-757.814) * (-756.699) [-757.147] (-755.392) (-756.650) -- 0:00:21
628500 -- (-762.430) (-758.789) [-756.545] (-759.883) * (-764.812) [-754.330] (-755.235) (-757.958) -- 0:00:21
629000 -- (-762.143) [-756.077] (-759.387) (-761.559) * (-755.122) [-759.562] (-755.910) (-757.001) -- 0:00:22
629500 -- (-758.295) (-757.575) (-753.818) [-755.455] * [-757.424] (-761.453) (-760.720) (-758.847) -- 0:00:22
630000 -- (-756.415) [-756.269] (-759.795) (-754.649) * (-758.443) (-755.882) (-757.637) [-755.231] -- 0:00:22
Average standard deviation of split frequencies: 0.011212
630500 -- (-758.329) (-755.232) [-754.923] (-754.931) * (-762.249) [-754.343] (-757.995) (-757.063) -- 0:00:22
631000 -- (-758.154) (-755.230) [-755.474] (-754.902) * (-754.921) (-755.115) (-756.231) [-754.767] -- 0:00:22
631500 -- (-755.689) (-755.804) [-755.627] (-758.964) * [-755.243] (-755.525) (-757.781) (-755.232) -- 0:00:22
632000 -- (-756.668) (-755.883) [-757.245] (-755.266) * (-758.916) (-755.100) (-759.856) [-756.783] -- 0:00:22
632500 -- (-757.920) (-754.151) (-755.367) [-755.803] * (-754.900) (-760.491) [-754.815] (-758.370) -- 0:00:22
633000 -- (-756.634) [-754.872] (-756.640) (-754.872) * [-754.853] (-759.406) (-754.642) (-754.096) -- 0:00:22
633500 -- (-754.979) (-755.274) (-757.318) [-756.719] * [-754.401] (-755.252) (-755.158) (-757.923) -- 0:00:21
634000 -- (-754.782) (-755.146) [-755.915] (-756.144) * [-756.303] (-754.042) (-754.294) (-758.133) -- 0:00:21
634500 -- (-756.810) (-760.429) [-757.328] (-755.502) * (-763.591) (-754.152) (-758.127) [-755.222] -- 0:00:21
635000 -- (-756.019) [-760.279] (-758.075) (-755.632) * (-757.920) (-756.305) [-755.970] (-755.804) -- 0:00:21
Average standard deviation of split frequencies: 0.011760
635500 -- (-755.748) (-757.475) [-757.952] (-756.163) * (-756.665) (-758.458) (-757.372) [-754.017] -- 0:00:21
636000 -- (-755.689) [-756.696] (-754.762) (-757.858) * (-757.521) [-755.032] (-761.637) (-758.965) -- 0:00:21
636500 -- (-755.683) (-757.788) (-759.079) [-755.619] * (-754.138) [-754.523] (-759.342) (-758.502) -- 0:00:21
637000 -- [-755.849] (-757.251) (-758.151) (-756.119) * [-758.037] (-756.448) (-756.323) (-754.267) -- 0:00:21
637500 -- (-756.967) [-754.566] (-756.730) (-755.783) * (-757.651) [-755.372] (-754.378) (-754.183) -- 0:00:21
638000 -- [-756.455] (-758.105) (-757.207) (-758.370) * (-757.269) (-754.275) (-755.443) [-754.278] -- 0:00:21
638500 -- [-756.442] (-756.929) (-761.165) (-756.930) * (-757.577) (-754.429) [-756.181] (-755.553) -- 0:00:21
639000 -- (-754.661) (-757.914) [-756.328] (-754.710) * (-759.618) (-754.861) [-755.179] (-758.518) -- 0:00:21
639500 -- (-755.981) (-757.356) (-756.102) [-754.854] * [-755.119] (-754.404) (-756.675) (-755.220) -- 0:00:21
640000 -- (-757.549) (-760.021) [-754.563] (-761.012) * (-757.330) [-755.483] (-755.739) (-756.612) -- 0:00:21
Average standard deviation of split frequencies: 0.012067
640500 -- [-757.365] (-755.326) (-756.618) (-756.660) * (-755.898) [-755.019] (-755.428) (-759.578) -- 0:00:21
641000 -- (-758.917) (-755.229) [-755.566] (-756.719) * [-753.933] (-754.046) (-757.667) (-758.427) -- 0:00:21
641500 -- (-756.519) (-756.199) [-755.469] (-755.016) * (-755.877) [-755.234] (-755.341) (-756.453) -- 0:00:21
642000 -- (-754.966) [-754.998] (-755.720) (-755.415) * (-755.621) (-760.315) (-755.875) [-756.734] -- 0:00:21
642500 -- (-757.726) (-755.055) [-755.696] (-755.127) * [-754.907] (-756.001) (-757.603) (-755.333) -- 0:00:21
643000 -- (-757.104) (-755.393) [-755.024] (-755.931) * [-754.965] (-755.591) (-758.437) (-754.935) -- 0:00:21
643500 -- (-757.430) (-757.019) (-755.066) [-754.861] * (-757.876) (-755.734) (-756.021) [-755.908] -- 0:00:21
644000 -- [-755.507] (-754.792) (-755.682) (-754.997) * (-754.699) (-756.967) (-760.103) [-754.013] -- 0:00:21
644500 -- (-755.080) (-755.008) (-756.749) [-755.973] * [-756.349] (-759.544) (-757.759) (-754.032) -- 0:00:20
645000 -- (-754.728) (-757.029) [-755.699] (-753.879) * (-757.213) (-758.264) (-758.658) [-754.032] -- 0:00:20
Average standard deviation of split frequencies: 0.011773
645500 -- [-755.792] (-754.016) (-757.224) (-755.645) * (-755.355) (-759.431) (-756.492) [-754.061] -- 0:00:20
646000 -- [-755.129] (-755.218) (-758.039) (-754.727) * (-754.542) (-756.428) [-754.562] (-758.825) -- 0:00:21
646500 -- (-754.591) (-753.589) [-754.056] (-755.525) * (-760.011) (-757.582) [-761.023] (-756.314) -- 0:00:21
647000 -- (-754.841) (-754.617) (-754.974) [-755.590] * [-755.013] (-758.672) (-762.544) (-759.059) -- 0:00:21
647500 -- (-755.616) (-755.468) (-756.666) [-756.029] * [-759.013] (-756.213) (-755.792) (-758.306) -- 0:00:21
648000 -- (-755.489) (-755.603) (-754.660) [-758.600] * (-756.754) (-753.986) (-757.505) [-756.730] -- 0:00:21
648500 -- (-756.141) [-757.743] (-758.836) (-761.161) * (-756.809) [-754.943] (-758.065) (-755.947) -- 0:00:21
649000 -- (-757.100) (-757.637) [-756.334] (-757.962) * (-756.425) (-756.924) (-757.338) [-755.477] -- 0:00:21
649500 -- (-756.741) (-755.767) [-756.264] (-755.902) * [-755.634] (-754.995) (-756.639) (-757.513) -- 0:00:21
650000 -- (-755.692) (-757.380) [-755.447] (-756.049) * (-756.312) (-757.264) [-756.302] (-754.769) -- 0:00:21
Average standard deviation of split frequencies: 0.011882
650500 -- (-754.172) (-757.033) (-754.954) [-755.615] * (-756.324) (-756.277) [-756.154] (-755.945) -- 0:00:20
651000 -- (-753.946) (-760.671) [-753.936] (-756.203) * [-756.076] (-755.995) (-755.943) (-757.919) -- 0:00:20
651500 -- (-754.058) [-757.353] (-757.316) (-754.296) * (-755.657) [-755.081] (-756.509) (-755.825) -- 0:00:20
652000 -- (-756.715) (-755.037) (-756.920) [-755.072] * [-754.557] (-755.974) (-754.103) (-755.323) -- 0:00:20
652500 -- (-755.983) (-756.435) (-757.382) [-754.258] * (-757.374) [-754.970] (-754.845) (-756.429) -- 0:00:20
653000 -- [-754.373] (-757.979) (-757.917) (-753.971) * (-756.120) [-755.883] (-759.769) (-756.350) -- 0:00:20
653500 -- [-755.815] (-755.612) (-758.376) (-754.283) * [-754.646] (-754.653) (-755.535) (-756.415) -- 0:00:20
654000 -- (-757.773) (-758.250) (-758.964) [-753.712] * (-755.895) (-757.914) (-754.757) [-756.780] -- 0:00:20
654500 -- (-756.614) (-755.193) (-757.645) [-755.066] * (-755.541) (-754.441) (-756.255) [-755.636] -- 0:00:20
655000 -- (-758.798) (-756.459) (-760.487) [-754.917] * (-759.672) (-757.484) [-759.527] (-754.438) -- 0:00:20
Average standard deviation of split frequencies: 0.012312
655500 -- (-759.408) [-756.186] (-755.380) (-754.379) * (-755.783) [-755.780] (-762.395) (-755.787) -- 0:00:20
656000 -- (-758.411) (-759.663) [-756.901] (-755.396) * [-754.684] (-754.784) (-756.530) (-758.076) -- 0:00:20
656500 -- [-754.496] (-759.246) (-756.923) (-754.543) * [-756.602] (-755.849) (-756.521) (-755.898) -- 0:00:20
657000 -- [-756.065] (-754.581) (-756.889) (-754.132) * (-755.472) (-756.554) (-755.100) [-757.674] -- 0:00:20
657500 -- [-754.512] (-755.181) (-756.824) (-755.484) * [-755.414] (-755.782) (-754.657) (-755.535) -- 0:00:20
658000 -- (-755.336) [-755.616] (-759.614) (-756.370) * [-757.511] (-754.246) (-756.633) (-758.720) -- 0:00:20
658500 -- (-753.992) [-759.181] (-758.242) (-755.451) * (-759.228) (-761.209) (-756.203) [-753.881] -- 0:00:20
659000 -- (-756.301) (-755.843) (-755.485) [-757.174] * (-755.044) (-758.348) (-756.135) [-754.574] -- 0:00:20
659500 -- (-756.407) (-755.349) (-758.528) [-754.808] * [-757.484] (-755.025) (-756.620) (-755.532) -- 0:00:20
660000 -- (-756.544) (-757.650) (-754.671) [-755.443] * (-755.996) (-755.071) [-754.840] (-761.705) -- 0:00:20
Average standard deviation of split frequencies: 0.012606
660500 -- (-756.721) [-755.488] (-754.451) (-756.877) * (-755.688) [-754.770] (-753.908) (-767.193) -- 0:00:20
661000 -- (-755.130) [-755.647] (-755.939) (-756.238) * [-756.029] (-755.785) (-755.141) (-757.476) -- 0:00:20
661500 -- [-754.654] (-756.562) (-755.020) (-756.589) * [-756.760] (-756.667) (-756.134) (-760.494) -- 0:00:19
662000 -- (-754.144) (-754.626) (-758.760) [-759.943] * (-755.801) (-756.349) [-757.232] (-760.106) -- 0:00:19
662500 -- (-754.125) [-755.441] (-754.358) (-756.100) * (-755.563) [-757.479] (-756.115) (-754.489) -- 0:00:19
663000 -- [-755.084] (-755.732) (-754.460) (-754.928) * (-755.710) [-755.722] (-757.867) (-755.831) -- 0:00:20
663500 -- (-760.583) [-756.356] (-753.966) (-756.989) * (-755.814) [-756.742] (-756.397) (-755.983) -- 0:00:20
664000 -- (-755.303) (-756.734) [-753.932] (-756.339) * (-757.319) (-756.768) [-755.928] (-755.587) -- 0:00:20
664500 -- (-758.095) (-756.137) (-755.167) [-755.881] * (-754.775) [-754.045] (-757.926) (-756.251) -- 0:00:20
665000 -- (-755.301) (-756.800) [-754.456] (-755.030) * (-763.222) (-753.871) (-755.416) [-754.209] -- 0:00:20
Average standard deviation of split frequencies: 0.012693
665500 -- (-757.900) (-754.552) (-755.146) [-755.731] * (-755.830) [-755.778] (-757.103) (-757.600) -- 0:00:20
666000 -- [-755.647] (-755.769) (-755.357) (-755.742) * [-758.690] (-755.261) (-757.329) (-763.557) -- 0:00:20
666500 -- (-762.034) (-754.955) [-758.844] (-755.404) * (-754.667) [-756.337] (-757.933) (-756.032) -- 0:00:20
667000 -- (-758.474) [-756.667] (-755.892) (-757.300) * (-755.223) (-755.546) [-756.857] (-754.822) -- 0:00:19
667500 -- (-754.775) [-755.524] (-754.983) (-754.118) * (-754.512) (-761.823) (-759.020) [-756.983] -- 0:00:19
668000 -- [-756.381] (-756.202) (-755.110) (-755.268) * [-754.690] (-759.778) (-757.069) (-756.147) -- 0:00:19
668500 -- (-757.574) [-756.361] (-753.895) (-755.045) * [-754.953] (-757.522) (-757.911) (-754.425) -- 0:00:19
669000 -- (-764.969) [-754.481] (-756.527) (-757.072) * (-756.766) (-756.222) [-755.979] (-756.025) -- 0:00:19
669500 -- (-754.821) (-753.937) (-755.046) [-756.307] * [-754.330] (-755.528) (-757.464) (-756.617) -- 0:00:19
670000 -- [-755.593] (-754.539) (-757.589) (-754.918) * (-754.377) [-753.988] (-762.165) (-757.238) -- 0:00:19
Average standard deviation of split frequencies: 0.012605
670500 -- (-759.148) (-754.318) [-758.421] (-757.095) * (-754.098) [-757.640] (-761.991) (-755.404) -- 0:00:19
671000 -- [-755.172] (-754.070) (-755.192) (-754.151) * [-756.313] (-757.961) (-756.827) (-755.404) -- 0:00:19
671500 -- (-757.314) (-753.810) [-755.104] (-760.486) * [-754.582] (-755.010) (-756.690) (-755.288) -- 0:00:19
672000 -- (-754.783) [-755.686] (-755.565) (-756.239) * (-754.428) (-756.220) (-757.353) [-755.876] -- 0:00:19
672500 -- (-756.361) [-755.485] (-756.343) (-757.799) * (-754.228) (-756.432) [-755.397] (-760.253) -- 0:00:19
673000 -- (-756.431) (-754.543) [-755.851] (-755.152) * (-755.819) (-756.681) [-756.095] (-758.081) -- 0:00:19
673500 -- (-755.059) (-755.930) [-756.324] (-756.043) * (-754.278) (-755.885) (-756.775) [-756.500] -- 0:00:19
674000 -- (-758.442) [-755.367] (-754.202) (-755.016) * [-754.218] (-758.038) (-756.377) (-755.249) -- 0:00:19
674500 -- (-755.279) (-755.388) (-754.992) [-754.504] * (-753.935) (-756.878) (-754.154) [-756.530] -- 0:00:19
675000 -- (-754.784) (-754.289) (-756.756) [-754.860] * (-754.292) [-754.607] (-755.541) (-756.472) -- 0:00:19
Average standard deviation of split frequencies: 0.013064
675500 -- (-756.934) (-754.896) (-754.908) [-757.045] * (-754.635) (-755.646) (-754.896) [-755.827] -- 0:00:19
676000 -- (-754.841) [-756.109] (-756.839) (-759.006) * (-756.690) (-755.774) [-755.787] (-755.471) -- 0:00:19
676500 -- (-754.953) [-757.392] (-757.080) (-756.213) * [-755.017] (-754.917) (-756.661) (-756.963) -- 0:00:19
677000 -- (-754.946) (-755.005) (-756.188) [-755.382] * (-755.415) (-755.340) (-754.549) [-756.741] -- 0:00:19
677500 -- [-757.251] (-760.960) (-755.042) (-754.311) * (-757.337) [-755.617] (-755.520) (-755.581) -- 0:00:19
678000 -- (-758.039) (-755.644) [-755.411] (-756.441) * (-757.823) (-755.891) [-756.379] (-758.129) -- 0:00:18
678500 -- (-756.535) (-757.999) (-755.537) [-755.555] * (-758.827) (-758.475) [-756.439] (-756.058) -- 0:00:18
679000 -- [-754.672] (-755.225) (-756.272) (-755.182) * [-754.875] (-761.365) (-755.861) (-754.623) -- 0:00:18
679500 -- (-754.015) (-755.695) (-754.550) [-756.917] * (-755.459) [-755.643] (-755.609) (-755.816) -- 0:00:19
680000 -- (-756.471) (-755.541) (-756.420) [-757.214] * (-757.447) (-755.676) (-757.813) [-757.259] -- 0:00:19
Average standard deviation of split frequencies: 0.013066
680500 -- (-756.307) (-755.031) (-755.059) [-757.093] * (-757.387) [-756.204] (-757.480) (-756.536) -- 0:00:19
681000 -- (-756.098) (-755.270) (-754.870) [-755.461] * [-757.995] (-756.755) (-753.926) (-755.781) -- 0:00:19
681500 -- (-756.386) (-759.659) [-755.200] (-757.670) * (-755.709) (-754.207) [-754.534] (-755.064) -- 0:00:19
682000 -- [-753.917] (-755.956) (-756.893) (-756.391) * (-756.087) (-754.766) (-754.534) [-755.006] -- 0:00:19
682500 -- (-756.239) (-757.898) (-756.076) [-757.130] * (-755.624) (-756.309) (-755.454) [-755.759] -- 0:00:19
683000 -- [-754.907] (-756.188) (-760.329) (-758.996) * (-758.466) [-754.988] (-758.481) (-759.888) -- 0:00:19
683500 -- (-754.902) (-755.705) (-759.741) [-754.130] * (-756.044) [-755.241] (-759.159) (-756.617) -- 0:00:18
684000 -- [-754.336] (-755.694) (-760.099) (-756.298) * (-755.977) (-756.102) [-757.188] (-755.778) -- 0:00:18
684500 -- [-755.387] (-756.846) (-753.890) (-757.171) * [-757.322] (-757.152) (-757.607) (-759.735) -- 0:00:18
685000 -- (-754.678) (-756.823) [-756.183] (-754.714) * (-755.870) (-757.534) [-758.965] (-756.341) -- 0:00:18
Average standard deviation of split frequencies: 0.012827
685500 -- (-756.410) (-754.148) [-755.022] (-753.747) * (-753.907) [-759.458] (-757.177) (-755.538) -- 0:00:18
686000 -- (-754.706) [-754.074] (-754.506) (-754.617) * (-762.229) (-755.823) [-757.430] (-756.032) -- 0:00:18
686500 -- [-754.266] (-754.437) (-758.058) (-754.591) * [-756.280] (-754.350) (-757.220) (-757.689) -- 0:00:18
687000 -- [-755.727] (-757.114) (-755.657) (-754.768) * (-756.272) (-755.854) [-760.530] (-755.991) -- 0:00:18
687500 -- (-755.713) (-758.487) (-760.123) [-758.381] * [-759.991] (-759.149) (-755.394) (-761.001) -- 0:00:18
688000 -- (-755.302) (-759.656) (-755.865) [-754.784] * (-759.486) (-758.677) [-754.783] (-753.630) -- 0:00:18
688500 -- (-756.418) (-757.529) (-754.334) [-754.974] * [-755.141] (-755.701) (-757.005) (-757.081) -- 0:00:18
689000 -- (-756.260) [-754.870] (-754.510) (-754.894) * (-757.063) (-760.196) (-756.683) [-757.032] -- 0:00:18
689500 -- (-757.277) (-754.529) (-755.163) [-754.581] * (-760.326) [-755.491] (-756.557) (-755.094) -- 0:00:18
690000 -- [-754.823] (-756.437) (-755.195) (-757.609) * (-759.496) [-756.292] (-756.260) (-756.482) -- 0:00:18
Average standard deviation of split frequencies: 0.012786
690500 -- [-758.337] (-755.327) (-755.447) (-754.128) * [-754.022] (-754.157) (-757.672) (-757.192) -- 0:00:18
691000 -- (-756.788) (-759.187) [-755.368] (-758.736) * (-756.638) [-756.655] (-753.824) (-754.672) -- 0:00:18
691500 -- (-755.016) [-754.517] (-753.826) (-756.289) * (-757.745) [-756.179] (-755.942) (-755.907) -- 0:00:18
692000 -- (-759.700) (-756.867) (-756.178) [-758.502] * (-755.115) (-757.288) [-755.157] (-757.477) -- 0:00:18
692500 -- (-755.800) (-760.564) [-753.872] (-757.779) * (-756.412) (-757.461) (-755.221) [-756.360] -- 0:00:18
693000 -- (-756.885) (-756.409) (-755.372) [-756.457] * (-758.522) [-756.590] (-760.956) (-756.175) -- 0:00:18
693500 -- [-756.904] (-754.449) (-759.382) (-756.842) * (-756.171) (-755.364) [-758.543] (-758.219) -- 0:00:18
694000 -- (-758.767) (-754.197) [-754.988] (-754.978) * (-754.376) (-755.939) [-755.149] (-755.659) -- 0:00:18
694500 -- (-761.694) [-754.857] (-754.182) (-755.698) * (-757.635) (-754.644) [-755.765] (-756.752) -- 0:00:18
695000 -- [-755.580] (-755.874) (-754.875) (-755.172) * [-757.503] (-754.644) (-754.491) (-755.870) -- 0:00:17
