--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:18:57 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2463/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2463/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2463/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/9res/ML2463/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1087.04         -1091.59
2      -1087.05         -1090.03
--------------------------------------
TOTAL    -1087.04         -1091.09
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/9res/ML2463/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2463/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2463/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.897631    0.094791    0.385773    1.534305    0.854311   1501.00   1501.00    1.002
r(A<->C){all}   0.162681    0.018616    0.000021    0.428913    0.125304    234.97    258.55    1.000
r(A<->G){all}   0.177630    0.021162    0.000056    0.468589    0.144983    232.91    269.93    1.006
r(A<->T){all}   0.161679    0.019969    0.000034    0.458232    0.122933    234.61    240.09    1.009
r(C<->G){all}   0.176547    0.021497    0.000074    0.466637    0.141142    134.36    199.25    1.007
r(C<->T){all}   0.167539    0.020496    0.000222    0.474413    0.132853    154.23    167.89    1.000
r(G<->T){all}   0.153923    0.017890    0.000153    0.413708    0.117025    194.00    210.42    1.009
pi(A){all}      0.195020    0.000192    0.168788    0.222281    0.194849   1275.62   1314.27    1.000
pi(C){all}      0.265384    0.000253    0.234656    0.296306    0.265262   1075.76   1288.38    1.000
pi(G){all}      0.313545    0.000276    0.281814    0.347033    0.313143   1349.44   1371.66    1.000
pi(T){all}      0.226052    0.000227    0.195661    0.254948    0.226032   1471.46   1486.23    1.000
alpha{1,2}      0.415822    0.222546    0.000151    1.411112    0.244436   1150.06   1173.96    1.000
alpha{3}        0.452983    0.227840    0.000109    1.442798    0.291644   1169.87   1244.18    1.000
pinvar{all}     0.998019    0.000005    0.993440    0.999998    0.998775   1035.58   1159.34    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1046.635348
Model 2: PositiveSelection	-1046.634846
Model 0: one-ratio	-1046.63547
Model 7: beta	-1046.634846
Model 8: beta&w>1	-1046.634846