Average standard deviation of split frequencies: 0.012914
695500 -- [-754.782] (-759.003) (-758.628) (-755.579) * (-754.859) [-754.858] (-755.393) (-756.933) -- 0:00:17
696000 -- (-755.489) (-754.047) [-757.312] (-756.515) * (-757.457) [-755.946] (-756.238) (-757.254) -- 0:00:17
696500 -- (-756.627) (-754.375) [-757.321] (-755.301) * (-754.851) [-757.357] (-754.959) (-756.729) -- 0:00:18
697000 -- [-754.250] (-756.188) (-758.082) (-755.003) * (-754.489) [-760.591] (-756.896) (-754.988) -- 0:00:18
697500 -- (-754.533) (-755.556) (-758.596) [-756.524] * [-755.903] (-761.509) (-757.704) (-754.303) -- 0:00:18
698000 -- (-755.001) (-754.845) [-756.141] (-755.461) * [-756.841] (-755.433) (-757.495) (-757.612) -- 0:00:18
698500 -- (-754.955) (-755.903) (-758.807) [-755.016] * [-755.342] (-754.847) (-754.490) (-755.791) -- 0:00:18
699000 -- (-754.108) (-756.124) [-755.113] (-758.908) * [-754.683] (-757.477) (-756.282) (-758.168) -- 0:00:18
699500 -- (-755.924) (-754.455) [-756.469] (-757.106) * (-754.312) [-755.884] (-755.724) (-756.910) -- 0:00:18
700000 -- [-758.393] (-754.839) (-757.025) (-758.977) * (-754.592) (-755.735) (-761.467) [-754.945] -- 0:00:18
Average standard deviation of split frequencies: 0.013635
700500 -- (-755.490) [-754.623] (-758.266) (-755.546) * (-754.475) (-758.273) [-756.237] (-755.464) -- 0:00:17
701000 -- [-754.982] (-755.521) (-757.098) (-758.359) * (-756.522) (-756.363) (-757.433) [-754.013] -- 0:00:17
701500 -- (-758.057) [-755.244] (-761.720) (-756.501) * (-756.859) [-754.397] (-755.067) (-757.193) -- 0:00:17
702000 -- (-755.851) (-755.348) [-757.077] (-757.986) * (-756.441) (-754.393) [-757.717] (-755.053) -- 0:00:17
702500 -- (-755.276) (-756.145) [-757.384] (-759.121) * (-758.959) (-755.891) [-753.956] (-754.516) -- 0:00:17
703000 -- (-758.705) (-755.018) (-761.183) [-754.726] * (-758.357) (-754.722) (-754.668) [-754.374] -- 0:00:17
703500 -- (-758.256) [-755.091] (-756.032) (-754.669) * [-755.031] (-754.812) (-753.959) (-754.491) -- 0:00:17
704000 -- (-757.369) (-755.030) [-755.652] (-758.690) * (-754.928) (-755.756) (-754.904) [-755.491] -- 0:00:17
704500 -- (-755.635) (-758.895) [-759.504] (-754.329) * (-756.629) [-756.866] (-759.492) (-756.204) -- 0:00:17
705000 -- (-754.382) (-756.883) (-754.510) [-754.258] * [-758.917] (-757.061) (-755.120) (-755.286) -- 0:00:17
Average standard deviation of split frequencies: 0.013621
705500 -- (-756.138) (-755.278) [-756.078] (-760.832) * (-755.540) (-757.773) [-754.423] (-754.551) -- 0:00:17
706000 -- [-755.754] (-755.715) (-755.433) (-754.274) * (-756.839) (-755.349) (-757.986) [-754.188] -- 0:00:17
706500 -- [-756.253] (-758.126) (-753.612) (-755.548) * [-758.127] (-755.932) (-757.460) (-756.907) -- 0:00:17
707000 -- (-757.032) (-754.948) (-756.650) [-756.181] * (-756.757) (-759.296) (-756.786) [-755.109] -- 0:00:17
707500 -- [-754.670] (-759.051) (-760.214) (-759.591) * (-754.804) (-757.801) [-758.293] (-755.722) -- 0:00:17
708000 -- (-755.288) [-756.551] (-755.568) (-756.629) * (-757.771) [-755.659] (-754.407) (-756.069) -- 0:00:17
708500 -- (-757.282) (-755.832) [-755.070] (-755.265) * (-757.743) [-756.336] (-754.572) (-754.961) -- 0:00:17
709000 -- (-756.566) [-757.175] (-758.406) (-755.444) * (-756.603) (-756.928) [-755.277] (-756.086) -- 0:00:17
709500 -- [-754.730] (-754.766) (-758.922) (-758.479) * (-756.285) (-754.611) [-754.119] (-758.441) -- 0:00:17
710000 -- (-755.763) (-754.767) (-753.848) [-755.099] * (-757.292) [-756.215] (-754.061) (-755.651) -- 0:00:17
Average standard deviation of split frequencies: 0.013267
710500 -- (-755.221) [-754.848] (-757.900) (-760.292) * [-758.089] (-758.455) (-756.646) (-755.937) -- 0:00:17
711000 -- (-757.782) (-754.002) [-755.620] (-756.278) * (-754.383) [-755.105] (-756.421) (-758.642) -- 0:00:17
711500 -- (-753.813) (-756.414) (-756.675) [-755.830] * (-758.822) (-756.485) [-756.197] (-758.207) -- 0:00:17
712000 -- (-756.755) (-755.468) [-755.656] (-755.006) * (-754.953) (-754.757) (-758.826) [-755.453] -- 0:00:16
712500 -- (-756.217) (-758.350) [-756.275] (-756.472) * [-755.395] (-756.293) (-754.765) (-755.035) -- 0:00:16
713000 -- (-754.574) [-756.332] (-759.930) (-754.437) * (-754.910) (-754.561) (-758.324) [-755.273] -- 0:00:17
713500 -- [-754.352] (-758.032) (-758.019) (-756.997) * [-754.497] (-757.997) (-755.571) (-759.370) -- 0:00:17
714000 -- (-754.445) [-755.107] (-754.141) (-760.519) * (-755.271) (-758.428) (-755.460) [-756.550] -- 0:00:17
714500 -- (-758.671) (-760.990) (-755.041) [-755.219] * [-754.914] (-754.425) (-754.630) (-757.773) -- 0:00:17
715000 -- (-759.282) [-756.178] (-755.460) (-754.921) * [-755.508] (-755.058) (-759.601) (-755.686) -- 0:00:17
Average standard deviation of split frequencies: 0.013212
715500 -- (-756.943) [-755.072] (-755.000) (-755.615) * [-754.742] (-756.362) (-755.499) (-755.410) -- 0:00:17
716000 -- [-755.949] (-755.948) (-760.562) (-755.461) * (-759.003) (-760.007) (-759.218) [-755.909] -- 0:00:17
716500 -- (-755.323) (-754.573) [-754.551] (-755.158) * (-754.232) (-755.778) (-757.541) [-754.866] -- 0:00:17
717000 -- (-755.762) (-758.277) (-755.290) [-755.165] * (-755.377) (-758.476) (-756.685) [-757.099] -- 0:00:16
717500 -- (-756.729) (-753.916) (-758.476) [-758.774] * [-754.562] (-756.397) (-755.772) (-755.731) -- 0:00:16
718000 -- [-758.644] (-757.769) (-764.742) (-760.839) * (-755.662) (-755.596) [-757.152] (-757.462) -- 0:00:16
718500 -- (-758.828) (-756.711) [-756.566] (-758.826) * (-754.216) (-754.775) (-755.721) [-754.543] -- 0:00:16
719000 -- (-759.132) [-754.865] (-753.756) (-757.860) * (-754.377) (-755.591) [-757.567] (-755.430) -- 0:00:16
719500 -- [-760.137] (-755.968) (-755.504) (-758.840) * (-755.694) (-759.679) [-755.219] (-754.565) -- 0:00:16
720000 -- (-757.374) [-755.404] (-755.966) (-760.033) * (-755.436) (-757.366) [-754.331] (-755.417) -- 0:00:16
Average standard deviation of split frequencies: 0.012734
720500 -- (-756.229) (-754.359) (-754.490) [-759.568] * [-753.981] (-758.144) (-758.175) (-756.335) -- 0:00:16
721000 -- (-753.803) (-753.881) [-757.629] (-754.872) * (-756.417) (-756.966) (-760.100) [-755.961] -- 0:00:16
721500 -- [-754.393] (-755.124) (-757.001) (-754.588) * (-755.303) [-756.338] (-755.876) (-758.155) -- 0:00:16
722000 -- (-756.382) (-755.727) [-755.917] (-756.737) * [-754.407] (-760.227) (-757.404) (-764.434) -- 0:00:16
722500 -- [-756.707] (-755.932) (-757.902) (-762.819) * (-755.844) [-755.621] (-755.522) (-759.686) -- 0:00:16
723000 -- (-758.028) (-754.904) [-757.984] (-754.410) * (-755.844) (-755.276) [-755.901] (-757.878) -- 0:00:16
723500 -- (-757.213) (-755.194) (-754.815) [-754.463] * (-756.952) [-755.324] (-754.831) (-757.223) -- 0:00:16
724000 -- (-754.657) (-755.825) (-757.041) [-756.806] * [-756.855] (-756.127) (-756.181) (-757.913) -- 0:00:16
724500 -- [-755.663] (-757.555) (-754.398) (-754.708) * [-756.167] (-757.069) (-756.066) (-755.669) -- 0:00:16
725000 -- (-756.042) (-756.668) (-754.301) [-754.748] * [-758.089] (-758.973) (-755.814) (-756.678) -- 0:00:16
Average standard deviation of split frequencies: 0.013419
725500 -- (-759.347) [-759.415] (-755.591) (-754.178) * (-755.618) (-755.208) (-760.956) [-755.080] -- 0:00:16
726000 -- (-759.506) (-755.840) (-759.211) [-754.285] * (-755.569) (-760.450) (-756.318) [-754.392] -- 0:00:16
726500 -- (-760.518) [-757.873] (-766.313) (-755.017) * (-755.801) (-754.992) (-758.366) [-755.318] -- 0:00:16
727000 -- [-757.164] (-755.905) (-757.369) (-755.515) * (-759.359) [-754.263] (-757.036) (-753.989) -- 0:00:16
727500 -- (-756.733) (-758.367) [-754.063] (-756.336) * (-759.208) (-757.136) [-754.676] (-755.838) -- 0:00:16
728000 -- (-757.577) (-756.878) [-755.808] (-756.213) * (-754.684) (-759.183) (-756.920) [-756.458] -- 0:00:16
728500 -- (-756.614) (-771.477) [-758.858] (-763.207) * [-755.098] (-758.382) (-755.198) (-756.063) -- 0:00:16
729000 -- (-755.153) (-758.526) [-755.899] (-754.988) * [-755.154] (-754.439) (-755.332) (-757.245) -- 0:00:16
729500 -- (-758.070) [-758.336] (-754.119) (-758.329) * (-756.811) [-757.030] (-755.771) (-760.880) -- 0:00:16
730000 -- [-757.569] (-758.281) (-757.035) (-754.501) * (-756.772) (-757.492) (-755.941) [-756.574] -- 0:00:16
Average standard deviation of split frequencies: 0.013247
730500 -- [-754.833] (-754.022) (-755.611) (-755.226) * (-755.681) (-758.939) (-757.248) [-757.898] -- 0:00:16
731000 -- (-758.119) (-755.689) [-755.836] (-756.389) * (-755.624) [-754.689] (-762.205) (-757.289) -- 0:00:16
731500 -- [-758.152] (-755.151) (-759.133) (-754.469) * [-756.363] (-754.775) (-757.870) (-754.472) -- 0:00:16
732000 -- [-754.851] (-755.396) (-754.422) (-754.004) * [-754.379] (-759.490) (-753.918) (-754.717) -- 0:00:16
732500 -- [-754.833] (-758.928) (-754.753) (-755.627) * (-754.198) (-758.002) (-757.806) [-755.834] -- 0:00:16
733000 -- (-755.411) [-756.100] (-760.243) (-758.224) * [-753.946] (-754.892) (-755.161) (-756.673) -- 0:00:16
733500 -- (-755.164) (-759.142) [-755.960] (-760.842) * (-757.079) (-757.137) (-754.542) [-756.522] -- 0:00:15
734000 -- (-755.027) [-757.310] (-756.182) (-757.496) * (-756.786) (-758.684) (-756.534) [-757.001] -- 0:00:15
734500 -- [-760.860] (-754.531) (-753.925) (-756.495) * (-763.033) (-758.506) [-754.156] (-755.867) -- 0:00:15
735000 -- (-754.598) (-755.966) [-754.993] (-756.983) * (-756.603) (-755.690) [-756.817] (-755.746) -- 0:00:15
Average standard deviation of split frequencies: 0.013450
735500 -- (-760.124) [-757.421] (-754.699) (-755.579) * [-755.282] (-754.662) (-755.975) (-756.522) -- 0:00:15
736000 -- (-756.567) (-755.181) (-754.568) [-759.029] * (-758.622) [-754.662] (-757.917) (-755.181) -- 0:00:15
736500 -- (-754.467) (-754.435) (-754.318) [-755.147] * (-755.709) (-755.086) (-757.527) [-753.874] -- 0:00:15
737000 -- (-756.526) (-754.841) [-760.791] (-763.248) * (-755.501) (-754.767) (-755.123) [-756.525] -- 0:00:15
737500 -- (-758.667) (-755.278) (-759.977) [-760.848] * (-758.483) [-756.864] (-754.912) (-755.361) -- 0:00:15
738000 -- (-760.385) [-753.829] (-757.211) (-754.304) * (-755.215) (-754.794) [-756.923] (-754.576) -- 0:00:15
738500 -- (-759.608) (-757.061) [-756.572] (-753.978) * [-754.432] (-753.615) (-754.816) (-755.409) -- 0:00:15
739000 -- (-757.695) (-757.080) (-754.088) [-757.107] * (-760.081) (-754.529) (-757.705) [-754.884] -- 0:00:15
739500 -- (-756.291) (-756.756) [-753.824] (-755.868) * (-754.444) (-755.699) [-754.728] (-754.714) -- 0:00:15
740000 -- (-755.530) [-755.418] (-758.142) (-756.319) * (-754.339) (-756.454) (-757.049) [-753.954] -- 0:00:15
Average standard deviation of split frequencies: 0.013069
740500 -- (-756.972) (-757.017) [-755.795] (-757.508) * [-754.690] (-755.968) (-755.756) (-754.511) -- 0:00:15
741000 -- (-755.283) (-756.745) [-753.991] (-758.177) * (-755.300) (-757.064) [-760.072] (-756.008) -- 0:00:15
741500 -- (-757.674) [-759.356] (-758.034) (-755.835) * (-754.203) (-756.718) (-763.660) [-756.204] -- 0:00:15
742000 -- (-756.582) [-758.738] (-755.429) (-754.572) * [-759.849] (-754.758) (-759.608) (-755.670) -- 0:00:15
742500 -- (-754.453) (-757.588) [-757.594] (-754.699) * (-756.734) (-755.388) (-756.610) [-755.824] -- 0:00:15
743000 -- (-754.793) (-755.776) [-757.728] (-756.223) * [-756.532] (-758.071) (-755.152) (-755.742) -- 0:00:15
743500 -- (-754.460) [-755.975] (-759.979) (-760.566) * (-758.987) [-758.170] (-756.252) (-754.297) -- 0:00:15
744000 -- [-754.501] (-754.363) (-759.206) (-755.097) * (-758.406) (-754.968) (-754.603) [-756.619] -- 0:00:15
744500 -- (-754.577) [-756.993] (-758.422) (-757.610) * [-755.412] (-756.020) (-754.947) (-754.527) -- 0:00:15
745000 -- (-754.889) [-756.523] (-755.831) (-758.166) * (-756.099) (-761.406) (-754.729) [-758.281] -- 0:00:15
Average standard deviation of split frequencies: 0.012638
745500 -- (-754.319) (-754.165) (-754.194) [-755.716] * (-756.021) (-756.560) [-755.395] (-756.110) -- 0:00:15
746000 -- (-754.958) (-753.794) [-754.221] (-759.723) * (-754.168) (-754.278) (-754.822) [-755.932] -- 0:00:15
746500 -- (-755.541) [-758.224] (-753.767) (-757.890) * (-754.729) (-755.591) (-756.479) [-755.430] -- 0:00:15
747000 -- (-758.174) [-755.566] (-753.682) (-755.860) * (-754.758) [-755.778] (-755.275) (-759.105) -- 0:00:15
747500 -- (-759.512) (-756.619) [-754.170] (-759.952) * (-756.526) (-755.625) [-760.242] (-755.965) -- 0:00:15
748000 -- (-755.442) (-754.416) (-757.367) [-754.943] * (-755.425) (-758.322) (-755.896) [-757.001] -- 0:00:15
748500 -- [-755.231] (-754.073) (-755.792) (-756.516) * (-755.257) (-755.910) (-756.024) [-754.540] -- 0:00:15
749000 -- [-754.639] (-754.480) (-754.523) (-756.577) * [-755.888] (-755.146) (-755.356) (-756.604) -- 0:00:15
749500 -- (-755.183) (-760.997) (-755.400) [-755.293] * (-756.941) (-756.633) [-756.893] (-756.451) -- 0:00:15
750000 -- [-754.793] (-756.815) (-756.364) (-755.486) * (-756.982) (-755.187) (-754.856) [-755.176] -- 0:00:15
Average standard deviation of split frequencies: 0.011597
750500 -- [-755.722] (-758.449) (-758.738) (-753.743) * (-755.676) (-757.685) (-753.964) [-755.504] -- 0:00:14
751000 -- (-755.983) [-757.742] (-757.796) (-755.061) * (-756.315) (-756.323) [-754.150] (-755.495) -- 0:00:14
751500 -- (-762.322) (-757.026) [-759.035] (-754.619) * (-756.392) (-754.223) [-754.025] (-761.301) -- 0:00:14
752000 -- (-756.172) (-759.617) [-754.398] (-754.957) * [-757.009] (-753.952) (-755.534) (-754.026) -- 0:00:14
752500 -- [-755.699] (-756.628) (-762.363) (-756.818) * [-755.593] (-755.291) (-755.285) (-755.490) -- 0:00:14
753000 -- (-755.476) [-757.419] (-756.299) (-754.884) * (-756.468) (-754.460) (-756.064) [-757.502] -- 0:00:14
753500 -- (-758.058) [-758.522] (-755.435) (-755.833) * (-757.917) [-754.987] (-755.114) (-754.425) -- 0:00:14
754000 -- (-758.840) (-755.901) [-758.677] (-756.073) * (-759.273) (-758.796) (-757.241) [-760.958] -- 0:00:14
754500 -- (-756.120) (-754.441) (-759.700) [-758.105] * (-755.051) (-758.763) (-755.855) [-756.464] -- 0:00:14
755000 -- (-755.059) (-754.755) [-755.855] (-756.259) * (-755.494) [-759.084] (-755.153) (-754.151) -- 0:00:14
Average standard deviation of split frequencies: 0.011806
755500 -- (-756.168) (-754.758) (-755.253) [-755.516] * [-755.371] (-754.397) (-755.307) (-755.940) -- 0:00:14
756000 -- (-755.450) (-759.951) (-758.631) [-754.310] * (-755.160) (-756.698) (-758.995) [-754.497] -- 0:00:14
756500 -- [-755.292] (-761.655) (-756.624) (-758.262) * (-758.662) (-757.556) (-758.148) [-756.373] -- 0:00:14
757000 -- [-754.801] (-755.768) (-756.531) (-756.000) * (-755.883) (-755.522) (-756.391) [-755.371] -- 0:00:14
757500 -- [-756.000] (-756.515) (-757.571) (-754.629) * [-756.444] (-756.534) (-754.265) (-754.980) -- 0:00:14
758000 -- [-755.175] (-756.871) (-756.911) (-754.449) * [-754.235] (-757.091) (-755.067) (-754.328) -- 0:00:14
758500 -- (-765.381) (-757.045) [-756.243] (-755.016) * (-754.309) [-755.277] (-756.677) (-754.779) -- 0:00:14
759000 -- (-755.048) [-754.074] (-762.570) (-754.461) * (-756.660) [-756.363] (-755.626) (-757.062) -- 0:00:14
759500 -- (-755.904) [-754.907] (-755.715) (-756.035) * (-758.972) (-756.583) [-757.699] (-754.837) -- 0:00:14
760000 -- (-757.228) (-757.780) [-757.895] (-754.503) * [-754.986] (-757.558) (-756.372) (-755.461) -- 0:00:14
Average standard deviation of split frequencies: 0.011692
760500 -- [-755.370] (-757.828) (-758.352) (-754.553) * (-755.346) [-754.137] (-755.265) (-754.740) -- 0:00:14
761000 -- [-758.664] (-755.188) (-755.604) (-755.681) * (-754.538) [-756.752] (-759.663) (-756.598) -- 0:00:14
761500 -- [-758.002] (-756.437) (-754.117) (-754.595) * (-755.149) [-759.314] (-756.737) (-757.638) -- 0:00:14
762000 -- (-754.075) [-754.667] (-755.142) (-755.253) * [-756.328] (-755.675) (-763.321) (-753.933) -- 0:00:14
762500 -- (-758.323) (-755.575) (-757.599) [-756.677] * [-755.136] (-756.517) (-757.877) (-756.697) -- 0:00:14
763000 -- [-754.961] (-759.563) (-760.624) (-761.157) * (-754.616) (-756.808) [-760.117] (-755.031) -- 0:00:14
763500 -- (-755.826) (-759.130) [-757.941] (-755.451) * (-754.927) (-756.169) (-756.906) [-755.387] -- 0:00:14
764000 -- (-757.597) (-757.067) [-756.736] (-761.965) * (-756.465) (-756.622) (-756.340) [-754.949] -- 0:00:14
764500 -- [-755.422] (-756.784) (-759.969) (-758.599) * (-755.668) (-754.901) [-757.815] (-754.023) -- 0:00:14
765000 -- (-757.359) [-757.438] (-759.576) (-763.361) * (-757.128) (-756.215) (-761.177) [-754.431] -- 0:00:14
Average standard deviation of split frequencies: 0.011118
765500 -- (-755.523) [-757.147] (-755.954) (-759.277) * [-755.556] (-758.442) (-757.092) (-754.676) -- 0:00:14
766000 -- (-756.395) (-754.745) (-755.429) [-758.660] * (-757.839) [-755.923] (-759.859) (-755.751) -- 0:00:14
766500 -- (-755.155) [-754.669] (-754.724) (-757.663) * (-759.133) (-759.361) (-756.522) [-755.808] -- 0:00:14
767000 -- (-756.297) (-757.073) (-755.089) [-757.928] * (-756.203) (-756.258) (-756.727) [-755.695] -- 0:00:13
767500 -- (-758.358) (-758.488) [-754.425] (-755.014) * [-754.120] (-756.586) (-759.536) (-755.538) -- 0:00:13
768000 -- (-760.081) (-756.947) (-758.666) [-755.537] * (-755.700) (-756.356) (-756.444) [-755.321] -- 0:00:13
768500 -- [-758.548] (-754.642) (-757.277) (-758.244) * (-755.701) (-757.521) [-756.344] (-755.050) -- 0:00:13
769000 -- [-754.656] (-757.596) (-754.184) (-758.965) * (-757.132) (-757.318) (-758.395) [-754.000] -- 0:00:13
769500 -- (-755.615) (-760.073) [-756.160] (-759.100) * [-758.323] (-754.947) (-758.561) (-755.348) -- 0:00:13
770000 -- (-758.841) (-760.687) [-759.701] (-757.584) * (-757.288) (-754.885) (-761.708) [-754.199] -- 0:00:13
Average standard deviation of split frequencies: 0.010684
770500 -- [-759.101] (-755.504) (-757.516) (-756.614) * (-755.392) (-757.338) (-756.734) [-754.631] -- 0:00:13
771000 -- (-754.925) (-758.151) (-756.498) [-754.833] * [-754.094] (-761.228) (-756.614) (-755.650) -- 0:00:13
771500 -- (-756.040) (-754.926) (-756.496) [-754.533] * (-755.626) [-755.270] (-755.623) (-756.541) -- 0:00:13
772000 -- (-757.591) (-754.932) [-758.282] (-757.413) * (-758.860) (-754.575) [-753.925] (-754.957) -- 0:00:13
772500 -- (-756.713) [-756.543] (-759.472) (-755.133) * (-754.518) (-754.334) [-754.412] (-755.300) -- 0:00:13
773000 -- (-757.610) [-756.480] (-756.188) (-757.852) * [-754.884] (-756.359) (-755.583) (-758.017) -- 0:00:13
773500 -- (-756.590) [-757.446] (-759.749) (-754.674) * (-757.179) (-756.117) (-754.344) [-759.304] -- 0:00:13
774000 -- [-756.967] (-754.639) (-757.060) (-757.251) * (-755.139) (-757.727) (-754.246) [-756.239] -- 0:00:13
774500 -- (-755.497) [-758.122] (-756.197) (-755.627) * (-758.553) (-754.814) [-755.816] (-753.714) -- 0:00:13
775000 -- (-756.774) (-757.718) (-759.446) [-755.737] * (-755.509) [-754.190] (-754.932) (-755.856) -- 0:00:13
Average standard deviation of split frequencies: 0.010732
775500 -- (-756.981) (-758.799) (-759.700) [-755.046] * (-755.658) [-756.526] (-756.102) (-758.844) -- 0:00:13
776000 -- (-755.740) [-759.937] (-757.553) (-755.040) * (-755.743) (-755.005) [-756.580] (-757.726) -- 0:00:13
776500 -- (-755.686) (-756.603) (-757.713) [-755.158] * (-754.840) (-755.278) [-754.595] (-757.361) -- 0:00:13
777000 -- (-754.173) (-755.577) (-757.403) [-756.366] * (-755.318) (-755.961) [-755.066] (-755.474) -- 0:00:13
777500 -- (-755.150) [-756.909] (-757.096) (-756.194) * (-753.916) (-756.499) (-755.480) [-754.055] -- 0:00:13
778000 -- (-757.201) (-759.203) [-755.896] (-754.462) * (-754.296) [-756.251] (-754.785) (-755.258) -- 0:00:13
778500 -- (-756.598) (-759.898) (-755.805) [-754.134] * [-755.274] (-756.265) (-753.985) (-757.905) -- 0:00:13
779000 -- (-754.646) (-757.522) (-755.451) [-755.284] * [-755.034] (-762.079) (-756.132) (-759.291) -- 0:00:13
779500 -- (-754.500) [-759.208] (-757.272) (-755.903) * (-755.505) (-754.676) (-757.576) [-755.397] -- 0:00:13
780000 -- (-755.144) (-756.726) [-758.651] (-755.741) * (-754.212) [-756.887] (-756.619) (-757.382) -- 0:00:13
Average standard deviation of split frequencies: 0.010950
780500 -- [-753.734] (-756.187) (-756.920) (-758.204) * [-754.996] (-759.412) (-758.142) (-757.619) -- 0:00:13
781000 -- (-753.797) (-757.855) [-757.546] (-755.461) * (-760.327) [-756.129] (-755.540) (-755.963) -- 0:00:13
781500 -- (-755.086) [-755.010] (-756.721) (-754.325) * (-757.612) (-759.087) [-758.214] (-758.158) -- 0:00:13
782000 -- [-753.900] (-754.788) (-754.956) (-755.871) * (-758.044) (-755.303) (-755.423) [-756.055] -- 0:00:13
782500 -- (-754.453) (-756.104) (-755.530) [-757.153] * (-756.461) (-756.629) [-754.911] (-755.068) -- 0:00:13
783000 -- (-757.781) (-755.565) [-754.522] (-756.807) * (-758.145) (-756.030) (-754.961) [-756.809] -- 0:00:13
783500 -- (-761.245) (-757.175) (-754.990) [-757.686] * [-761.082] (-757.844) (-755.051) (-755.560) -- 0:00:12
784000 -- (-760.967) (-761.662) [-754.055] (-754.802) * (-756.480) (-757.638) (-754.780) [-757.489] -- 0:00:12
784500 -- (-754.803) (-757.154) [-754.811] (-759.868) * (-756.847) [-754.290] (-758.264) (-754.439) -- 0:00:12
785000 -- (-755.051) (-757.309) (-755.942) [-755.293] * (-758.088) (-754.891) [-759.957] (-759.545) -- 0:00:12
Average standard deviation of split frequencies: 0.011235
785500 -- (-754.957) (-758.036) (-756.767) [-754.161] * (-757.405) (-754.269) [-756.971] (-755.104) -- 0:00:12
786000 -- [-756.478] (-756.143) (-756.083) (-754.740) * (-759.166) [-754.236] (-755.400) (-756.395) -- 0:00:12
786500 -- (-756.684) (-755.219) (-755.263) [-756.809] * (-758.018) (-754.814) [-757.787] (-762.846) -- 0:00:12
787000 -- (-755.604) (-757.813) (-758.902) [-756.834] * [-754.861] (-756.969) (-756.437) (-760.217) -- 0:00:12
787500 -- (-759.862) [-755.370] (-757.306) (-755.201) * (-757.696) [-759.127] (-759.953) (-756.233) -- 0:00:12
788000 -- (-755.819) (-756.977) (-755.802) [-759.389] * (-756.961) (-756.137) [-757.466] (-755.822) -- 0:00:12
788500 -- (-757.131) (-755.928) [-755.335] (-753.947) * (-763.821) (-757.090) [-755.726] (-756.611) -- 0:00:12
789000 -- [-761.161] (-756.914) (-757.107) (-756.350) * (-763.387) (-761.069) [-757.331] (-755.913) -- 0:00:12
789500 -- [-757.066] (-755.946) (-755.501) (-755.350) * (-762.459) [-756.083] (-754.399) (-755.195) -- 0:00:12
790000 -- (-755.881) (-756.978) (-755.830) [-755.563] * [-756.077] (-755.500) (-756.143) (-754.906) -- 0:00:12
Average standard deviation of split frequencies: 0.011050
790500 -- (-754.805) [-757.961] (-758.476) (-756.705) * [-754.136] (-754.885) (-755.004) (-755.332) -- 0:00:12
791000 -- [-754.924] (-757.278) (-757.961) (-755.246) * (-756.686) (-763.148) [-754.043] (-760.823) -- 0:00:12
791500 -- (-754.367) (-756.205) [-756.235] (-757.017) * [-755.822] (-755.022) (-756.222) (-758.532) -- 0:00:12
792000 -- (-755.167) (-754.259) (-761.019) [-755.827] * (-757.054) [-754.641] (-755.551) (-754.800) -- 0:00:12
792500 -- (-758.072) (-754.162) [-754.351] (-758.883) * (-755.411) (-755.833) (-761.989) [-757.265] -- 0:00:12
793000 -- [-755.083] (-755.286) (-755.238) (-756.567) * (-755.452) (-756.610) (-755.822) [-755.059] -- 0:00:12
793500 -- (-757.216) (-755.628) [-758.144] (-755.696) * (-754.588) [-754.685] (-758.122) (-754.219) -- 0:00:12
794000 -- [-754.903] (-754.330) (-757.729) (-755.745) * (-754.529) (-755.203) (-754.460) [-754.893] -- 0:00:12
794500 -- (-757.008) [-756.896] (-756.590) (-754.995) * (-755.316) (-758.020) [-755.389] (-755.996) -- 0:00:12
795000 -- (-756.977) [-755.364] (-754.878) (-753.791) * [-754.742] (-757.168) (-755.112) (-758.685) -- 0:00:12
Average standard deviation of split frequencies: 0.011015
795500 -- (-754.656) (-754.220) [-756.511] (-755.042) * [-755.049] (-756.912) (-754.912) (-756.380) -- 0:00:12
796000 -- (-757.203) (-755.737) [-755.234] (-755.327) * (-756.590) [-757.127] (-757.100) (-754.747) -- 0:00:12
796500 -- [-756.340] (-757.527) (-755.200) (-756.276) * (-755.456) (-755.650) (-753.899) [-757.587] -- 0:00:12
797000 -- (-762.299) (-756.548) (-754.653) [-755.355] * [-754.867] (-754.473) (-758.709) (-760.621) -- 0:00:12
797500 -- (-754.848) [-757.217] (-755.162) (-757.034) * (-755.200) (-755.613) [-756.809] (-756.373) -- 0:00:12
798000 -- (-761.018) [-754.723] (-754.208) (-754.794) * (-757.637) (-758.289) [-760.128] (-756.787) -- 0:00:12
798500 -- [-756.751] (-754.989) (-754.664) (-755.123) * (-756.232) (-757.202) (-758.907) [-757.360] -- 0:00:12
799000 -- (-758.788) (-759.735) [-754.653] (-757.031) * (-754.442) [-756.633] (-755.589) (-755.917) -- 0:00:12
799500 -- [-757.401] (-761.219) (-755.203) (-757.227) * (-754.393) (-758.633) (-758.366) [-754.956] -- 0:00:12
800000 -- (-755.546) (-756.252) [-753.793] (-756.104) * (-754.082) [-757.047] (-754.719) (-755.076) -- 0:00:12
Average standard deviation of split frequencies: 0.010676
800500 -- (-755.346) (-755.152) [-756.431] (-754.784) * (-754.114) (-763.170) [-756.186] (-754.563) -- 0:00:11
801000 -- [-754.628] (-754.894) (-754.577) (-756.728) * (-755.165) (-758.962) [-754.624] (-754.422) -- 0:00:11
801500 -- (-756.512) [-755.429] (-756.397) (-754.110) * (-756.923) (-755.985) [-754.945] (-758.389) -- 0:00:11
802000 -- (-759.944) (-756.368) [-756.567] (-753.551) * (-755.510) (-758.055) (-756.437) [-756.681] -- 0:00:11
802500 -- (-758.385) (-756.033) (-755.428) [-755.045] * (-755.203) [-758.291] (-757.175) (-756.856) -- 0:00:11
803000 -- (-755.634) [-756.719] (-756.372) (-758.127) * (-756.019) (-760.539) [-755.686] (-758.883) -- 0:00:11
803500 -- (-755.134) (-755.939) (-755.138) [-755.835] * (-761.340) [-755.401] (-755.940) (-757.225) -- 0:00:11
804000 -- (-757.785) [-756.357] (-754.528) (-756.027) * (-758.695) [-755.664] (-759.382) (-756.388) -- 0:00:11
804500 -- (-757.324) (-755.591) [-755.892] (-755.614) * (-761.555) (-756.536) [-761.011] (-755.753) -- 0:00:11
805000 -- (-757.925) (-756.200) (-754.789) [-754.983] * (-758.430) (-756.071) [-757.690] (-757.938) -- 0:00:11
Average standard deviation of split frequencies: 0.009982
805500 -- (-757.296) [-756.815] (-755.588) (-762.574) * (-757.361) (-760.657) (-757.067) [-755.157] -- 0:00:11
806000 -- (-755.371) (-758.873) [-755.745] (-755.182) * (-759.295) (-755.308) (-755.302) [-753.985] -- 0:00:11
806500 -- (-756.296) (-759.177) [-756.560] (-755.702) * (-754.019) [-756.431] (-756.500) (-753.878) -- 0:00:11
807000 -- [-757.072] (-757.268) (-756.327) (-757.471) * (-757.683) (-754.461) (-755.731) [-754.719] -- 0:00:11
807500 -- (-760.906) (-755.941) [-754.319] (-757.017) * [-757.672] (-754.409) (-754.132) (-755.471) -- 0:00:11
808000 -- (-757.825) [-757.611] (-754.769) (-757.336) * (-756.938) (-754.409) (-754.265) [-755.174] -- 0:00:11
808500 -- (-755.321) (-757.160) [-754.693] (-757.732) * (-756.177) (-757.783) (-755.825) [-757.841] -- 0:00:11
809000 -- (-757.659) (-755.909) [-753.868] (-757.557) * [-755.114] (-754.374) (-754.169) (-755.820) -- 0:00:11
809500 -- (-756.971) (-756.350) [-754.241] (-756.523) * (-753.865) [-755.512] (-756.154) (-755.499) -- 0:00:11
810000 -- (-757.071) (-756.615) (-754.288) [-754.692] * (-757.783) (-756.990) (-757.655) [-761.203] -- 0:00:11
Average standard deviation of split frequencies: 0.010506
810500 -- (-756.274) (-757.806) [-754.097] (-755.708) * (-755.804) (-755.808) [-756.496] (-756.893) -- 0:00:11
811000 -- (-754.999) [-755.043] (-754.674) (-754.880) * [-759.181] (-756.311) (-754.990) (-755.681) -- 0:00:11
811500 -- (-755.959) (-754.159) [-754.488] (-758.139) * [-759.988] (-756.888) (-756.796) (-754.778) -- 0:00:11
812000 -- (-756.295) (-755.719) [-755.530] (-759.658) * (-761.601) (-754.704) (-756.590) [-753.974] -- 0:00:11
812500 -- [-758.391] (-755.456) (-759.382) (-755.215) * (-757.637) (-756.332) (-756.996) [-754.032] -- 0:00:11
813000 -- (-757.094) [-754.227] (-755.452) (-761.764) * (-755.472) (-755.668) [-755.833] (-754.095) -- 0:00:11
813500 -- (-756.320) (-754.512) [-755.219] (-758.802) * [-754.635] (-755.454) (-756.388) (-763.429) -- 0:00:11
814000 -- (-755.425) (-756.040) (-756.073) [-755.370] * [-754.259] (-758.301) (-754.953) (-757.965) -- 0:00:11
814500 -- [-754.987] (-755.775) (-758.080) (-754.606) * (-757.119) (-754.751) (-755.108) [-754.472] -- 0:00:11
815000 -- (-755.997) [-754.272] (-755.950) (-754.300) * (-756.128) [-756.801] (-757.131) (-756.972) -- 0:00:11
Average standard deviation of split frequencies: 0.010822
815500 -- (-755.507) (-755.936) (-757.582) [-754.956] * (-759.920) [-754.227] (-754.986) (-756.231) -- 0:00:11
816000 -- [-754.440] (-753.803) (-761.121) (-756.025) * (-757.360) [-755.355] (-754.194) (-754.932) -- 0:00:11
816500 -- [-756.780] (-754.962) (-760.020) (-754.483) * [-755.715] (-756.330) (-756.306) (-754.805) -- 0:00:11
817000 -- (-756.495) (-759.170) (-753.925) [-755.741] * (-755.036) (-756.176) [-755.149] (-754.259) -- 0:00:10
817500 -- [-754.468] (-754.702) (-753.925) (-754.664) * [-755.863] (-755.995) (-755.872) (-755.662) -- 0:00:10
818000 -- (-754.241) [-755.346] (-754.990) (-757.238) * (-756.778) [-755.246] (-754.003) (-756.010) -- 0:00:10
818500 -- (-759.912) [-760.887] (-755.196) (-755.715) * (-754.964) (-756.716) [-756.463] (-755.387) -- 0:00:10
819000 -- [-758.830] (-756.370) (-757.208) (-758.707) * [-754.705] (-757.951) (-758.983) (-754.324) -- 0:00:10
819500 -- [-754.782] (-756.127) (-758.060) (-755.344) * [-754.895] (-759.575) (-754.232) (-754.848) -- 0:00:10
820000 -- (-755.789) [-755.871] (-755.899) (-757.547) * (-755.323) (-754.824) [-754.116] (-756.053) -- 0:00:10
Average standard deviation of split frequencies: 0.010799
820500 -- (-757.843) (-756.264) [-756.198] (-756.650) * [-758.183] (-755.394) (-754.424) (-758.057) -- 0:00:10
821000 -- (-759.299) (-755.284) [-755.823] (-757.113) * (-760.884) (-759.222) (-754.955) [-755.587] -- 0:00:10
821500 -- (-756.368) [-754.707] (-756.528) (-757.166) * (-756.047) (-756.741) (-754.318) [-755.188] -- 0:00:10
822000 -- (-756.087) [-754.392] (-756.276) (-756.055) * (-756.768) (-758.205) (-754.547) [-754.598] -- 0:00:10
822500 -- (-755.377) (-754.240) (-756.014) [-757.020] * (-761.375) [-755.664] (-755.538) (-755.234) -- 0:00:10
823000 -- (-753.985) [-755.090] (-759.645) (-754.802) * (-755.423) [-757.921] (-755.699) (-758.471) -- 0:00:10
823500 -- (-755.657) [-754.726] (-754.682) (-755.840) * (-754.982) [-754.935] (-756.559) (-758.446) -- 0:00:10
824000 -- [-757.256] (-755.196) (-756.345) (-762.214) * (-757.228) (-754.411) [-756.784] (-754.777) -- 0:00:10
824500 -- [-755.193] (-754.724) (-756.060) (-759.592) * [-754.133] (-757.019) (-754.329) (-759.241) -- 0:00:10
825000 -- (-754.837) (-755.018) [-754.988] (-754.790) * (-757.373) (-755.569) (-755.251) [-755.855] -- 0:00:10
Average standard deviation of split frequencies: 0.010958
825500 -- (-755.452) (-755.874) (-755.132) [-757.429] * [-755.852] (-757.145) (-753.678) (-755.428) -- 0:00:10
826000 -- (-757.885) (-756.572) (-755.393) [-759.744] * [-754.232] (-755.985) (-754.574) (-758.198) -- 0:00:10
826500 -- (-760.623) (-755.120) (-754.566) [-755.934] * [-754.067] (-758.182) (-754.546) (-755.860) -- 0:00:10
827000 -- [-758.733] (-754.460) (-756.985) (-754.580) * (-757.141) (-757.523) [-757.176] (-756.639) -- 0:00:10
827500 -- (-760.376) (-757.532) [-754.644] (-754.474) * (-757.976) [-756.040] (-761.534) (-755.674) -- 0:00:10
828000 -- (-755.491) (-758.501) (-754.677) [-753.998] * (-761.001) [-756.311] (-759.152) (-756.786) -- 0:00:10
828500 -- (-755.058) (-760.091) [-754.455] (-754.985) * (-754.796) (-754.691) [-762.990] (-756.214) -- 0:00:10
829000 -- [-754.650] (-755.916) (-757.895) (-754.638) * (-754.996) [-758.867] (-759.179) (-756.028) -- 0:00:10