Model 0 vs 1	2.4399999983870657E-4

Model 2 vs 1	0.0010040000001936278

Model 8 vs 7	0.0
>C1
VSLDKIMMPVPEGHPDVFDREWPLRVGDIDRTGRLRLDAGVRHIQDIGQD
QLREMGFEETHPLWIVRRTMVDLIRPVEFQEMLRLRRWCSGTSNRWCEMR
VRIDGRKGGLIESEAFWININRETQMPARIADDFLAGLHRTTSVDRLRWR
GYLQPGSRDDASEIHEFPVRVTDIDLFDHMNNSVYWSVIEDYLVSHSELL
KGPLRTTIEHEAPVALGDKLEIVLHVHPAGSTDQFGPGLVDRSVITLTYT
VGDETKAIAAIFAL
>C2
VSLDKIMMPVPEGHPDVFDREWPLRVGDIDRTGRLRLDAGVRHIQDIGQD
QLREMGFEETHPLWIVRRTMVDLIRPVEFQEMLRLRRWCSGTSNRWCEMR
VRIDGRKGGLIESEAFWININRETQMPARIADDFLAGLHRTTSVDRLRWR
GYLQPGSRDDASEIHEFPVRVTDIDLFDHMNNSVYWSVIEDYLVSHSELL
KGPLRTTIEHEAPVALGDKLEIVLHVHPAGSTDQFGPGLVDRSVITLTYT
VGDETKAIAAIFAL
>C3
VSLDKIMMPVPEGHPDVFDREWPLRVGDIDRTGRLRLDAGVRHIQDIGQD
QLREMGFEETHPLWIVRRTMVDLIRPVEFQEMLRLRRWCSGTSNRWCEMR
VRIDGRKGGLIESEAFWININRETQMPARIADDFLAGLHRTTSVDRLRWR
GYLQPGSRDDASEIHEFPVRVTDIDLFDHMNNSVYWSVIEDYLVSHSELL
KGPLRTTIEHEAPVALGDKLEIVLHVHPAGSTDQFGPGLVDRSVITLTYT
VGDETKAIAAIFAL
>C4
VSLDKIMMPVPEGHPDVFDREWPLRVGDIDRTGRLRLDAGVRHIQDIGQD
QLREMGFEETHPLWIVRRTMVDLIRPVEFQEMLRLRRWCSGTSNRWCEMR
VRIDGRKGGLIESEAFWININRETQMPARIADDFLAGLHRTTSVDRLRWR
GYLQPGSRDDASEIHEFPVRVTDIDLFDHMNNSVYWSVIEDYLVSHSELL
KGPLRTTIEHEAPVALGDKLEIVLHVHPAGSTDQFGPGLVDRSVITLTYT
VGDETKAIAAIFAL
>C5
VSLDKIMMPVPEGHPDVFDREWPLRVGDIDRTGRLRLDAGVRHIQDIGQD
QLREMGFEETHPLWIVRRTMVDLIRPVEFQEMLRLRRWCSGTSNRWCEMR
VRIDGRKGGLIESEAFWININRETQMPARIADDFLAGLHRTTSVDRLRWR
GYLQPGSRDDASEIHEFPVRVTDIDLFDHMNNSVYWSVIEDYLVSHSELL
KGPLRTTIEHEAPVALGDKLEIVLHVHPAGSTDQFGPGLVDRSVITLTYT
VGDETKAIAAIFAL
>C6
VSLDKIMMPVPEGHPDVFDREWPLRVGDIDRTGRLRLDAGVRHIQDIGQD
QLREMGFEETHPLWIVRRTMVDLIRPVEFQEMLRLRRWCSGTSNRWCEMR
VRIDGRKGGLIESEAFWININRETQMPARIADDFLAGLHRTTSVDRLRWR
GYLQPGSRDDASEIHEFPVRVTDIDLFDHMNNSVYWSVIEDYLVSHSELL
KGPLRTTIEHEAPVALGDKLEIVLHVHPAGSTDQFGPGLVDRSVITLTYT
VGDETKAIAAIFAL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=264 

C1              VSLDKIMMPVPEGHPDVFDREWPLRVGDIDRTGRLRLDAGVRHIQDIGQD
C2              VSLDKIMMPVPEGHPDVFDREWPLRVGDIDRTGRLRLDAGVRHIQDIGQD
C3              VSLDKIMMPVPEGHPDVFDREWPLRVGDIDRTGRLRLDAGVRHIQDIGQD
C4              VSLDKIMMPVPEGHPDVFDREWPLRVGDIDRTGRLRLDAGVRHIQDIGQD
C5              VSLDKIMMPVPEGHPDVFDREWPLRVGDIDRTGRLRLDAGVRHIQDIGQD
C6              VSLDKIMMPVPEGHPDVFDREWPLRVGDIDRTGRLRLDAGVRHIQDIGQD
                **************************************************

C1              QLREMGFEETHPLWIVRRTMVDLIRPVEFQEMLRLRRWCSGTSNRWCEMR
C2              QLREMGFEETHPLWIVRRTMVDLIRPVEFQEMLRLRRWCSGTSNRWCEMR
C3              QLREMGFEETHPLWIVRRTMVDLIRPVEFQEMLRLRRWCSGTSNRWCEMR
C4              QLREMGFEETHPLWIVRRTMVDLIRPVEFQEMLRLRRWCSGTSNRWCEMR
C5              QLREMGFEETHPLWIVRRTMVDLIRPVEFQEMLRLRRWCSGTSNRWCEMR
C6              QLREMGFEETHPLWIVRRTMVDLIRPVEFQEMLRLRRWCSGTSNRWCEMR
                **************************************************

C1              VRIDGRKGGLIESEAFWININRETQMPARIADDFLAGLHRTTSVDRLRWR
C2              VRIDGRKGGLIESEAFWININRETQMPARIADDFLAGLHRTTSVDRLRWR
C3              VRIDGRKGGLIESEAFWININRETQMPARIADDFLAGLHRTTSVDRLRWR
C4              VRIDGRKGGLIESEAFWININRETQMPARIADDFLAGLHRTTSVDRLRWR
C5              VRIDGRKGGLIESEAFWININRETQMPARIADDFLAGLHRTTSVDRLRWR
C6              VRIDGRKGGLIESEAFWININRETQMPARIADDFLAGLHRTTSVDRLRWR
                **************************************************