829500 -- (-758.871) (-756.080) [-756.967] (-755.129) * (-759.778) (-756.692) (-759.568) [-759.148] -- 0:00:10
830000 -- (-754.637) (-755.433) [-755.706] (-754.395) * [-757.030] (-754.309) (-757.648) (-755.740) -- 0:00:10
Average standard deviation of split frequencies: 0.010745
830500 -- (-755.128) (-759.126) [-754.764] (-755.704) * (-756.568) (-755.052) [-753.994] (-756.783) -- 0:00:10
831000 -- (-755.570) [-755.337] (-757.335) (-757.686) * (-755.201) (-756.804) (-756.948) [-755.586] -- 0:00:10
831500 -- (-756.429) [-755.941] (-753.877) (-756.553) * (-755.249) (-754.903) [-755.099] (-755.601) -- 0:00:10
832000 -- [-755.609] (-755.730) (-754.106) (-755.220) * (-756.659) [-756.760] (-755.252) (-759.027) -- 0:00:10
832500 -- (-756.353) (-757.835) (-755.371) [-753.839] * [-757.533] (-756.611) (-756.273) (-758.965) -- 0:00:10
833000 -- (-757.417) (-753.910) [-754.106] (-755.337) * (-758.354) (-755.683) (-756.963) [-764.137] -- 0:00:10
833500 -- [-754.423] (-754.668) (-753.686) (-755.693) * [-754.759] (-754.198) (-760.452) (-757.925) -- 0:00:09
834000 -- (-754.579) [-754.429] (-753.914) (-756.263) * (-755.376) (-756.087) [-757.766] (-754.921) -- 0:00:09
834500 -- (-754.175) (-754.425) (-757.146) [-754.664] * (-756.759) (-757.948) [-755.702] (-761.425) -- 0:00:09
835000 -- (-754.309) (-757.144) (-756.795) [-757.843] * [-757.527] (-759.417) (-757.411) (-757.241) -- 0:00:09
Average standard deviation of split frequencies: 0.010977
835500 -- (-755.713) (-759.872) (-757.335) [-755.639] * [-756.808] (-755.361) (-759.045) (-758.383) -- 0:00:09
836000 -- [-754.521] (-759.027) (-757.728) (-758.465) * (-757.172) [-754.734] (-754.565) (-759.075) -- 0:00:09
836500 -- [-755.750] (-755.507) (-758.569) (-759.007) * (-756.813) [-755.338] (-755.301) (-755.554) -- 0:00:09
837000 -- [-757.558] (-755.055) (-756.870) (-759.289) * [-758.583] (-754.568) (-755.943) (-756.286) -- 0:00:09
837500 -- (-754.505) (-754.841) (-755.838) [-759.381] * [-754.260] (-754.831) (-754.034) (-756.179) -- 0:00:09
838000 -- (-755.241) [-759.157] (-756.379) (-758.389) * (-757.015) (-756.131) (-756.446) [-754.911] -- 0:00:09
838500 -- (-757.083) (-755.070) [-756.460] (-761.199) * (-758.344) [-756.271] (-756.244) (-755.810) -- 0:00:09
839000 -- (-756.440) (-754.423) (-759.157) [-757.607] * (-756.952) (-755.537) (-755.509) [-753.950] -- 0:00:09
839500 -- [-755.320] (-755.492) (-758.991) (-758.983) * (-754.798) (-756.900) (-755.955) [-761.724] -- 0:00:09
840000 -- (-755.678) (-759.773) (-757.019) [-757.339] * (-754.906) (-755.771) [-756.645] (-754.032) -- 0:00:09
Average standard deviation of split frequencies: 0.010804
840500 -- (-756.269) [-757.091] (-755.563) (-755.721) * (-758.938) (-754.694) (-755.931) [-754.041] -- 0:00:09
841000 -- (-755.062) (-754.432) [-758.919] (-756.369) * (-757.256) (-754.304) (-759.324) [-754.684] -- 0:00:09
841500 -- (-754.905) [-756.244] (-756.725) (-761.173) * (-757.110) (-755.101) (-756.891) [-754.225] -- 0:00:09
842000 -- (-755.033) (-754.897) [-754.633] (-757.940) * [-756.933] (-755.207) (-759.223) (-754.357) -- 0:00:09
842500 -- (-756.133) [-755.716] (-757.375) (-758.458) * [-757.044] (-756.663) (-755.302) (-754.885) -- 0:00:09
843000 -- [-755.320] (-757.278) (-757.317) (-758.580) * (-757.026) [-755.057] (-758.381) (-754.127) -- 0:00:09
843500 -- (-755.370) [-755.422] (-757.255) (-760.111) * (-756.815) [-755.042] (-755.290) (-754.128) -- 0:00:09
844000 -- (-755.606) [-754.640] (-755.279) (-756.261) * (-754.530) [-753.969] (-757.396) (-755.241) -- 0:00:09
844500 -- (-760.985) [-757.873] (-754.765) (-754.605) * (-756.768) (-755.014) (-757.102) [-755.114] -- 0:00:09
845000 -- (-759.729) (-757.099) [-755.870] (-756.223) * (-755.445) (-755.792) [-758.540] (-754.022) -- 0:00:09
Average standard deviation of split frequencies: 0.010401
845500 -- (-754.517) (-760.200) [-757.794] (-755.948) * (-755.101) (-754.548) [-756.586] (-754.002) -- 0:00:09
846000 -- (-754.608) [-754.447] (-755.314) (-758.798) * (-755.009) [-755.419] (-756.065) (-755.869) -- 0:00:09
846500 -- (-755.771) (-754.737) [-754.562] (-754.544) * (-757.485) [-754.781] (-759.433) (-755.854) -- 0:00:09
847000 -- (-758.763) [-755.689] (-754.876) (-756.706) * (-765.258) (-756.407) (-755.500) [-756.072] -- 0:00:09
847500 -- (-755.771) (-754.363) [-756.648] (-755.384) * (-754.698) [-755.388] (-754.514) (-756.031) -- 0:00:09
848000 -- [-754.852] (-757.643) (-753.734) (-755.387) * (-754.448) [-755.026] (-754.705) (-759.170) -- 0:00:09
848500 -- (-756.417) (-755.263) (-756.657) [-753.904] * [-760.782] (-754.589) (-756.658) (-761.173) -- 0:00:09
849000 -- (-754.749) (-758.887) (-754.152) [-753.697] * (-754.933) [-755.024] (-754.707) (-755.446) -- 0:00:09
849500 -- [-755.726] (-754.240) (-755.655) (-753.883) * (-760.425) (-755.870) [-757.776] (-755.415) -- 0:00:09
850000 -- [-754.651] (-755.161) (-755.894) (-755.598) * (-761.099) [-754.052] (-759.864) (-755.651) -- 0:00:09
Average standard deviation of split frequencies: 0.009827
850500 -- (-756.989) (-755.479) [-756.521] (-754.574) * (-756.615) [-757.064] (-758.057) (-755.048) -- 0:00:08
851000 -- (-758.388) (-756.494) [-757.067] (-756.049) * (-758.029) (-757.029) [-755.315] (-754.247) -- 0:00:08
851500 -- (-755.684) [-759.195] (-757.876) (-754.310) * (-760.055) [-755.592] (-758.133) (-755.282) -- 0:00:08
852000 -- (-754.693) (-755.361) (-753.902) [-755.589] * (-755.548) (-759.358) (-758.992) [-756.719] -- 0:00:08
852500 -- (-755.693) (-754.184) (-753.753) [-756.988] * (-757.786) [-756.400] (-761.873) (-755.771) -- 0:00:08
853000 -- (-756.425) [-755.554] (-755.315) (-753.992) * (-754.647) (-759.327) [-761.748] (-759.191) -- 0:00:08
853500 -- [-755.716] (-755.382) (-759.460) (-756.272) * (-757.882) (-756.061) [-758.759] (-754.556) -- 0:00:08
854000 -- (-754.906) (-755.860) (-755.524) [-754.870] * (-754.721) (-757.205) [-760.210] (-753.878) -- 0:00:08
854500 -- (-754.576) (-757.001) [-758.205] (-755.021) * [-755.661] (-760.619) (-755.446) (-756.497) -- 0:00:08
855000 -- [-756.411] (-754.992) (-755.287) (-754.331) * (-757.314) [-754.869] (-758.101) (-758.405) -- 0:00:08
Average standard deviation of split frequencies: 0.009435
855500 -- (-755.623) [-754.942] (-755.227) (-755.188) * (-756.907) (-754.369) (-755.110) [-759.165] -- 0:00:08
856000 -- (-753.942) [-755.694] (-756.442) (-757.168) * [-754.644] (-755.644) (-757.888) (-754.876) -- 0:00:08
856500 -- (-754.598) (-758.975) (-755.021) [-754.981] * (-756.666) [-755.110] (-757.473) (-755.583) -- 0:00:08
857000 -- (-754.078) [-758.086] (-756.024) (-755.809) * (-758.599) [-757.377] (-753.780) (-757.561) -- 0:00:08
857500 -- (-757.356) (-756.399) (-760.515) [-756.412] * (-757.667) (-757.641) (-754.414) [-757.328] -- 0:00:08
858000 -- (-753.956) (-755.646) [-761.557] (-757.133) * (-754.143) (-754.576) [-756.913] (-754.490) -- 0:00:08
858500 -- [-756.655] (-754.616) (-754.732) (-756.266) * (-755.787) [-754.507] (-758.850) (-754.267) -- 0:00:08
859000 -- [-754.578] (-755.492) (-755.185) (-760.704) * (-754.831) (-755.978) (-758.063) [-754.379] -- 0:00:08
859500 -- (-756.632) (-755.817) [-754.762] (-765.916) * (-755.528) (-756.702) (-757.515) [-756.208] -- 0:00:08
860000 -- (-755.659) [-754.382] (-754.841) (-754.913) * (-755.262) (-759.067) [-757.973] (-759.315) -- 0:00:08
Average standard deviation of split frequencies: 0.009749
860500 -- (-756.742) [-754.682] (-755.961) (-755.130) * [-755.430] (-762.357) (-758.790) (-759.303) -- 0:00:08
861000 -- (-754.403) (-756.376) [-755.457] (-755.088) * [-755.284] (-761.539) (-762.653) (-756.019) -- 0:00:08
861500 -- (-754.907) (-754.463) (-757.733) [-754.704] * [-757.060] (-762.730) (-755.510) (-756.462) -- 0:00:08
862000 -- (-754.765) (-755.741) [-755.673] (-756.355) * (-756.789) [-755.611] (-754.574) (-755.208) -- 0:00:08
862500 -- (-755.732) (-753.946) (-755.118) [-757.703] * (-755.053) (-758.465) [-754.271] (-754.965) -- 0:00:08
863000 -- (-755.577) (-755.376) (-756.298) [-757.358] * (-755.103) (-758.338) (-756.167) [-754.109] -- 0:00:08
863500 -- (-754.682) [-755.417] (-755.214) (-756.236) * (-756.007) (-757.196) (-756.129) [-755.269] -- 0:00:08
864000 -- (-757.163) [-754.830] (-758.371) (-756.430) * (-760.175) [-761.104] (-757.035) (-760.047) -- 0:00:08
864500 -- [-755.216] (-753.713) (-759.083) (-754.267) * (-755.521) [-753.914] (-757.926) (-757.481) -- 0:00:08
865000 -- (-755.496) [-755.409] (-760.919) (-755.550) * [-756.954] (-754.305) (-756.218) (-757.285) -- 0:00:08
Average standard deviation of split frequencies: 0.009653
865500 -- [-755.600] (-756.724) (-755.630) (-756.742) * (-755.603) (-755.630) [-754.909] (-755.159) -- 0:00:08
866000 -- (-756.051) (-753.936) [-757.590] (-760.298) * (-754.836) (-755.284) (-755.783) [-755.097] -- 0:00:08
866500 -- (-757.606) (-758.029) (-756.429) [-759.858] * (-756.801) (-754.130) [-755.525] (-758.036) -- 0:00:08
867000 -- (-755.787) (-753.604) [-755.777] (-755.140) * (-755.787) (-755.777) [-753.923] (-754.531) -- 0:00:07
867500 -- (-756.310) [-755.383] (-755.292) (-757.075) * (-759.067) [-755.372] (-756.800) (-754.666) -- 0:00:07
868000 -- (-758.390) [-754.594] (-756.764) (-755.954) * [-755.986] (-754.983) (-758.152) (-754.575) -- 0:00:07
868500 -- (-757.509) [-757.447] (-755.475) (-755.082) * (-755.108) [-754.993] (-757.488) (-754.602) -- 0:00:07
869000 -- (-757.529) (-758.560) [-756.057] (-754.655) * (-758.335) (-756.480) (-754.636) [-756.071] -- 0:00:07
869500 -- (-759.865) [-756.483] (-754.689) (-758.539) * [-754.722] (-755.631) (-754.856) (-756.642) -- 0:00:07
870000 -- (-762.002) [-754.234] (-756.872) (-757.124) * [-755.215] (-753.750) (-755.610) (-756.099) -- 0:00:07
Average standard deviation of split frequencies: 0.009818
870500 -- (-763.018) (-754.263) [-755.248] (-754.626) * (-755.744) (-756.259) [-754.574] (-754.265) -- 0:00:07
871000 -- (-755.259) (-758.584) [-756.478] (-755.001) * (-754.465) [-754.120] (-754.403) (-758.342) -- 0:00:07
871500 -- (-755.910) [-755.281] (-758.794) (-755.661) * (-755.286) [-756.421] (-759.836) (-756.287) -- 0:00:07
872000 -- [-755.368] (-756.985) (-756.359) (-754.922) * [-756.621] (-759.312) (-756.637) (-754.169) -- 0:00:07
872500 -- [-755.009] (-756.404) (-758.771) (-756.457) * (-757.853) [-755.836] (-756.384) (-755.606) -- 0:00:07
873000 -- (-756.713) [-755.924] (-760.215) (-755.659) * (-755.104) (-755.364) (-755.531) [-757.175] -- 0:00:07
873500 -- (-756.817) [-754.612] (-756.674) (-756.689) * (-762.432) (-756.732) (-755.921) [-755.530] -- 0:00:07
874000 -- [-754.603] (-754.909) (-756.137) (-757.149) * (-760.333) (-756.235) (-759.130) [-755.517] -- 0:00:07
874500 -- [-756.575] (-754.805) (-755.916) (-756.556) * (-757.133) (-755.376) [-757.968] (-755.542) -- 0:00:07
875000 -- (-756.847) (-755.027) (-756.254) [-755.141] * (-757.279) [-754.646] (-753.961) (-756.502) -- 0:00:07
Average standard deviation of split frequencies: 0.009507
875500 -- (-758.019) [-754.433] (-754.818) (-755.098) * (-755.684) (-755.040) [-754.423] (-756.128) -- 0:00:07
876000 -- [-755.717] (-755.995) (-756.353) (-759.180) * (-758.873) (-756.283) [-756.542] (-758.687) -- 0:00:07
876500 -- (-758.444) [-754.010] (-756.954) (-760.694) * [-758.177] (-758.649) (-755.423) (-759.177) -- 0:00:07
877000 -- (-754.030) [-756.557] (-758.166) (-754.049) * (-755.262) (-759.686) [-756.031] (-756.546) -- 0:00:07
877500 -- (-756.271) (-758.382) [-755.225] (-756.228) * (-755.151) (-759.844) [-754.561] (-754.423) -- 0:00:07
878000 -- [-756.047] (-761.582) (-758.805) (-753.583) * (-754.723) [-760.541] (-756.070) (-756.052) -- 0:00:07
878500 -- (-754.925) (-756.111) (-756.424) [-755.160] * [-754.331] (-757.709) (-760.541) (-756.484) -- 0:00:07
879000 -- [-755.113] (-754.416) (-754.907) (-755.687) * (-756.226) (-755.569) (-759.169) [-759.697] -- 0:00:07
879500 -- (-756.082) (-760.108) (-757.406) [-754.545] * (-755.013) [-755.088] (-755.711) (-758.325) -- 0:00:07
880000 -- (-758.704) (-755.734) [-753.973] (-756.342) * (-755.314) (-755.735) [-756.717] (-755.784) -- 0:00:07
Average standard deviation of split frequencies: 0.010063
880500 -- (-758.294) [-757.520] (-758.439) (-758.484) * (-755.206) (-756.319) [-754.858] (-754.959) -- 0:00:07
881000 -- (-757.900) (-757.909) [-756.440] (-754.648) * (-755.020) [-754.827] (-760.643) (-755.598) -- 0:00:07
881500 -- (-759.650) (-753.849) [-756.075] (-755.612) * (-754.976) (-753.946) [-755.630] (-756.967) -- 0:00:07
882000 -- (-755.819) (-757.137) [-755.026] (-753.602) * [-755.323] (-755.555) (-758.237) (-756.335) -- 0:00:07
882500 -- [-755.550] (-755.602) (-756.230) (-753.683) * (-755.710) (-755.168) [-753.937] (-756.108) -- 0:00:07
883000 -- (-755.125) (-754.783) (-755.263) [-755.739] * [-754.985] (-755.820) (-756.091) (-757.239) -- 0:00:07
883500 -- (-755.566) (-755.966) (-757.771) [-757.626] * (-754.335) (-758.596) (-757.414) [-755.465] -- 0:00:06
884000 -- (-754.884) [-757.156] (-756.165) (-755.137) * (-754.703) (-754.170) (-754.414) [-756.142] -- 0:00:06
884500 -- (-756.733) (-755.477) (-754.836) [-754.787] * [-756.535] (-755.490) (-759.195) (-757.123) -- 0:00:06
885000 -- (-755.103) (-754.776) (-756.809) [-754.247] * [-756.910] (-754.379) (-757.129) (-758.997) -- 0:00:06
Average standard deviation of split frequencies: 0.010003
885500 -- (-764.141) [-758.002] (-754.675) (-754.662) * [-756.819] (-757.408) (-753.898) (-758.181) -- 0:00:06
886000 -- [-755.733] (-758.195) (-754.303) (-755.971) * (-756.172) (-754.845) [-754.262] (-755.289) -- 0:00:06
886500 -- (-755.542) (-754.939) [-754.220] (-758.026) * [-757.237] (-757.982) (-755.535) (-756.396) -- 0:00:06
887000 -- (-754.383) [-754.705] (-760.307) (-756.733) * [-757.968] (-755.238) (-755.359) (-757.995) -- 0:00:06
887500 -- (-754.176) (-754.898) [-754.792] (-755.582) * (-756.132) (-755.011) [-756.341] (-756.780) -- 0:00:06
888000 -- (-754.780) [-756.177] (-755.643) (-756.243) * [-754.360] (-756.645) (-754.387) (-758.932) -- 0:00:06
888500 -- (-755.536) [-757.384] (-757.060) (-755.455) * [-761.054] (-757.259) (-762.119) (-759.563) -- 0:00:06
889000 -- (-758.880) (-759.247) [-757.090] (-759.464) * (-760.861) (-758.776) [-757.202] (-756.852) -- 0:00:06
889500 -- (-753.920) (-755.274) (-760.174) [-760.507] * (-755.460) (-756.905) [-755.285] (-756.806) -- 0:00:06
890000 -- (-757.222) (-754.908) (-755.300) [-756.569] * (-754.869) [-757.346] (-754.967) (-757.461) -- 0:00:06
Average standard deviation of split frequencies: 0.009633
890500 -- (-757.726) [-756.387] (-755.541) (-754.946) * (-758.849) (-756.248) [-754.673] (-756.838) -- 0:00:06
891000 -- (-754.852) (-755.969) [-755.784] (-755.197) * (-756.125) (-756.151) [-755.429] (-760.170) -- 0:00:06
891500 -- (-757.209) (-755.969) (-757.276) [-755.493] * (-761.654) [-755.664] (-755.956) (-753.990) -- 0:00:06
892000 -- (-760.445) (-757.825) (-759.571) [-758.789] * (-755.520) [-754.242] (-755.576) (-754.882) -- 0:00:06
892500 -- (-754.046) [-755.632] (-756.595) (-758.371) * [-754.777] (-754.208) (-757.824) (-754.564) -- 0:00:06
893000 -- (-756.274) (-754.780) [-756.456] (-757.785) * (-754.339) [-759.932] (-762.274) (-757.613) -- 0:00:06
893500 -- (-758.685) (-756.108) [-754.997] (-758.247) * [-759.028] (-757.893) (-763.042) (-756.200) -- 0:00:06
894000 -- (-756.324) (-755.228) [-756.086] (-756.016) * (-757.016) (-757.493) (-758.625) [-753.904] -- 0:00:06
894500 -- (-757.107) [-759.166] (-757.325) (-754.880) * [-756.239] (-755.460) (-757.658) (-753.566) -- 0:00:06
895000 -- (-757.943) (-757.583) (-757.213) [-755.952] * (-756.676) (-759.037) (-756.323) [-754.965] -- 0:00:06
Average standard deviation of split frequencies: 0.009260
895500 -- (-759.595) (-755.940) [-754.932] (-757.411) * (-754.522) (-759.184) (-759.701) [-754.380] -- 0:00:06
896000 -- (-756.210) (-755.736) [-754.752] (-757.655) * (-758.343) (-755.750) [-759.051] (-760.554) -- 0:00:06
896500 -- [-758.481] (-755.179) (-755.779) (-760.053) * (-756.718) (-756.837) [-755.793] (-759.955) -- 0:00:06
897000 -- (-755.179) (-756.471) (-755.550) [-754.198] * (-756.882) (-757.969) [-756.059] (-756.672) -- 0:00:06
897500 -- (-755.937) (-761.299) (-757.055) [-759.806] * (-755.996) (-756.129) [-755.952] (-755.971) -- 0:00:06
898000 -- (-754.483) [-756.777] (-755.933) (-757.155) * (-758.184) (-758.710) (-757.682) [-755.798] -- 0:00:06
898500 -- (-755.694) (-756.534) (-758.865) [-760.378] * [-757.906] (-756.544) (-755.604) (-755.659) -- 0:00:06
899000 -- [-755.154] (-758.719) (-757.982) (-757.974) * (-755.014) (-758.674) (-755.261) [-755.822] -- 0:00:06
899500 -- (-757.357) (-760.907) [-757.572] (-754.832) * (-754.567) [-756.680] (-755.326) (-757.257) -- 0:00:06
900000 -- [-754.827] (-758.206) (-756.993) (-754.778) * (-757.212) (-754.903) (-756.096) [-757.417] -- 0:00:06
Average standard deviation of split frequencies: 0.009142
900500 -- (-756.680) (-755.611) (-755.541) [-754.995] * (-760.193) (-755.156) (-756.704) [-755.436] -- 0:00:05
901000 -- (-756.109) (-755.487) (-755.721) [-754.793] * (-758.316) [-755.631] (-756.733) (-755.024) -- 0:00:05
901500 -- (-754.244) (-755.953) (-755.352) [-756.700] * [-756.449] (-755.645) (-758.979) (-754.723) -- 0:00:05
902000 -- [-754.688] (-754.805) (-755.468) (-755.475) * (-754.585) (-756.164) (-758.736) [-755.257] -- 0:00:05
902500 -- (-759.133) [-754.353] (-755.711) (-755.568) * [-754.436] (-756.331) (-756.257) (-754.704) -- 0:00:05
903000 -- (-755.349) [-754.377] (-757.688) (-755.596) * (-755.698) (-756.506) (-754.581) [-755.583] -- 0:00:05
903500 -- (-754.078) (-754.474) (-759.791) [-759.160] * (-755.160) (-754.620) [-754.052] (-755.455) -- 0:00:05
904000 -- (-757.329) [-755.256] (-755.059) (-758.139) * (-756.212) [-756.274] (-755.826) (-755.454) -- 0:00:05
904500 -- (-755.781) (-755.284) [-754.914] (-756.832) * (-755.220) (-758.765) [-756.473] (-754.123) -- 0:00:05
905000 -- (-755.229) [-756.269] (-756.871) (-759.360) * (-755.673) (-755.039) (-757.183) [-757.460] -- 0:00:05
Average standard deviation of split frequencies: 0.009053
905500 -- (-756.624) [-755.568] (-756.360) (-760.799) * (-758.449) [-758.091] (-756.356) (-760.567) -- 0:00:05
906000 -- [-759.041] (-754.408) (-755.733) (-756.738) * (-762.503) [-756.098] (-755.572) (-757.503) -- 0:00:05
906500 -- (-755.590) (-755.183) (-754.287) [-755.256] * (-761.734) (-757.561) [-754.606] (-758.684) -- 0:00:05
907000 -- (-756.110) (-756.134) [-756.947] (-754.900) * (-755.342) (-758.783) (-754.358) [-755.184] -- 0:00:05
907500 -- (-757.072) [-755.451] (-758.607) (-755.347) * (-758.084) (-762.372) (-754.530) [-756.033] -- 0:00:05
908000 -- (-756.145) (-755.599) [-755.780] (-755.247) * (-756.612) (-758.900) (-756.166) [-754.896] -- 0:00:05
908500 -- (-755.627) [-753.976] (-758.102) (-758.315) * (-757.125) (-756.348) [-757.232] (-756.269) -- 0:00:05
909000 -- [-755.946] (-753.802) (-759.133) (-756.244) * (-754.301) (-754.904) (-759.930) [-759.131] -- 0:00:05
909500 -- (-757.283) (-755.829) (-755.630) [-756.350] * (-756.638) [-754.239] (-755.559) (-756.554) -- 0:00:05
910000 -- [-755.995] (-755.461) (-754.134) (-760.432) * [-756.050] (-760.790) (-756.389) (-754.746) -- 0:00:05
Average standard deviation of split frequencies: 0.009249
910500 -- (-756.933) [-754.060] (-760.119) (-757.221) * [-758.568] (-756.823) (-756.323) (-756.008) -- 0:00:05
911000 -- (-754.506) [-757.756] (-758.097) (-754.867) * (-757.057) (-757.406) (-755.850) [-756.778] -- 0:00:05
911500 -- (-758.318) [-755.403] (-756.451) (-756.195) * (-759.231) [-757.596] (-755.460) (-755.561) -- 0:00:05
912000 -- (-756.148) [-755.456] (-758.181) (-755.072) * (-758.550) (-754.638) (-755.915) [-754.478] -- 0:00:05
912500 -- (-755.267) [-756.723] (-756.501) (-756.671) * [-755.366] (-757.534) (-757.701) (-756.075) -- 0:00:05
913000 -- [-755.115] (-757.311) (-756.686) (-757.294) * (-757.196) [-758.108] (-755.809) (-755.994) -- 0:00:05
913500 -- (-756.234) (-755.060) (-754.970) [-759.539] * (-758.807) [-755.438] (-754.785) (-759.710) -- 0:00:05
914000 -- (-756.365) (-756.232) (-754.358) [-755.394] * (-754.124) (-755.862) [-756.367] (-755.348) -- 0:00:05
914500 -- (-765.676) (-758.955) [-754.841] (-758.583) * (-754.225) [-755.472] (-757.277) (-758.880) -- 0:00:05
915000 -- (-758.368) [-756.258] (-764.664) (-758.927) * (-754.396) (-755.139) [-754.876] (-759.989) -- 0:00:05
Average standard deviation of split frequencies: 0.009195
915500 -- (-758.896) [-756.525] (-758.762) (-756.280) * (-754.600) (-754.050) (-754.700) [-754.329] -- 0:00:05
916000 -- (-755.829) (-756.046) (-754.743) [-754.512] * (-754.485) [-754.906] (-756.325) (-755.269) -- 0:00:05
916500 -- (-757.605) (-754.992) [-754.837] (-755.436) * [-755.045] (-755.313) (-756.930) (-754.662) -- 0:00:05
917000 -- (-756.778) [-757.159] (-756.129) (-758.535) * [-756.908] (-757.898) (-755.838) (-754.637) -- 0:00:04
917500 -- (-754.832) (-756.832) [-755.296] (-755.772) * [-754.152] (-754.956) (-754.964) (-764.199) -- 0:00:04
918000 -- (-756.036) [-758.710] (-761.471) (-755.273) * (-754.988) (-756.888) [-757.423] (-759.787) -- 0:00:04
918500 -- [-759.738] (-756.162) (-760.347) (-755.335) * [-756.610] (-758.470) (-757.382) (-760.078) -- 0:00:04
919000 -- (-760.824) (-755.016) (-757.625) [-755.298] * (-756.521) [-756.430] (-758.401) (-754.776) -- 0:00:04
919500 -- (-759.449) (-755.328) (-756.096) [-754.961] * [-754.276] (-756.974) (-756.377) (-756.906) -- 0:00:04
920000 -- (-756.258) [-754.551] (-754.051) (-755.722) * [-753.686] (-756.315) (-757.414) (-757.834) -- 0:00:04
Average standard deviation of split frequencies: 0.009251
920500 -- (-760.544) (-758.340) [-754.766] (-755.782) * (-754.142) (-755.260) (-760.857) [-755.603] -- 0:00:04
921000 -- (-756.361) (-757.068) (-754.916) [-759.688] * (-755.232) [-754.307] (-762.186) (-756.246) -- 0:00:04
921500 -- [-755.042] (-757.757) (-756.593) (-757.458) * (-755.093) [-754.699] (-755.100) (-760.375) -- 0:00:04
922000 -- (-754.350) (-757.762) (-762.166) [-754.813] * (-757.418) (-756.168) [-755.090] (-760.303) -- 0:00:04
922500 -- [-756.294] (-754.740) (-761.481) (-754.730) * (-757.007) (-757.044) (-756.228) [-754.937] -- 0:00:04
923000 -- (-755.783) [-756.294] (-754.492) (-755.395) * [-755.517] (-757.459) (-753.753) (-755.411) -- 0:00:04
923500 -- (-757.949) [-754.981] (-757.207) (-755.320) * (-757.048) [-756.372] (-754.861) (-755.320) -- 0:00:04
924000 -- (-755.498) [-755.849] (-755.756) (-756.802) * (-754.449) (-755.317) [-754.478] (-753.860) -- 0:00:04
924500 -- (-754.316) (-758.226) [-755.264] (-757.953) * [-755.468] (-755.324) (-754.487) (-757.753) -- 0:00:04
925000 -- [-754.262] (-757.281) (-754.234) (-758.047) * [-754.507] (-759.439) (-755.469) (-758.977) -- 0:00:04
Average standard deviation of split frequencies: 0.009537
925500 -- (-756.490) (-757.189) (-757.807) [-760.720] * [-753.716] (-756.845) (-758.979) (-754.624) -- 0:00:04
926000 -- (-754.370) [-755.748] (-753.843) (-758.767) * (-755.346) (-757.574) [-760.286] (-756.946) -- 0:00:04
926500 -- (-757.699) (-755.763) [-754.405] (-755.556) * [-756.198] (-760.634) (-758.668) (-757.855) -- 0:00:04
927000 -- (-760.171) (-755.160) [-755.226] (-755.206) * [-756.498] (-756.240) (-760.393) (-758.126) -- 0:00:04
927500 -- (-756.571) (-756.778) (-754.981) [-755.795] * (-755.031) [-756.056] (-756.182) (-756.968) -- 0:00:04
928000 -- (-754.870) [-754.536] (-754.605) (-759.152) * (-754.567) (-757.783) (-757.107) [-755.318] -- 0:00:04
928500 -- (-756.845) (-754.821) [-754.905] (-755.402) * (-755.136) [-755.748] (-759.819) (-757.307) -- 0:00:04
929000 -- (-755.525) (-755.661) (-755.241) [-756.264] * [-754.843] (-754.894) (-756.683) (-758.230) -- 0:00:04
929500 -- [-756.151] (-755.871) (-759.202) (-755.415) * (-756.269) (-759.142) [-754.867] (-755.660) -- 0:00:04
930000 -- (-755.426) [-754.007] (-763.704) (-755.750) * [-757.132] (-756.531) (-754.503) (-757.248) -- 0:00:04
Average standard deviation of split frequencies: 0.009219
930500 -- (-756.019) (-754.451) [-755.420] (-757.056) * (-756.326) (-758.634) (-756.351) [-755.239] -- 0:00:04
931000 -- (-756.849) [-756.963] (-757.040) (-754.784) * (-756.247) (-753.851) (-755.026) [-757.111] -- 0:00:04
931500 -- (-758.553) (-758.761) (-759.466) [-755.173] * [-758.503] (-753.802) (-757.241) (-754.431) -- 0:00:04
932000 -- (-754.938) (-754.545) (-755.258) [-756.284] * (-754.441) (-754.700) [-759.173] (-754.681) -- 0:00:04
932500 -- (-760.071) (-755.357) [-757.132] (-757.201) * (-754.679) (-756.599) [-755.574] (-757.372) -- 0:00:04
933000 -- [-761.687] (-758.060) (-754.897) (-756.851) * (-754.992) (-759.128) (-756.034) [-754.259] -- 0:00:04
933500 -- [-759.158] (-754.483) (-754.460) (-754.159) * (-757.616) [-756.124] (-757.006) (-754.135) -- 0:00:03
934000 -- [-756.492] (-756.831) (-756.772) (-757.847) * [-756.510] (-755.897) (-757.731) (-758.504) -- 0:00:03
934500 -- (-757.607) (-754.260) (-757.327) [-756.508] * (-756.346) (-758.008) [-754.873] (-758.661) -- 0:00:03
935000 -- (-755.351) (-756.297) (-755.111) [-754.496] * (-756.480) (-757.758) [-754.870] (-758.393) -- 0:00:03
Average standard deviation of split frequencies: 0.009065
935500 -- (-758.390) (-760.350) (-756.497) [-754.097] * [-757.973] (-757.380) (-757.216) (-756.483) -- 0:00:03
936000 -- (-756.856) (-755.645) [-755.593] (-754.552) * (-754.288) (-756.276) (-757.577) [-757.430] -- 0:00:03
936500 -- (-754.706) (-756.800) [-755.060] (-758.769) * (-754.944) (-758.087) [-758.221] (-757.840) -- 0:00:03
937000 -- (-758.027) (-756.860) (-755.041) [-756.055] * [-756.132] (-756.556) (-755.435) (-757.421) -- 0:00:03
937500 -- (-757.795) (-754.362) (-753.933) [-756.352] * (-754.529) (-760.136) [-755.577] (-755.213) -- 0:00:03
938000 -- (-758.995) [-756.194] (-753.950) (-761.307) * (-754.206) (-756.056) [-755.669] (-759.490) -- 0:00:03
938500 -- (-756.210) (-756.258) (-754.062) [-754.041] * (-760.408) (-761.112) (-754.342) [-755.887] -- 0:00:03
939000 -- [-758.537] (-756.941) (-760.503) (-755.546) * (-759.352) (-757.092) (-761.642) [-755.398] -- 0:00:03
939500 -- [-757.978] (-755.996) (-760.776) (-759.310) * (-753.707) [-758.406] (-758.677) (-755.518) -- 0:00:03
940000 -- [-756.218] (-757.153) (-755.086) (-755.963) * (-754.352) (-756.200) (-757.498) [-755.613] -- 0:00:03
Average standard deviation of split frequencies: 0.009188
940500 -- [-756.628] (-755.618) (-755.843) (-756.122) * (-755.033) (-756.844) (-757.806) [-755.034] -- 0:00:03
941000 -- (-755.868) (-755.198) [-757.344] (-755.233) * (-753.717) (-756.758) (-757.760) [-756.964] -- 0:00:03
941500 -- [-756.193] (-763.675) (-754.871) (-759.033) * (-754.221) (-756.541) (-756.160) [-757.547] -- 0:00:03
942000 -- (-755.091) [-759.486] (-756.597) (-757.855) * (-758.874) (-757.944) [-755.245] (-755.224) -- 0:00:03
942500 -- (-755.400) [-757.352] (-754.283) (-760.414) * (-758.166) (-755.513) [-754.430] (-759.075) -- 0:00:03
943000 -- (-755.634) (-758.138) [-755.804] (-755.358) * (-755.353) (-756.618) (-757.358) [-754.481] -- 0:00:03
943500 -- (-754.582) (-754.530) (-756.071) [-755.579] * (-755.256) (-755.375) [-756.363] (-754.435) -- 0:00:03
944000 -- (-755.562) [-755.204] (-756.317) (-757.032) * (-754.728) (-756.275) (-755.781) [-755.169] -- 0:00:03
944500 -- (-757.126) [-755.567] (-758.704) (-756.865) * (-755.925) [-755.696] (-758.862) (-755.730) -- 0:00:03
945000 -- (-757.611) [-756.371] (-753.925) (-756.209) * (-755.624) (-759.940) (-762.331) [-757.077] -- 0:00:03
Average standard deviation of split frequencies: 0.009202
945500 -- [-754.408] (-755.649) (-755.902) (-755.646) * (-754.473) (-756.517) (-761.659) [-755.469] -- 0:00:03
946000 -- (-755.320) (-758.282) (-754.585) [-754.852] * (-757.852) (-757.146) (-756.286) [-755.362] -- 0:00:03
946500 -- (-757.494) (-757.897) (-755.200) [-755.427] * (-755.849) (-757.360) [-755.482] (-756.058) -- 0:00:03
947000 -- (-758.207) (-757.841) (-754.104) [-755.816] * (-760.949) [-754.388] (-755.824) (-754.834) -- 0:00:03
947500 -- (-755.838) (-756.163) (-753.930) [-754.052] * (-756.206) (-756.948) (-757.059) [-754.460] -- 0:00:03
948000 -- [-754.246] (-758.131) (-755.210) (-755.442) * (-756.371) (-765.556) [-755.994] (-755.420) -- 0:00:03
948500 -- (-754.794) (-756.346) [-757.508] (-756.182) * (-756.422) (-754.654) (-756.554) [-755.159] -- 0:00:03
949000 -- [-754.943] (-754.458) (-757.328) (-755.443) * (-756.448) (-755.168) (-757.863) [-757.716] -- 0:00:03
949500 -- (-754.341) [-756.310] (-759.563) (-756.078) * (-754.060) [-757.825] (-756.213) (-756.276) -- 0:00:03
950000 -- [-754.787] (-755.968) (-760.351) (-756.400) * [-754.656] (-755.715) (-756.315) (-755.028) -- 0:00:03
Average standard deviation of split frequencies: 0.009025
950500 -- (-754.240) (-758.631) (-757.180) [-757.822] * (-757.627) (-757.363) (-755.639) [-754.171] -- 0:00:02
951000 -- (-756.779) (-758.185) [-759.823] (-758.257) * (-755.507) (-757.164) [-753.960] (-755.528) -- 0:00:02
951500 -- (-759.105) [-756.445] (-759.234) (-758.403) * (-755.492) [-754.059] (-758.913) (-754.508) -- 0:00:02
952000 -- [-757.154] (-753.921) (-758.262) (-758.096) * (-758.750) (-755.325) [-753.925] (-754.519) -- 0:00:02
952500 -- (-759.465) [-754.426] (-756.261) (-758.751) * [-757.378] (-756.204) (-755.135) (-755.838) -- 0:00:02
953000 -- (-754.779) [-754.974] (-755.115) (-756.012) * (-756.189) (-756.603) [-756.172] (-756.013) -- 0:00:02
953500 -- [-754.551] (-755.963) (-757.118) (-759.466) * [-755.702] (-756.409) (-757.477) (-755.741) -- 0:00:02
954000 -- (-757.313) (-756.537) (-755.485) [-755.725] * (-754.910) (-759.440) [-754.516] (-759.228) -- 0:00:02
954500 -- (-756.883) (-757.057) (-757.025) [-755.351] * (-754.780) (-758.049) [-753.834] (-754.600) -- 0:00:02
955000 -- (-760.823) [-757.114] (-759.658) (-754.963) * (-756.848) (-757.353) (-753.865) [-754.222] -- 0:00:02
Average standard deviation of split frequencies: 0.009040
955500 -- (-756.857) [-756.250] (-757.405) (-755.717) * (-755.126) (-760.436) (-757.105) [-754.581] -- 0:00:02
956000 -- (-760.681) (-756.734) [-756.448] (-754.299) * (-755.652) (-754.989) [-754.831] (-757.462) -- 0:00:02
956500 -- (-754.568) (-755.346) (-755.879) [-754.587] * (-761.708) [-755.341] (-759.010) (-757.989) -- 0:00:02
957000 -- (-758.313) (-754.677) [-758.211] (-754.782) * [-759.457] (-755.925) (-759.672) (-755.720) -- 0:00:02
957500 -- (-755.157) (-755.500) [-757.685] (-755.704) * (-754.963) (-757.021) (-756.245) [-756.397] -- 0:00:02
958000 -- (-755.428) [-758.279] (-756.452) (-759.933) * (-759.489) (-760.071) (-755.595) [-759.118] -- 0:00:02
958500 -- (-756.273) (-758.385) (-758.488) [-755.893] * [-756.004] (-756.344) (-754.936) (-757.139) -- 0:00:02
959000 -- (-757.787) (-754.190) (-756.817) [-756.395] * [-754.911] (-754.788) (-755.498) (-756.492) -- 0:00:02
959500 -- (-754.396) (-754.511) (-759.017) [-754.742] * (-759.054) (-758.743) (-756.932) [-755.331] -- 0:00:02
960000 -- (-755.863) (-754.911) (-755.255) [-753.988] * [-756.280] (-758.980) (-757.749) (-756.133) -- 0:00:02
Average standard deviation of split frequencies: 0.008996
960500 -- (-754.950) (-755.282) (-754.760) [-753.982] * (-754.427) (-755.953) (-755.691) [-756.370] -- 0:00:02
961000 -- [-755.430] (-760.618) (-754.863) (-754.766) * (-755.268) (-760.312) [-758.349] (-755.046) -- 0:00:02
961500 -- (-755.278) (-757.429) (-754.907) [-756.149] * (-754.803) (-755.787) (-759.383) [-755.034] -- 0:00:02
962000 -- [-755.146] (-757.072) (-755.581) (-755.788) * (-755.887) (-754.666) [-756.081] (-754.473) -- 0:00:02
962500 -- [-755.530] (-757.519) (-755.850) (-756.933) * (-762.563) (-755.442) [-757.873] (-757.059) -- 0:00:02
963000 -- [-755.241] (-755.654) (-755.714) (-761.925) * (-756.318) (-754.800) (-757.221) [-761.104] -- 0:00:02