C1              GYLQPGSRDDASEIHEFPVRVTDIDLFDHMNNSVYWSVIEDYLVSHSELL
C2              GYLQPGSRDDASEIHEFPVRVTDIDLFDHMNNSVYWSVIEDYLVSHSELL
C3              GYLQPGSRDDASEIHEFPVRVTDIDLFDHMNNSVYWSVIEDYLVSHSELL
C4              GYLQPGSRDDASEIHEFPVRVTDIDLFDHMNNSVYWSVIEDYLVSHSELL
C5              GYLQPGSRDDASEIHEFPVRVTDIDLFDHMNNSVYWSVIEDYLVSHSELL
C6              GYLQPGSRDDASEIHEFPVRVTDIDLFDHMNNSVYWSVIEDYLVSHSELL
                **************************************************

C1              KGPLRTTIEHEAPVALGDKLEIVLHVHPAGSTDQFGPGLVDRSVITLTYT
C2              KGPLRTTIEHEAPVALGDKLEIVLHVHPAGSTDQFGPGLVDRSVITLTYT
C3              KGPLRTTIEHEAPVALGDKLEIVLHVHPAGSTDQFGPGLVDRSVITLTYT
C4              KGPLRTTIEHEAPVALGDKLEIVLHVHPAGSTDQFGPGLVDRSVITLTYT
C5              KGPLRTTIEHEAPVALGDKLEIVLHVHPAGSTDQFGPGLVDRSVITLTYT
C6              KGPLRTTIEHEAPVALGDKLEIVLHVHPAGSTDQFGPGLVDRSVITLTYT
                **************************************************

C1              VGDETKAIAAIFAL
C2              VGDETKAIAAIFAL
C3              VGDETKAIAAIFAL
C4              VGDETKAIAAIFAL
C5              VGDETKAIAAIFAL
C6              VGDETKAIAAIFAL
                **************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  264 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  264 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7920]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [7920]--->[7920]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.497 Mb, Max= 30.819 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VSLDKIMMPVPEGHPDVFDREWPLRVGDIDRTGRLRLDAGVRHIQDIGQD
C2              VSLDKIMMPVPEGHPDVFDREWPLRVGDIDRTGRLRLDAGVRHIQDIGQD
C3              VSLDKIMMPVPEGHPDVFDREWPLRVGDIDRTGRLRLDAGVRHIQDIGQD
C4              VSLDKIMMPVPEGHPDVFDREWPLRVGDIDRTGRLRLDAGVRHIQDIGQD
C5              VSLDKIMMPVPEGHPDVFDREWPLRVGDIDRTGRLRLDAGVRHIQDIGQD
C6              VSLDKIMMPVPEGHPDVFDREWPLRVGDIDRTGRLRLDAGVRHIQDIGQD
                **************************************************

C1              QLREMGFEETHPLWIVRRTMVDLIRPVEFQEMLRLRRWCSGTSNRWCEMR
C2              QLREMGFEETHPLWIVRRTMVDLIRPVEFQEMLRLRRWCSGTSNRWCEMR
C3              QLREMGFEETHPLWIVRRTMVDLIRPVEFQEMLRLRRWCSGTSNRWCEMR
C4              QLREMGFEETHPLWIVRRTMVDLIRPVEFQEMLRLRRWCSGTSNRWCEMR
C5              QLREMGFEETHPLWIVRRTMVDLIRPVEFQEMLRLRRWCSGTSNRWCEMR
C6              QLREMGFEETHPLWIVRRTMVDLIRPVEFQEMLRLRRWCSGTSNRWCEMR
                **************************************************