963500 -- (-755.281) (-754.680) (-756.273) [-754.529] * (-756.682) [-755.606] (-757.284) (-756.117) -- 0:00:02
964000 -- [-756.655] (-759.226) (-756.258) (-756.372) * [-755.217] (-758.153) (-758.685) (-756.959) -- 0:00:02
964500 -- [-758.375] (-758.370) (-756.023) (-761.216) * (-757.495) [-757.431] (-758.633) (-756.226) -- 0:00:02
965000 -- (-758.004) (-755.097) [-756.128] (-762.835) * (-756.280) [-756.424] (-756.271) (-754.754) -- 0:00:02
Average standard deviation of split frequencies: 0.008589
965500 -- (-758.186) [-758.695] (-755.826) (-760.342) * (-758.495) [-755.607] (-757.175) (-756.473) -- 0:00:02
966000 -- (-759.870) (-758.226) [-758.426] (-756.935) * (-755.895) (-757.702) (-757.220) [-756.071] -- 0:00:02
966500 -- (-759.251) [-754.046] (-756.863) (-759.029) * (-759.646) [-755.149] (-755.078) (-758.175) -- 0:00:02
967000 -- (-756.883) (-756.244) (-755.878) [-756.466] * (-756.639) [-760.187] (-756.097) (-755.470) -- 0:00:01
967500 -- (-755.010) (-754.417) [-755.801] (-756.236) * (-755.375) (-756.186) [-754.022] (-756.084) -- 0:00:01
968000 -- (-756.319) (-754.425) (-755.795) [-755.825] * (-758.647) (-755.767) (-755.714) [-755.643] -- 0:00:01
968500 -- (-757.385) (-753.633) (-761.742) [-756.620] * (-758.485) [-755.452] (-757.149) (-754.566) -- 0:00:01
969000 -- [-754.377] (-755.337) (-758.662) (-756.523) * (-756.699) [-755.086] (-753.922) (-755.184) -- 0:00:01
969500 -- (-754.601) (-754.664) (-758.989) [-754.895] * [-754.898] (-755.340) (-753.903) (-756.861) -- 0:00:01
970000 -- (-755.795) [-755.046] (-757.744) (-754.981) * (-759.265) (-754.404) (-755.268) [-755.323] -- 0:00:01
Average standard deviation of split frequencies: 0.008321
970500 -- (-754.804) (-757.575) (-756.473) [-755.047] * (-756.668) [-756.640] (-755.804) (-754.524) -- 0:00:01
971000 -- (-754.665) (-755.434) (-757.274) [-756.579] * [-758.523] (-756.554) (-755.696) (-753.905) -- 0:00:01
971500 -- (-754.634) (-755.961) (-757.236) [-756.493] * (-758.923) (-757.470) [-756.384] (-754.464) -- 0:00:01
972000 -- [-754.702] (-756.149) (-757.993) (-755.790) * (-755.312) (-756.540) (-754.434) [-754.452] -- 0:00:01
972500 -- (-754.325) (-754.592) (-759.865) [-756.126] * (-754.814) (-756.142) [-755.181] (-756.475) -- 0:00:01
973000 -- (-756.323) (-756.510) (-757.244) [-754.438] * (-762.489) (-756.829) [-754.057] (-755.436) -- 0:00:01
973500 -- (-759.209) (-758.519) [-755.744] (-755.156) * (-758.148) (-761.299) (-757.091) [-756.390] -- 0:00:01
974000 -- (-757.549) (-759.183) (-755.443) [-757.192] * (-755.280) [-754.753] (-755.625) (-756.536) -- 0:00:01
974500 -- [-755.846] (-755.208) (-756.271) (-755.279) * [-755.644] (-758.190) (-756.363) (-755.847) -- 0:00:01
975000 -- [-754.528] (-754.275) (-756.007) (-756.995) * (-755.344) (-760.437) (-754.693) [-754.237] -- 0:00:01
Average standard deviation of split frequencies: 0.008533
975500 -- (-755.357) (-753.858) [-755.791] (-758.618) * (-759.430) (-756.496) (-755.148) [-754.381] -- 0:00:01
976000 -- (-755.276) (-753.869) (-758.137) [-754.475] * (-755.679) (-756.333) [-757.571] (-754.314) -- 0:00:01
976500 -- [-756.588] (-755.576) (-758.949) (-757.616) * [-754.933] (-759.815) (-758.712) (-754.711) -- 0:00:01
977000 -- (-756.547) [-754.149] (-754.796) (-757.128) * [-754.509] (-758.149) (-755.896) (-754.305) -- 0:00:01
977500 -- [-757.367] (-758.408) (-755.564) (-754.584) * (-757.031) (-754.467) [-754.405] (-756.118) -- 0:00:01
978000 -- (-757.023) (-754.938) [-755.564] (-755.483) * (-758.151) (-756.203) (-754.901) [-757.405] -- 0:00:01
978500 -- (-756.435) [-755.059] (-756.661) (-758.312) * (-757.124) [-756.169] (-754.100) (-755.300) -- 0:00:01
979000 -- (-754.515) (-756.370) [-759.269] (-756.073) * (-755.763) [-756.950] (-755.160) (-756.255) -- 0:00:01
979500 -- (-755.726) [-756.360] (-755.882) (-755.186) * (-755.173) [-755.357] (-754.629) (-754.550) -- 0:00:01
980000 -- (-758.289) [-757.779] (-754.989) (-760.922) * [-756.811] (-755.311) (-757.132) (-756.695) -- 0:00:01
Average standard deviation of split frequencies: 0.008204
980500 -- (-755.669) [-756.189] (-755.344) (-757.758) * [-757.549] (-757.653) (-756.473) (-755.555) -- 0:00:01
981000 -- [-759.246] (-758.156) (-754.819) (-756.108) * (-756.258) (-754.560) [-756.990] (-757.300) -- 0:00:01
981500 -- (-757.341) (-757.463) (-754.880) [-755.058] * (-756.260) (-754.562) [-754.174] (-754.999) -- 0:00:01
982000 -- (-755.121) (-754.992) [-756.683] (-756.168) * (-754.555) (-758.965) (-754.893) [-754.053] -- 0:00:01
982500 -- (-755.022) (-754.056) [-756.909] (-756.957) * (-754.299) (-755.416) [-754.065] (-755.814) -- 0:00:01
983000 -- [-755.590] (-755.624) (-755.237) (-754.560) * [-754.130] (-754.472) (-753.994) (-756.634) -- 0:00:01
983500 -- (-755.567) [-756.891] (-757.933) (-754.686) * (-757.559) [-756.249] (-755.219) (-756.300) -- 0:00:00
984000 -- (-756.018) (-754.810) (-758.826) [-756.861] * (-754.762) [-758.599] (-754.880) (-754.546) -- 0:00:00
984500 -- (-755.299) [-756.404] (-760.977) (-757.168) * (-756.211) (-754.247) (-757.421) [-754.500] -- 0:00:00
985000 -- (-754.600) (-754.909) [-761.234] (-757.660) * [-755.440] (-754.247) (-756.831) (-754.632) -- 0:00:00
Average standard deviation of split frequencies: 0.008096
985500 -- (-754.638) (-754.786) (-757.880) [-755.331] * [-755.000] (-754.692) (-754.695) (-754.550) -- 0:00:00
986000 -- (-754.815) [-755.915] (-756.763) (-754.464) * (-758.964) (-754.736) [-754.793] (-755.497) -- 0:00:00
986500 -- [-756.901] (-754.559) (-760.773) (-754.454) * (-756.318) [-754.713] (-757.622) (-758.228) -- 0:00:00
987000 -- (-758.617) (-756.646) (-759.817) [-754.540] * (-755.039) (-756.506) [-757.015] (-760.785) -- 0:00:00
987500 -- (-758.113) (-756.745) (-755.798) [-756.274] * (-756.874) (-754.859) (-756.437) [-756.116] -- 0:00:00
988000 -- (-758.223) (-758.988) [-756.724] (-757.772) * (-758.696) [-754.170] (-755.763) (-762.123) -- 0:00:00
988500 -- (-757.092) (-758.727) [-755.969] (-756.424) * (-758.904) (-754.928) [-754.234] (-758.448) -- 0:00:00
989000 -- [-753.990] (-756.451) (-755.475) (-759.912) * (-756.430) [-755.881] (-758.734) (-755.767) -- 0:00:00
989500 -- (-754.863) (-754.977) [-757.667] (-756.952) * (-755.866) [-756.047] (-763.242) (-755.127) -- 0:00:00
990000 -- (-755.754) (-759.102) [-757.716] (-757.795) * (-754.047) (-761.898) [-757.093] (-758.358) -- 0:00:00
Average standard deviation of split frequencies: 0.008153
990500 -- (-755.542) (-756.472) [-754.420] (-756.432) * (-756.432) [-756.008] (-757.857) (-756.354) -- 0:00:00
991000 -- (-757.560) (-759.762) [-755.282] (-759.717) * (-760.352) (-762.847) (-755.325) [-757.378] -- 0:00:00
991500 -- (-760.514) (-759.900) [-754.721] (-759.914) * (-760.756) (-755.982) (-754.152) [-764.513] -- 0:00:00
992000 -- (-758.771) (-756.114) [-754.865] (-756.217) * [-758.477] (-755.931) (-754.588) (-755.975) -- 0:00:00
992500 -- (-758.997) (-760.848) (-756.214) [-754.646] * [-755.675] (-757.057) (-754.531) (-755.570) -- 0:00:00
993000 -- (-761.326) [-754.315] (-754.628) (-755.276) * (-754.575) (-760.284) (-754.888) [-760.425] -- 0:00:00
993500 -- (-756.197) (-754.273) (-755.165) [-756.092] * (-754.417) (-754.462) (-756.183) [-755.584] -- 0:00:00
994000 -- (-755.011) (-758.570) (-759.922) [-754.557] * (-758.781) (-756.335) (-755.546) [-755.906] -- 0:00:00
994500 -- (-757.637) (-754.734) (-758.625) [-754.053] * (-755.315) [-758.574] (-756.489) (-758.395) -- 0:00:00
995000 -- (-755.250) (-755.775) (-757.012) [-757.090] * (-755.392) (-758.341) (-756.939) [-755.769] -- 0:00:00
Average standard deviation of split frequencies: 0.008582
995500 -- (-754.372) (-755.252) (-757.535) [-756.384] * [-753.896] (-756.960) (-758.527) (-754.035) -- 0:00:00
996000 -- [-756.249] (-759.378) (-756.629) (-756.297) * (-755.484) (-759.041) (-756.810) [-756.323] -- 0:00:00
996500 -- [-757.651] (-758.675) (-759.860) (-756.562) * (-755.767) (-754.225) (-756.548) [-756.442] -- 0:00:00
997000 -- [-756.369] (-757.453) (-754.670) (-756.003) * (-757.501) [-758.015] (-758.486) (-756.290) -- 0:00:00
997500 -- (-759.322) (-754.804) [-759.220] (-756.930) * (-758.144) [-758.505] (-755.073) (-756.938) -- 0:00:00
998000 -- (-756.013) (-757.081) (-764.826) [-757.856] * [-757.442] (-756.192) (-759.050) (-754.197) -- 0:00:00
998500 -- (-755.876) (-757.205) (-755.203) [-758.340] * (-756.539) [-754.554] (-755.668) (-756.295) -- 0:00:00
999000 -- [-758.755] (-755.059) (-755.563) (-754.812) * (-754.930) (-753.983) [-755.317] (-754.346) -- 0:00:00
999500 -- (-757.670) [-758.078] (-755.930) (-756.962) * [-756.764] (-755.404) (-755.772) (-760.788) -- 0:00:00
1000000 -- (-760.643) (-754.900) [-755.334] (-757.682) * [-756.368] (-756.281) (-757.003) (-755.245) -- 0:00:00
Average standard deviation of split frequencies: 0.008794
Analysis completed in 60 seconds
Analysis used 59.31 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -753.55
Likelihood of best state for "cold" chain of run 2 was -753.55
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.9 % ( 61 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
29.6 % ( 26 %) Dirichlet(Pi{all})
30.9 % ( 25 %) Slider(Pi{all})
78.9 % ( 59 %) Multiplier(Alpha{1,2})
77.6 % ( 59 %) Multiplier(Alpha{3})
22.6 % ( 31 %) Slider(Pinvar{all})
98.7 % ( 97 %) ExtSPR(Tau{all},V{all})
70.2 % ( 75 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 89 %) ParsSPR(Tau{all},V{all})
28.1 % ( 32 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.4 % ( 38 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.1 % ( 73 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
29.7 % ( 17 %) Dirichlet(Pi{all})
31.5 % ( 22 %) Slider(Pi{all})
79.0 % ( 55 %) Multiplier(Alpha{1,2})
77.0 % ( 48 %) Multiplier(Alpha{3})
23.0 % ( 24 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
69.8 % ( 62 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.7 % ( 91 %) ParsSPR(Tau{all},V{all})
28.2 % ( 24 %) Multiplier(V{all})
97.5 % (100 %) Nodeslider(V{all})
30.5 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166311 0.82 0.67
3 | 167200 167050 0.84
4 | 166930 165999 166510
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166325 0.82 0.66
3 | 167344 166122 0.84
4 | 167013 166777 166419
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -755.32
| 2 2 2 |
| 1 2 1 2 |
| 2 2 1 22 1 2 2 |
| 1 2 1 2 1 2 1 |
| 22 2 2 1 1 * 12 1 |
|2 1 2 211 2 1 1 2 |
| 1 1 1 2 1 2 1 |
|1 1 1 1 12 22 1 2 211112 |
| 2 2 *1 1* * 2111 2 1 1 1 1|
| 1 1 2 21 22 2 1 1 1 2 2 |
| 2 2 * 2 2 1 |
| 1 2 2 1 2 2 |
| 1 1 2 |
| 1 2|
| 2 1 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -756.88
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -755.33 -758.60
2 -755.26 -758.91
--------------------------------------
TOTAL -755.29 -758.77
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.884746 0.086031 0.362795 1.466667 0.844419 1462.39 1481.70 1.000
r(A<->C){all} 0.170083 0.020969 0.000051 0.457426 0.130541 238.79 297.99 1.000
r(A<->G){all} 0.159006 0.019734 0.000054 0.456830 0.118516 190.92 262.51 1.001
r(A<->T){all} 0.156928 0.018793 0.000040 0.445112 0.119603 171.01 223.37 1.000
r(C<->G){all} 0.176808 0.020989 0.000014 0.461258 0.139451 198.48 276.04 1.000
r(C<->T){all} 0.178124 0.020837 0.000010 0.473373 0.142709 227.20 268.21 1.001
r(G<->T){all} 0.159052 0.018291 0.000019 0.435830 0.125030 293.53 310.39 1.000
pi(A){all} 0.209940 0.000287 0.176773 0.242565 0.209799 1254.53 1313.93 1.000
pi(C){all} 0.290440 0.000365 0.253180 0.327951 0.290599 1228.56 1293.04 1.001
pi(G){all} 0.351754 0.000415 0.312692 0.392191 0.351923 1320.05 1370.31 1.000
pi(T){all} 0.147866 0.000223 0.119611 0.177233 0.147734 1349.17 1355.98 1.000
alpha{1,2} 0.407397 0.225170 0.000103 1.361250 0.244771 1261.36 1283.27 1.000
alpha{3} 0.465577 0.266018 0.000446 1.467284 0.293459 1102.88 1126.87 1.000
pinvar{all} 0.997239 0.000010 0.991339 1.000000 0.998237 773.65 993.16 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...*.*
8 -- .*..*.
9 -- .****.
10 -- .*.***
11 -- .*.*..
12 -- .**...
13 -- ..**..
14 -- .***.*
15 -- ..****
16 -- ....**
17 -- ..*..*
18 -- ..*.*.
19 -- ...**.
20 -- .**.**
21 -- .*...*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 459 0.152898 0.015546 0.141905 0.163891 2
8 453 0.150899 0.018373 0.137908 0.163891 2
9 442 0.147235 0.005653 0.143238 0.151233 2
10 441 0.146902 0.004240 0.143904 0.149900 2
11 438 0.145903 0.012248 0.137242 0.154564 2
12 438 0.145903 0.002827 0.143904 0.147901 2
13 429 0.142905 0.003298 0.140573 0.145237 2
14 425 0.141572 0.000471 0.141239 0.141905 2
15 424 0.141239 0.009422 0.134577 0.147901 2
16 422 0.140573 0.005653 0.136576 0.144570 2
17 414 0.137908 0.012248 0.129247 0.146569 2
18 412 0.137242 0.006595 0.132578 0.141905 2
19 412 0.137242 0.021670 0.121919 0.152565 2
20 407 0.135576 0.005182 0.131912 0.139241 2
21 404 0.134577 0.008480 0.128581 0.140573 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099471 0.009572 0.000002 0.290324 0.070446 1.000 2
length{all}[2] 0.100246 0.010357 0.000001 0.299755 0.070293 1.000 2
length{all}[3] 0.097632 0.009233 0.000092 0.283941 0.069848 1.000 2
length{all}[4] 0.099897 0.010017 0.000036 0.298687 0.069637 1.000 2
length{all}[5] 0.096101 0.009877 0.000007 0.290717 0.066601 1.000 2
length{all}[6] 0.098314 0.009964 0.000009 0.291733 0.067667 1.000 2
length{all}[7] 0.106699 0.013690 0.000181 0.331353 0.070118 1.002 2
length{all}[8] 0.095114 0.008678 0.000069 0.275150 0.064865 0.998 2
length{all}[9] 0.097652 0.010657 0.000388 0.288684 0.068454 0.998 2
length{all}[10] 0.098726 0.011166 0.000654 0.282837 0.066265 1.001 2
length{all}[11] 0.099291 0.009168 0.000027 0.284762 0.067808 0.998 2
length{all}[12] 0.103888 0.010264 0.000062 0.326943 0.073976 0.998 2
length{all}[13] 0.099307 0.011184 0.000043 0.311439 0.068014 1.000 2
length{all}[14] 0.102608 0.009751 0.000292 0.292505 0.069933 0.998 2
length{all}[15] 0.096816 0.009491 0.000216 0.298088 0.069407 0.999 2
length{all}[16] 0.099527 0.010557 0.000185 0.285501 0.072695 0.998 2
length{all}[17] 0.101087 0.010848 0.000191 0.320122 0.072331 1.013 2
length{all}[18] 0.101069 0.011004 0.000268 0.303230 0.066051 1.000 2
length{all}[19] 0.092079 0.008611 0.000155 0.280033 0.062162 0.999 2
length{all}[20] 0.088308 0.005893 0.000310 0.240750 0.061962 0.998 2
length{all}[21] 0.084814 0.006375 0.000087 0.241761 0.057587 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008794
Maximum standard deviation of split frequencies = 0.021670
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.013
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|-------------------------------------------------------------------- C5 (5)
|
\--------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 564
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 43 patterns at 188 / 188 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 43 patterns at 188 / 188 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
41968 bytes for conP
3784 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.097944 0.044091 0.049355 0.038655 0.092838 0.060927 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -788.026866
Iterating by ming2
Initial: fx= 788.026866
x= 0.09794 0.04409 0.04936 0.03866 0.09284 0.06093 0.30000 1.30000
1 h-m-p 0.0000 0.0002 446.0014 +++ 745.857410 m 0.0002 14 | 1/8
2 h-m-p 0.0005 0.0026 72.4177 ++ 743.224262 m 0.0026 25 | 2/8
3 h-m-p 0.0000 0.0000 11717.7014 ++ 742.106394 m 0.0000 36 | 3/8
4 h-m-p 0.0000 0.0002 101.1347 ++ 739.996556 m 0.0002 47 | 4/8
5 h-m-p 0.0001 0.0006 145.9045 ++ 730.211710 m 0.0006 58 | 5/8
6 h-m-p 0.0001 0.0005 447.5208 ++ 724.642191 m 0.0005 69 | 6/8
7 h-m-p 0.0160 8.0000 20.7389 -------------.. | 6/8
8 h-m-p 0.0000 0.0002 182.3270 +++ 717.724497 m 0.0002 103 | 7/8
9 h-m-p 1.6000 8.0000 0.0000 Y 717.724497 0 0.4000 114 | 7/8
10 h-m-p 0.0160 8.0000 0.0000 -C 717.724497 0 0.0010 127
Out..
lnL = -717.724497
128 lfun, 128 eigenQcodon, 768 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.105084 0.050619 0.093901 0.068663 0.082031 0.097054 0.000100 0.760913 0.367949
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.184025
np = 9
lnL0 = -805.988673
Iterating by ming2
Initial: fx= 805.988673
x= 0.10508 0.05062 0.09390 0.06866 0.08203 0.09705 0.00011 0.76091 0.36795
1 h-m-p 0.0000 0.0000 417.7084 ++ 805.720182 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0003 543.9036 +++ 752.476192 m 0.0003 27 | 2/9
3 h-m-p 0.0000 0.0000 1140.0793 ++ 737.149917 m 0.0000 39 | 3/9
4 h-m-p 0.0003 0.0015 92.7388 ++ 724.159764 m 0.0015 51 | 4/9
5 h-m-p 0.0000 0.0001 1136.6368 ++ 720.683021 m 0.0001 63 | 5/9
6 h-m-p 0.0017 0.0083 4.3984 -----------.. | 5/9
7 h-m-p 0.0000 0.0000 319.0107 ++ 719.265348 m 0.0000 96 | 6/9
8 h-m-p 0.0006 0.1238 6.2064 -----------.. | 6/9
9 h-m-p 0.0000 0.0000 262.3896 ++ 718.589830 m 0.0000 129 | 7/9
10 h-m-p 0.0003 0.1182 6.4949 ----------.. | 7/9
11 h-m-p 0.0000 0.0000 186.0589 ++ 717.724574 m 0.0000 161 | 8/9
12 h-m-p 1.6000 8.0000 0.0000 ++ 717.724574 m 8.0000 173 | 7/9
13 h-m-p 0.0160 8.0000 0.0176 +++++ 717.724548 m 8.0000 189 | 7/9
14 h-m-p 0.6824 3.4118 0.1852 ++ 717.724506 m 3.4118 203 | 8/9
15 h-m-p 1.6000 8.0000 0.0000 N 717.724506 0 0.4000 217 | 8/9
16 h-m-p 0.5000 8.0000 0.0000 N 717.724506 0 0.5000 230 | 8/9
17 h-m-p 0.0011 0.5575 1.6294 +++++ 717.724506 m 0.5575 246 | 9/9
18 h-m-p 0.0160 8.0000 0.0000 Y 717.724506 0 0.0160 258 | 9/9
19 h-m-p 0.0160 8.0000 0.0000 Y 717.724506 0 0.0160 270
Out..
lnL = -717.724506
271 lfun, 813 eigenQcodon, 3252 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.104937 0.091445 0.029911 0.027343 0.086919 0.058209 0.000100 1.368789 0.442279 0.372890 1.442871
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.005260
np = 11
lnL0 = -787.617466
Iterating by ming2
Initial: fx= 787.617466
x= 0.10494 0.09144 0.02991 0.02734 0.08692 0.05821 0.00011 1.36879 0.44228 0.37289 1.44287
1 h-m-p 0.0000 0.0000 409.3912 ++ 787.263177 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0006 266.0018 +++ 758.207476 m 0.0006 31 | 2/11
3 h-m-p 0.0000 0.0000 261.9158 ++ 756.335969 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0011 147.2464 +++ 736.338628 m 0.0011 60 | 4/11
5 h-m-p 0.0000 0.0000 5000.8793 ++ 723.031694 m 0.0000 74 | 5/11
6 h-m-p 0.0014 0.0070 8.7305 -----------.. | 5/11
7 h-m-p 0.0000 0.0000 312.8319 ++ 721.695699 m 0.0000 111 | 6/11
8 h-m-p 0.0160 8.0000 2.9273 -------------.. | 6/11
9 h-m-p 0.0000 0.0000 256.8270 ++ 720.114844 m 0.0000 150 | 7/11
10 h-m-p 0.0160 8.0000 1.9835 -------------.. | 7/11
11 h-m-p 0.0000 0.0001 182.6970 ++ 717.724539 m 0.0001 189 | 8/11
12 h-m-p 0.0489 8.0000 0.0000 ++++ 717.724539 m 8.0000 205 | 8/11
13 h-m-p 0.0160 8.0000 0.0284 +++++ 717.724534 m 8.0000 225 | 8/11
14 h-m-p 0.1309 0.6547 1.6680 ++ 717.724518 m 0.6547 242 | 8/11
15 h-m-p -0.0000 -0.0000 0.8076
h-m-p: -0.00000000e+00 -0.00000000e+00 8.07643158e-01 717.724518
.. | 8/11
16 h-m-p 0.0160 8.0000 0.0000 +++++ 717.724518 m 8.0000 273 | 8/11
17 h-m-p 0.0160 8.0000 0.4931 +++++ 717.724502 m 8.0000 293 | 8/11
18 h-m-p 1.6000 8.0000 0.1061 ++ 717.724502 m 8.0000 310 | 8/11
19 h-m-p 1.6000 8.0000 0.0706 Y 717.724502 0 0.6989 327 | 8/11
20 h-m-p 1.6000 8.0000 0.0011 ++ 717.724502 m 8.0000 344 | 8/11
21 h-m-p 1.3191 8.0000 0.0064 ++ 717.724502 m 8.0000 361 | 8/11
22 h-m-p 1.6000 8.0000 0.0053 ++ 717.724502 m 8.0000 378 | 8/11
23 h-m-p 0.1708 8.0000 0.2506 ++C 717.724502 0 3.6259 397 | 8/11
24 h-m-p 1.6000 8.0000 0.0948 ++ 717.724500 m 8.0000 414 | 8/11
25 h-m-p 0.2626 1.3128 2.1723 ---------------.. | 8/11
26 h-m-p 0.0160 8.0000 0.0000 +++++ 717.724500 m 8.0000 461 | 8/11
27 h-m-p 0.0241 8.0000 0.0016 -----Y 717.724500 0 0.0000 483 | 8/11
28 h-m-p 0.0160 8.0000 0.0000 +++++ 717.724500 m 8.0000 503 | 8/11
29 h-m-p 0.0160 8.0000 9.8996 +++++ 717.724463 m 8.0000 523 | 8/11
30 h-m-p 1.6000 8.0000 0.8365 ++ 717.724463 m 8.0000 537 | 8/11
31 h-m-p 1.6000 8.0000 1.9249 ++ 717.724463 m 8.0000 554 | 8/11
32 h-m-p 0.6638 4.5428 23.1982 --------C 717.724463 0 0.0000 576 | 8/11
33 h-m-p 1.6000 8.0000 0.0000 -C 717.724463 0 0.1000 591 | 8/11
34 h-m-p 0.2920 8.0000 0.0000 C 717.724463 0 0.2920 608 | 8/11
35 h-m-p 0.0247 8.0000 0.0001 ---Y 717.724463 0 0.0001 628
Out..
lnL = -717.724463
629 lfun, 2516 eigenQcodon, 11322 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -717.720282 S = -717.720101 -0.000069
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 43 patterns 0:04
did 20 / 43 patterns 0:04
did 30 / 43 patterns 0:04
did 40 / 43 patterns 0:04
did 43 / 43 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.012728 0.019911 0.069163 0.023685 0.085710 0.056131 0.000100 1.119663 1.209917
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 12.821067
np = 9
lnL0 = -765.862955
Iterating by ming2
Initial: fx= 765.862955
x= 0.01273 0.01991 0.06916 0.02368 0.08571 0.05613 0.00011 1.11966 1.20992
1 h-m-p 0.0000 0.0000 429.8653 ++ 765.285641 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0385 29.2611 ++++CYYCCC 764.309942 5 0.0278 38 | 1/9
3 h-m-p 0.0103 0.0514 4.2878 -------------.. | 1/9
4 h-m-p 0.0000 0.0002 416.0848 +++ 730.631606 m 0.0002 74 | 2/9
5 h-m-p 0.0055 0.1020 12.9350 ------------.. | 2/9
6 h-m-p 0.0000 0.0000 407.7121 ++ 728.064878 m 0.0000 108 | 3/9
7 h-m-p 0.0006 0.2023 9.6253 -----------.. | 3/9
8 h-m-p 0.0000 0.0000 366.2527 ++ 727.011130 m 0.0000 141 | 4/9
9 h-m-p 0.0005 0.2403 8.6626 -----------.. | 4/9
10 h-m-p 0.0000 0.0001 317.2721 ++ 720.405423 m 0.0001 174 | 5/9
11 h-m-p 0.0020 0.3314 8.3521 ------------.. | 5/9
12 h-m-p 0.0000 0.0000 263.3504 ++ 718.742140 m 0.0000 208 | 6/9
13 h-m-p 0.0010 0.5096 8.5426 -----------.. | 6/9
14 h-m-p 0.0000 0.0000 186.9261 ++ 717.724584 m 0.0000 241 | 7/9
15 h-m-p 0.3703 8.0000 0.0000 +++ 717.724584 m 8.0000 254 | 7/9
16 h-m-p 0.1459 8.0000 0.0001 ----C 717.724584 0 0.0001 272 | 7/9
17 h-m-p 0.0160 8.0000 0.0001 +++++ 717.724584 m 8.0000 289 | 7/9
18 h-m-p 0.0160 8.0000 0.3838 +++++ 717.724581 m 8.0000 306 | 7/9
19 h-m-p 1.6000 8.0000 0.4226 ++ 717.724581 m 8.0000 320 | 7/9
20 h-m-p 1.6000 8.0000 2.0900 ++ 717.724580 m 8.0000 334 | 7/9
21 h-m-p 1.6000 8.0000 0.3377 ++ 717.724580 m 8.0000 346 | 7/9
22 h-m-p 0.7869 7.8885 3.4328 --------C 717.724580 0 0.0000 368 | 7/9
23 h-m-p 0.6469 8.0000 0.0000 -----Y 717.724580 0 0.0002 385 | 7/9
24 h-m-p 1.6000 8.0000 0.0000 ----------Y 717.724580 0 0.0000 409
Out..
lnL = -717.724580
410 lfun, 4510 eigenQcodon, 24600 P(t)
Time used: 0:10
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.084086 0.027829 0.021176 0.034688 0.106009 0.088181 0.000100 0.900000 0.773235 1.762974 1.306615
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 14.315645
np = 11
lnL0 = -780.058528
Iterating by ming2
Initial: fx= 780.058528
x= 0.08409 0.02783 0.02118 0.03469 0.10601 0.08818 0.00011 0.90000 0.77323 1.76297 1.30662
1 h-m-p 0.0000 0.0000 395.0341 ++ 779.808243 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0007 197.4029 ++++ 757.958610 m 0.0007 32 | 2/11
3 h-m-p 0.0000 0.0001 263.1125 ++ 752.190689 m 0.0001 46 | 3/11
4 h-m-p 0.0003 0.0015 74.1194 ++ 746.887706 m 0.0015 60 | 4/11
5 h-m-p 0.0001 0.0005 442.4287 ++ 722.305783 m 0.0005 74 | 5/11
6 h-m-p 0.0002 0.0008 115.3691 ++ 720.644615 m 0.0008 88 | 6/11
7 h-m-p 0.0000 0.0003 2408.7259 ++ 717.780193 m 0.0003 102 | 6/11
8 h-m-p 0.0034 0.0168 94.7740 ------------.. | 6/11
9 h-m-p 0.0000 0.0000 184.7054 ++ 717.724512 m 0.0000 140 | 7/11
10 h-m-p 0.0160 8.0000 0.0000 Y 717.724512 0 0.0160 154 | 7/11
11 h-m-p 0.0160 8.0000 0.0000 Y 717.724512 0 0.0040 172
Out..
lnL = -717.724512
173 lfun, 2076 eigenQcodon, 11418 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -717.734106 S = -717.721358 -0.005596
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 43 patterns 0:14
did 20 / 43 patterns 0:14
did 30 / 43 patterns 0:14
did 40 / 43 patterns 0:14
did 43 / 43 patterns 0:14
Time used: 0:14
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=188
NC_011896_1_WP_010908911_1_2623_MLBR_RS12480 MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
NC_002677_1_NP_302592_1_1464_ML2454 MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
NZ_LVXE01000039_1_WP_010908911_1_1690_A3216_RS10255 MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
NZ_LYPH01000045_1_WP_010908911_1_1820_A8144_RS08680 MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
NZ_CP029543_1_WP_010908911_1_2650_DIJ64_RS13495 MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
NZ_AP014567_1_WP_010908911_1_2716_JK2ML_RS13825 MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV
**************************************************
NC_011896_1_WP_010908911_1_2623_MLBR_RS12480 EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
NC_002677_1_NP_302592_1_1464_ML2454 EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
NZ_LVXE01000039_1_WP_010908911_1_1690_A3216_RS10255 EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
NZ_LYPH01000045_1_WP_010908911_1_1820_A8144_RS08680 EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
NZ_CP029543_1_WP_010908911_1_2650_DIJ64_RS13495 EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
NZ_AP014567_1_WP_010908911_1_2716_JK2ML_RS13825 EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE
**************************************************
NC_011896_1_WP_010908911_1_2623_MLBR_RS12480 RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
NC_002677_1_NP_302592_1_1464_ML2454 RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
NZ_LVXE01000039_1_WP_010908911_1_1690_A3216_RS10255 RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
NZ_LYPH01000045_1_WP_010908911_1_1820_A8144_RS08680 RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
NZ_CP029543_1_WP_010908911_1_2650_DIJ64_RS13495 RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
NZ_AP014567_1_WP_010908911_1_2716_JK2ML_RS13825 RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR
**************************************************
NC_011896_1_WP_010908911_1_2623_MLBR_RS12480 AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
NC_002677_1_NP_302592_1_1464_ML2454 AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
NZ_LVXE01000039_1_WP_010908911_1_1690_A3216_RS10255 AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
NZ_LYPH01000045_1_WP_010908911_1_1820_A8144_RS08680 AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
NZ_CP029543_1_WP_010908911_1_2650_DIJ64_RS13495 AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
NZ_AP014567_1_WP_010908911_1_2716_JK2ML_RS13825 AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
**************************************
>NC_011896_1_WP_010908911_1_2623_MLBR_RS12480 ATGGCTGAAAACCCTAACGTCGACGACCTGCGGGCGCCATTGTTGGCAGC GCTGGGCGCGGCAGACTTGGCCCTGACCACCGTTAATGAGCTGGTCGGCA ACATGCGCGAACGTGCCGAAGAAACCCGCATCGATACCCGCAGCCGTGTT GAGGAGAGCCGCGCTCGCGTGGCAAAACTGCAGGAGGTTCTGCCCGAACA CCTTAGCGAGCTGCGTGAGAAGTTCACCGCCGACGAGTTGCGTAAGGCCG CTGAGGGCTATTTGGAGGCAGCGACCAACCGGTACAACGAGCTAGTCGAG CGCGGCGAGGCCGCCCTGGAGCGGTTACGCAGCCGGCCGGTTTTCGAAGA TGCGTCGGCACGTGCCGAGGGTTACGTGGACCAGGCTGTCGAGTTGACTC AGGAGGCGCTGGGTACTGTCGCGTCGCAGACCCGCGCGGTTGGCGGGCGT GCAGCCAAACTGGTCGGCATCGAGCTACCCAAGAAGGCGGCGGCGCCTGC GAGGAAGGCTCCGGCCAAGAAGGCGCCTGCGAAGAAGGCTCCGGCCAAGA AGGTCACACAGAAA >NC_002677_1_NP_302592_1_1464_ML2454 ATGGCTGAAAACCCTAACGTCGACGACCTGCGGGCGCCATTGTTGGCAGC GCTGGGCGCGGCAGACTTGGCCCTGACCACCGTTAATGAGCTGGTCGGCA ACATGCGCGAACGTGCCGAAGAAACCCGCATCGATACCCGCAGCCGTGTT GAGGAGAGCCGCGCTCGCGTGGCAAAACTGCAGGAGGTTCTGCCCGAACA CCTTAGCGAGCTGCGTGAGAAGTTCACCGCCGACGAGTTGCGTAAGGCCG CTGAGGGCTATTTGGAGGCAGCGACCAACCGGTACAACGAGCTAGTCGAG CGCGGCGAGGCCGCCCTGGAGCGGTTACGCAGCCGGCCGGTTTTCGAAGA TGCGTCGGCACGTGCCGAGGGTTACGTGGACCAGGCTGTCGAGTTGACTC AGGAGGCGCTGGGTACTGTCGCGTCGCAGACCCGCGCGGTTGGCGGGCGT GCAGCCAAACTGGTCGGCATCGAGCTACCCAAGAAGGCGGCGGCGCCTGC GAGGAAGGCTCCGGCCAAGAAGGCGCCTGCGAAGAAGGCTCCGGCCAAGA AGGTCACACAGAAA >NZ_LVXE01000039_1_WP_010908911_1_1690_A3216_RS10255 ATGGCTGAAAACCCTAACGTCGACGACCTGCGGGCGCCATTGTTGGCAGC GCTGGGCGCGGCAGACTTGGCCCTGACCACCGTTAATGAGCTGGTCGGCA ACATGCGCGAACGTGCCGAAGAAACCCGCATCGATACCCGCAGCCGTGTT GAGGAGAGCCGCGCTCGCGTGGCAAAACTGCAGGAGGTTCTGCCCGAACA CCTTAGCGAGCTGCGTGAGAAGTTCACCGCCGACGAGTTGCGTAAGGCCG CTGAGGGCTATTTGGAGGCAGCGACCAACCGGTACAACGAGCTAGTCGAG CGCGGCGAGGCCGCCCTGGAGCGGTTACGCAGCCGGCCGGTTTTCGAAGA TGCGTCGGCACGTGCCGAGGGTTACGTGGACCAGGCTGTCGAGTTGACTC AGGAGGCGCTGGGTACTGTCGCGTCGCAGACCCGCGCGGTTGGCGGGCGT GCAGCCAAACTGGTCGGCATCGAGCTACCCAAGAAGGCGGCGGCGCCTGC GAGGAAGGCTCCGGCCAAGAAGGCGCCTGCGAAGAAGGCTCCGGCCAAGA AGGTCACACAGAAA >NZ_LYPH01000045_1_WP_010908911_1_1820_A8144_RS08680 ATGGCTGAAAACCCTAACGTCGACGACCTGCGGGCGCCATTGTTGGCAGC GCTGGGCGCGGCAGACTTGGCCCTGACCACCGTTAATGAGCTGGTCGGCA ACATGCGCGAACGTGCCGAAGAAACCCGCATCGATACCCGCAGCCGTGTT GAGGAGAGCCGCGCTCGCGTGGCAAAACTGCAGGAGGTTCTGCCCGAACA CCTTAGCGAGCTGCGTGAGAAGTTCACCGCCGACGAGTTGCGTAAGGCCG CTGAGGGCTATTTGGAGGCAGCGACCAACCGGTACAACGAGCTAGTCGAG CGCGGCGAGGCCGCCCTGGAGCGGTTACGCAGCCGGCCGGTTTTCGAAGA TGCGTCGGCACGTGCCGAGGGTTACGTGGACCAGGCTGTCGAGTTGACTC AGGAGGCGCTGGGTACTGTCGCGTCGCAGACCCGCGCGGTTGGCGGGCGT GCAGCCAAACTGGTCGGCATCGAGCTACCCAAGAAGGCGGCGGCGCCTGC GAGGAAGGCTCCGGCCAAGAAGGCGCCTGCGAAGAAGGCTCCGGCCAAGA AGGTCACACAGAAA >NZ_CP029543_1_WP_010908911_1_2650_DIJ64_RS13495 ATGGCTGAAAACCCTAACGTCGACGACCTGCGGGCGCCATTGTTGGCAGC GCTGGGCGCGGCAGACTTGGCCCTGACCACCGTTAATGAGCTGGTCGGCA ACATGCGCGAACGTGCCGAAGAAACCCGCATCGATACCCGCAGCCGTGTT GAGGAGAGCCGCGCTCGCGTGGCAAAACTGCAGGAGGTTCTGCCCGAACA CCTTAGCGAGCTGCGTGAGAAGTTCACCGCCGACGAGTTGCGTAAGGCCG CTGAGGGCTATTTGGAGGCAGCGACCAACCGGTACAACGAGCTAGTCGAG CGCGGCGAGGCCGCCCTGGAGCGGTTACGCAGCCGGCCGGTTTTCGAAGA TGCGTCGGCACGTGCCGAGGGTTACGTGGACCAGGCTGTCGAGTTGACTC AGGAGGCGCTGGGTACTGTCGCGTCGCAGACCCGCGCGGTTGGCGGGCGT GCAGCCAAACTGGTCGGCATCGAGCTACCCAAGAAGGCGGCGGCGCCTGC GAGGAAGGCTCCGGCCAAGAAGGCGCCTGCGAAGAAGGCTCCGGCCAAGA AGGTCACACAGAAA >NZ_AP014567_1_WP_010908911_1_2716_JK2ML_RS13825 ATGGCTGAAAACCCTAACGTCGACGACCTGCGGGCGCCATTGTTGGCAGC GCTGGGCGCGGCAGACTTGGCCCTGACCACCGTTAATGAGCTGGTCGGCA ACATGCGCGAACGTGCCGAAGAAACCCGCATCGATACCCGCAGCCGTGTT GAGGAGAGCCGCGCTCGCGTGGCAAAACTGCAGGAGGTTCTGCCCGAACA CCTTAGCGAGCTGCGTGAGAAGTTCACCGCCGACGAGTTGCGTAAGGCCG CTGAGGGCTATTTGGAGGCAGCGACCAACCGGTACAACGAGCTAGTCGAG CGCGGCGAGGCCGCCCTGGAGCGGTTACGCAGCCGGCCGGTTTTCGAAGA TGCGTCGGCACGTGCCGAGGGTTACGTGGACCAGGCTGTCGAGTTGACTC AGGAGGCGCTGGGTACTGTCGCGTCGCAGACCCGCGCGGTTGGCGGGCGT GCAGCCAAACTGGTCGGCATCGAGCTACCCAAGAAGGCGGCGGCGCCTGC GAGGAAGGCTCCGGCCAAGAAGGCGCCTGCGAAGAAGGCTCCGGCCAAGA AGGTCACACAGAAA
>NC_011896_1_WP_010908911_1_2623_MLBR_RS12480 MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK >NC_002677_1_NP_302592_1_1464_ML2454 MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK >NZ_LVXE01000039_1_WP_010908911_1_1690_A3216_RS10255 MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK >NZ_LYPH01000045_1_WP_010908911_1_1820_A8144_RS08680 MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK >NZ_CP029543_1_WP_010908911_1_2650_DIJ64_RS13495 MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK >NZ_AP014567_1_WP_010908911_1_2716_JK2ML_RS13825 MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRV EESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYLEAATNRYNELVE RGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGR AAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK
#NEXUS
[ID: 5250567552]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908911_1_2623_MLBR_RS12480
NC_002677_1_NP_302592_1_1464_ML2454
NZ_LVXE01000039_1_WP_010908911_1_1690_A3216_RS10255
NZ_LYPH01000045_1_WP_010908911_1_1820_A8144_RS08680
NZ_CP029543_1_WP_010908911_1_2650_DIJ64_RS13495
NZ_AP014567_1_WP_010908911_1_2716_JK2ML_RS13825
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908911_1_2623_MLBR_RS12480,
2 NC_002677_1_NP_302592_1_1464_ML2454,
3 NZ_LVXE01000039_1_WP_010908911_1_1690_A3216_RS10255,
4 NZ_LYPH01000045_1_WP_010908911_1_1820_A8144_RS08680,
5 NZ_CP029543_1_WP_010908911_1_2650_DIJ64_RS13495,
6 NZ_AP014567_1_WP_010908911_1_2716_JK2ML_RS13825
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07044598,2:0.07029253,3:0.06984826,4:0.06963727,5:0.06660086,6:0.0676666);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07044598,2:0.07029253,3:0.06984826,4:0.06963727,5:0.06660086,6:0.0676666);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -755.33 -758.60
2 -755.26 -758.91
--------------------------------------
TOTAL -755.29 -758.77
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2454/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.884746 0.086031 0.362795 1.466667 0.844419 1462.39 1481.70 1.000
r(A<->C){all} 0.170083 0.020969 0.000051 0.457426 0.130541 238.79 297.99 1.000
r(A<->G){all} 0.159006 0.019734 0.000054 0.456830 0.118516 190.92 262.51 1.001
r(A<->T){all} 0.156928 0.018793 0.000040 0.445112 0.119603 171.01 223.37 1.000
r(C<->G){all} 0.176808 0.020989 0.000014 0.461258 0.139451 198.48 276.04 1.000
r(C<->T){all} 0.178124 0.020837 0.000010 0.473373 0.142709 227.20 268.21 1.001
r(G<->T){all} 0.159052 0.018291 0.000019 0.435830 0.125030 293.53 310.39 1.000
pi(A){all} 0.209940 0.000287 0.176773 0.242565 0.209799 1254.53 1313.93 1.000
pi(C){all} 0.290440 0.000365 0.253180 0.327951 0.290599 1228.56 1293.04 1.001
pi(G){all} 0.351754 0.000415 0.312692 0.392191 0.351923 1320.05 1370.31 1.000
pi(T){all} 0.147866 0.000223 0.119611 0.177233 0.147734 1349.17 1355.98 1.000
alpha{1,2} 0.407397 0.225170 0.000103 1.361250 0.244771 1261.36 1283.27 1.000
alpha{3} 0.465577 0.266018 0.000446 1.467284 0.293459 1102.88 1126.87 1.000
pinvar{all} 0.997239 0.000010 0.991339 1.000000 0.998237 773.65 993.16 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2454/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 188
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 0 0 0 0 0 0 | TAC 2 2 2 2 2 2 | TGC 0 0 0 0 0 0
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 6 6 6 6 6 6 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 3 3 3 3 3 3 | His CAT 0 0 0 0 0 0 | Arg CGT 6 6 6 6 6 6
CTC 0 0 0 0 0 0 | CCC 2 2 2 2 2 2 | CAC 1 1 1 1 1 1 | CGC 8 8 8 8 8 8
CTA 2 2 2 2 2 2 | CCA 1 1 1 1 1 1 | Gln CAA 0 0 0 0 0 0 | CGA 0 0 0 0 0 0
CTG 10 10 10 10 10 10 | CCG 3 3 3 3 3 3 | CAG 5 5 5 5 5 5 | CGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 2 2 2 2 2 2 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 2 2 2 2 2 2 | ACC 7 7 7 7 7 7 | AAC 5 5 5 5 5 5 | AGC 4 4 4 4 4 4
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 0 0 0 0 0 0 | AAG 11 11 11 11 11 11 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 5 5 5 5 5 5 | Ala GCT 6 6 6 6 6 6 | Asp GAT 2 2 2 2 2 2 | Gly GGT 2 2 2 2 2 2
GTC 7 7 7 7 7 7 | GCC 10 10 10 10 10 10 | GAC 5 5 5 5 5 5 | GGC 6 6 6 6 6 6
GTA 0 0 0 0 0 0 | GCA 6 6 6 6 6 6 | Glu GAA 6 6 6 6 6 6 | GGA 0 0 0 0 0 0
GTG 2 2 2 2 2 2 | GCG 14 14 14 14 14 14 | GAG 17 17 17 17 17 17 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908911_1_2623_MLBR_RS12480
position 1: T:0.07447 C:0.24468 A:0.20745 G:0.47340
position 2: T:0.21277 C:0.30319 A:0.31383 G:0.17021
position 3: T:0.15426 C:0.32447 A:0.10638 G:0.41489
Average T:0.14716 C:0.29078 A:0.20922 G:0.35284
#2: NC_002677_1_NP_302592_1_1464_ML2454
position 1: T:0.07447 C:0.24468 A:0.20745 G:0.47340
position 2: T:0.21277 C:0.30319 A:0.31383 G:0.17021
position 3: T:0.15426 C:0.32447 A:0.10638 G:0.41489
Average T:0.14716 C:0.29078 A:0.20922 G:0.35284
#3: NZ_LVXE01000039_1_WP_010908911_1_1690_A3216_RS10255
position 1: T:0.07447 C:0.24468 A:0.20745 G:0.47340
position 2: T:0.21277 C:0.30319 A:0.31383 G:0.17021
position 3: T:0.15426 C:0.32447 A:0.10638 G:0.41489
Average T:0.14716 C:0.29078 A:0.20922 G:0.35284
#4: NZ_LYPH01000045_1_WP_010908911_1_1820_A8144_RS08680
position 1: T:0.07447 C:0.24468 A:0.20745 G:0.47340
position 2: T:0.21277 C:0.30319 A:0.31383 G:0.17021
position 3: T:0.15426 C:0.32447 A:0.10638 G:0.41489
Average T:0.14716 C:0.29078 A:0.20922 G:0.35284
#5: NZ_CP029543_1_WP_010908911_1_2650_DIJ64_RS13495
position 1: T:0.07447 C:0.24468 A:0.20745 G:0.47340
position 2: T:0.21277 C:0.30319 A:0.31383 G:0.17021
position 3: T:0.15426 C:0.32447 A:0.10638 G:0.41489
Average T:0.14716 C:0.29078 A:0.20922 G:0.35284
#6: NZ_AP014567_1_WP_010908911_1_2716_JK2ML_RS13825
position 1: T:0.07447 C:0.24468 A:0.20745 G:0.47340
position 2: T:0.21277 C:0.30319 A:0.31383 G:0.17021
position 3: T:0.15426 C:0.32447 A:0.10638 G:0.41489
Average T:0.14716 C:0.29078 A:0.20922 G:0.35284
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 12 | TCC 0 | TAC 12 | TGC 0
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 36 | TCG 12 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 18 | His H CAT 0 | Arg R CGT 36
CTC 0 | CCC 12 | CAC 6 | CGC 48
CTA 12 | CCA 6 | Gln Q CAA 0 | CGA 0
CTG 60 | CCG 18 | CAG 30 | CGG 24
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 12 | Asn N AAT 6 | Ser S AGT 0
ATC 12 | ACC 42 | AAC 30 | AGC 24
ATA 0 | ACA 6 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 12 | ACG 0 | AAG 66 | AGG 6
------------------------------------------------------------------------------
Val V GTT 30 | Ala A GCT 36 | Asp D GAT 12 | Gly G GGT 12
GTC 42 | GCC 60 | GAC 30 | GGC 36
GTA 0 | GCA 36 | Glu E GAA 36 | GGA 0
GTG 12 | GCG 84 | GAG 102 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.07447 C:0.24468 A:0.20745 G:0.47340
position 2: T:0.21277 C:0.30319 A:0.31383 G:0.17021
position 3: T:0.15426 C:0.32447 A:0.10638 G:0.41489
Average T:0.14716 C:0.29078 A:0.20922 G:0.35284
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -717.724497 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.306615
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908911_1_2623_MLBR_RS12480: 0.000004, NC_002677_1_NP_302592_1_1464_ML2454: 0.000004, NZ_LVXE01000039_1_WP_010908911_1_1690_A3216_RS10255: 0.000004, NZ_LYPH01000045_1_WP_010908911_1_1820_A8144_RS08680: 0.000004, NZ_CP029543_1_WP_010908911_1_2650_DIJ64_RS13495: 0.000004, NZ_AP014567_1_WP_010908911_1_2716_JK2ML_RS13825: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 1.30662
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 448.3 115.7 1.3066 0.0000 0.0000 0.0 0.0
7..2 0.000 448.3 115.7 1.3066 0.0000 0.0000 0.0 0.0
7..3 0.000 448.3 115.7 1.3066 0.0000 0.0000 0.0 0.0
7..4 0.000 448.3 115.7 1.3066 0.0000 0.0000 0.0 0.0
7..5 0.000 448.3 115.7 1.3066 0.0000 0.0000 0.0 0.0
7..6 0.000 448.3 115.7 1.3066 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -717.724506 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908911_1_2623_MLBR_RS12480: 0.000004, NC_002677_1_NP_302592_1_1464_ML2454: 0.000004, NZ_LVXE01000039_1_WP_010908911_1_1690_A3216_RS10255: 0.000004, NZ_LYPH01000045_1_WP_010908911_1_1820_A8144_RS08680: 0.000004, NZ_CP029543_1_WP_010908911_1_2650_DIJ64_RS13495: 0.000004, NZ_AP014567_1_WP_010908911_1_2716_JK2ML_RS13825: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 448.3 115.7 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 448.3 115.7 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 448.3 115.7 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 448.3 115.7 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 448.3 115.7 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 448.3 115.7 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -717.724463 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000000 0.000000 0.000001 59.072098
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908911_1_2623_MLBR_RS12480: 0.000004, NC_002677_1_NP_302592_1_1464_ML2454: 0.000004, NZ_LVXE01000039_1_WP_010908911_1_1690_A3216_RS10255: 0.000004, NZ_LYPH01000045_1_WP_010908911_1_1820_A8144_RS08680: 0.000004, NZ_CP029543_1_WP_010908911_1_2650_DIJ64_RS13495: 0.000004, NZ_AP014567_1_WP_010908911_1_2716_JK2ML_RS13825: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 0.00000 1.00000 59.07210
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 448.3 115.7 59.0721 0.0000 0.0000 0.0 0.0
7..2 0.000 448.3 115.7 59.0721 0.0000 0.0000 0.0 0.0
7..3 0.000 448.3 115.7 59.0721 0.0000 0.0000 0.0 0.0
7..4 0.000 448.3 115.7 59.0721 0.0000 0.0000 0.0 0.0
7..5 0.000 448.3 115.7 59.0721 0.0000 0.0000 0.0 0.0
7..6 0.000 448.3 115.7 59.0721 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908911_1_2623_MLBR_RS12480)
Pr(w>1) post mean +- SE for w
1 M 1.000** 59.072
2 A 1.000** 59.072
3 E 1.000** 59.072
4 N 1.000** 59.072
5 P 1.000** 59.072
6 N 1.000** 59.072
7 V 1.000** 59.072
8 D 1.000** 59.072
9 D 1.000** 59.072
10 L 1.000** 59.072
11 R 1.000** 59.072
12 A 1.000** 59.072
13 P 1.000** 59.072
14 L 1.000** 59.072
15 L 1.000** 59.072
16 A 1.000** 59.072
17 A 1.000** 59.072
18 L 1.000** 59.072
19 G 1.000** 59.072
20 A 1.000** 59.072
21 A 1.000** 59.072
22 D 1.000** 59.072
23 L 1.000** 59.072
24 A 1.000** 59.072
25 L 1.000** 59.072
26 T 1.000** 59.072
27 T 1.000** 59.072
28 V 1.000** 59.072
29 N 1.000** 59.072
30 E 1.000** 59.072
31 L 1.000** 59.072
32 V 1.000** 59.072
33 G 1.000** 59.072
34 N 1.000** 59.072
35 M 1.000** 59.072
36 R 1.000** 59.072
37 E 1.000** 59.072
38 R 1.000** 59.072
39 A 1.000** 59.072
40 E 1.000** 59.072
41 E 1.000** 59.072
42 T 1.000** 59.072
43 R 1.000** 59.072
44 I 1.000** 59.072
45 D 1.000** 59.072
46 T 1.000** 59.072
47 R 1.000** 59.072
48 S 1.000** 59.072
49 R 1.000** 59.072
50 V 1.000** 59.072
51 E 1.000** 59.072
52 E 1.000** 59.072
53 S 1.000** 59.072
54 R 1.000** 59.072
55 A 1.000** 59.072
56 R 1.000** 59.072
57 V 1.000** 59.072
58 A 1.000** 59.072
59 K 1.000** 59.072
60 L 1.000** 59.072
61 Q 1.000** 59.072
62 E 1.000** 59.072
63 V 1.000** 59.072
64 L 1.000** 59.072
65 P 1.000** 59.072
66 E 1.000** 59.072
67 H 1.000** 59.072
68 L 1.000** 59.072
69 S 1.000** 59.072
70 E 1.000** 59.072
71 L 1.000** 59.072
72 R 1.000** 59.072
73 E 1.000** 59.072
74 K 1.000** 59.072
75 F 1.000** 59.072
76 T 1.000** 59.072
77 A 1.000** 59.072
78 D 1.000** 59.072
79 E 1.000** 59.072
80 L 1.000** 59.072
81 R 1.000** 59.072
82 K 1.000** 59.072
83 A 1.000** 59.072
84 A 1.000** 59.072
85 E 1.000** 59.072
86 G 1.000** 59.072
87 Y 1.000** 59.072
88 L 1.000** 59.072
89 E 1.000** 59.072
90 A 1.000** 59.072
91 A 1.000** 59.072
92 T 1.000** 59.072
93 N 1.000** 59.072
94 R 1.000** 59.072
95 Y 1.000** 59.072
96 N 1.000** 59.072
97 E 1.000** 59.072
98 L 1.000** 59.072
99 V 1.000** 59.072
100 E 1.000** 59.072
101 R 1.000** 59.072
102 G 1.000** 59.072
103 E 1.000** 59.072
104 A 1.000** 59.072
105 A 1.000** 59.072
106 L 1.000** 59.072
107 E 1.000** 59.072
108 R 1.000** 59.072
109 L 1.000** 59.072
110 R 1.000** 59.072
111 S 1.000** 59.072
112 R 1.000** 59.072
113 P 1.000** 59.072
114 V 1.000** 59.072
115 F 1.000** 59.072
116 E 1.000** 59.072
117 D 1.000** 59.072
118 A 1.000** 59.072
119 S 1.000** 59.072
120 A 1.000** 59.072
121 R 1.000** 59.072
122 A 1.000** 59.072
123 E 1.000** 59.072
124 G 1.000** 59.072
125 Y 1.000** 59.072
126 V 1.000** 59.072
127 D 1.000** 59.072
128 Q 1.000** 59.072
129 A 1.000** 59.072
130 V 1.000** 59.072
131 E 1.000** 59.072
132 L 1.000** 59.072
133 T 1.000** 59.072
134 Q 1.000** 59.072
135 E 1.000** 59.072
136 A 1.000** 59.072
137 L 1.000** 59.072
138 G 1.000** 59.072
139 T 1.000** 59.072
140 V 1.000** 59.072
141 A 1.000** 59.072
142 S 1.000** 59.072
143 Q 1.000** 59.072
144 T 1.000** 59.072
145 R 1.000** 59.072
146 A 1.000** 59.072
147 V 1.000** 59.072
148 G 1.000** 59.072
149 G 1.000** 59.072
150 R 1.000** 59.072
151 A 1.000** 59.072
152 A 1.000** 59.072
153 K 1.000** 59.072
154 L 1.000** 59.072
155 V 1.000** 59.072
156 G 1.000** 59.072
157 I 1.000** 59.072
158 E 1.000** 59.072
159 L 1.000** 59.072
160 P 1.000** 59.072
161 K 1.000** 59.072
162 K 1.000** 59.072
163 A 1.000** 59.072
164 A 1.000** 59.072
165 A 1.000** 59.072
166 P 1.000** 59.072
167 A 1.000** 59.072
168 R 1.000** 59.072
169 K 1.000** 59.072
170 A 1.000** 59.072
171 P 1.000** 59.072
172 A 1.000** 59.072
173 K 1.000** 59.072
174 K 1.000** 59.072
175 A 1.000** 59.072
176 P 1.000** 59.072
177 A 1.000** 59.072
178 K 1.000** 59.072
179 K 1.000** 59.072
180 A 1.000** 59.072
181 P 1.000** 59.072
182 A 1.000** 59.072
183 K 1.000** 59.072
184 K 1.000** 59.072
185 V 1.000** 59.072
186 T 1.000** 59.072
187 Q 1.000** 59.072
188 K 1.000** 59.072
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908911_1_2623_MLBR_RS12480)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -717.724580 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 6.949969 26.322570
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908911_1_2623_MLBR_RS12480: 0.000004, NC_002677_1_NP_302592_1_1464_ML2454: 0.000004, NZ_LVXE01000039_1_WP_010908911_1_1690_A3216_RS10255: 0.000004, NZ_LYPH01000045_1_WP_010908911_1_1820_A8144_RS08680: 0.000004, NZ_CP029543_1_WP_010908911_1_2650_DIJ64_RS13495: 0.000004, NZ_AP014567_1_WP_010908911_1_2716_JK2ML_RS13825: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 6.94997 q = 26.32257
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.10536 0.13720 0.15857 0.17690 0.19429 0.21191 0.23090 0.25292 0.28167 0.33254
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 448.3 115.7 0.2082 0.0000 0.0000 0.0 0.0
7..2 0.000 448.3 115.7 0.2082 0.0000 0.0000 0.0 0.0
7..3 0.000 448.3 115.7 0.2082 0.0000 0.0000 0.0 0.0
7..4 0.000 448.3 115.7 0.2082 0.0000 0.0000 0.0 0.0
7..5 0.000 448.3 115.7 0.2082 0.0000 0.0000 0.0 0.0
7..6 0.000 448.3 115.7 0.2082 0.0000 0.0000 0.0 0.0
Time used: 0:10
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -717.724512 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.594599 0.005000 1.977157 2.069875
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908911_1_2623_MLBR_RS12480: 0.000004, NC_002677_1_NP_302592_1_1464_ML2454: 0.000004, NZ_LVXE01000039_1_WP_010908911_1_1690_A3216_RS10255: 0.000004, NZ_LYPH01000045_1_WP_010908911_1_1820_A8144_RS08680: 0.000004, NZ_CP029543_1_WP_010908911_1_2650_DIJ64_RS13495: 0.000004, NZ_AP014567_1_WP_010908911_1_2716_JK2ML_RS13825: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.59460 p = 0.00500 q = 1.97716
(p1 = 0.40540) w = 2.06987
MLEs of dN/dS (w) for site classes (K=11)
p: 0.05946 0.05946 0.05946 0.05946 0.05946 0.05946 0.05946 0.05946 0.05946 0.05946 0.40540
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 2.06987
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 448.3 115.7 0.8391 0.0000 0.0000 0.0 0.0
7..2 0.000 448.3 115.7 0.8391 0.0000 0.0000 0.0 0.0
7..3 0.000 448.3 115.7 0.8391 0.0000 0.0000 0.0 0.0
7..4 0.000 448.3 115.7 0.8391 0.0000 0.0000 0.0 0.0
7..5 0.000 448.3 115.7 0.8391 0.0000 0.0000 0.0 0.0
7..6 0.000 448.3 115.7 0.8391 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908911_1_2623_MLBR_RS12480)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908911_1_2623_MLBR_RS12480)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.099 0.100 0.100 0.100 0.100 0.101 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Time used: 0:14
Model 1: NearlyNeutral -717.724506 Model 2: PositiveSelection -717.724463 Model 0: one-ratio -717.724497 Model 7: beta -717.72458 Model 8: beta&w>1 -717.724512 Model 0 vs 1 1.799999995455437E-5 Model 2 vs 1 8.600000001024455E-5 Model 8 vs 7 1.3599999988400668E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