C1              VRIDGRKGGLIESEAFWININRETQMPARIADDFLAGLHRTTSVDRLRWR
C2              VRIDGRKGGLIESEAFWININRETQMPARIADDFLAGLHRTTSVDRLRWR
C3              VRIDGRKGGLIESEAFWININRETQMPARIADDFLAGLHRTTSVDRLRWR
C4              VRIDGRKGGLIESEAFWININRETQMPARIADDFLAGLHRTTSVDRLRWR
C5              VRIDGRKGGLIESEAFWININRETQMPARIADDFLAGLHRTTSVDRLRWR
C6              VRIDGRKGGLIESEAFWININRETQMPARIADDFLAGLHRTTSVDRLRWR
                **************************************************

C1              GYLQPGSRDDASEIHEFPVRVTDIDLFDHMNNSVYWSVIEDYLVSHSELL
C2              GYLQPGSRDDASEIHEFPVRVTDIDLFDHMNNSVYWSVIEDYLVSHSELL
C3              GYLQPGSRDDASEIHEFPVRVTDIDLFDHMNNSVYWSVIEDYLVSHSELL
C4              GYLQPGSRDDASEIHEFPVRVTDIDLFDHMNNSVYWSVIEDYLVSHSELL
C5              GYLQPGSRDDASEIHEFPVRVTDIDLFDHMNNSVYWSVIEDYLVSHSELL
C6              GYLQPGSRDDASEIHEFPVRVTDIDLFDHMNNSVYWSVIEDYLVSHSELL
                **************************************************

C1              KGPLRTTIEHEAPVALGDKLEIVLHVHPAGSTDQFGPGLVDRSVITLTYT
C2              KGPLRTTIEHEAPVALGDKLEIVLHVHPAGSTDQFGPGLVDRSVITLTYT
C3              KGPLRTTIEHEAPVALGDKLEIVLHVHPAGSTDQFGPGLVDRSVITLTYT
C4              KGPLRTTIEHEAPVALGDKLEIVLHVHPAGSTDQFGPGLVDRSVITLTYT
C5              KGPLRTTIEHEAPVALGDKLEIVLHVHPAGSTDQFGPGLVDRSVITLTYT
C6              KGPLRTTIEHEAPVALGDKLEIVLHVHPAGSTDQFGPGLVDRSVITLTYT
                **************************************************

C1              VGDETKAIAAIFAL
C2              VGDETKAIAAIFAL
C3              VGDETKAIAAIFAL
C4              VGDETKAIAAIFAL
C5              VGDETKAIAAIFAL
C6              VGDETKAIAAIFAL
                **************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGAGCCTAGACAAGATAATGATGCCGGTTCCCGAAGGTCATCCCGATGT
C2              GTGAGCCTAGACAAGATAATGATGCCGGTTCCCGAAGGTCATCCCGATGT
C3              GTGAGCCTAGACAAGATAATGATGCCGGTTCCCGAAGGTCATCCCGATGT
C4              GTGAGCCTAGACAAGATAATGATGCCGGTTCCCGAAGGTCATCCCGATGT
C5              GTGAGCCTAGACAAGATAATGATGCCGGTTCCCGAAGGTCATCCCGATGT
C6              GTGAGCCTAGACAAGATAATGATGCCGGTTCCCGAAGGTCATCCCGATGT
                **************************************************

C1              GTTTGATCGTGAATGGCCGCTTCGCGTAGGGGACATCGACCGCACCGGTC
C2              GTTTGATCGTGAATGGCCGCTTCGCGTAGGGGACATCGACCGCACCGGTC
C3              GTTTGATCGTGAATGGCCGCTTCGCGTAGGGGACATCGACCGCACCGGTC
C4              GTTTGATCGTGAATGGCCGCTTCGCGTAGGGGACATCGACCGCACCGGTC
C5              GTTTGATCGTGAATGGCCGCTTCGCGTAGGGGACATCGACCGCACCGGTC
C6              GTTTGATCGTGAATGGCCGCTTCGCGTAGGGGACATCGACCGCACCGGTC
                **************************************************

C1              GGCTGCGATTAGACGCAGGTGTCCGGCATATCCAAGACATCGGTCAGGAT
C2              GGCTGCGATTAGACGCAGGTGTCCGGCATATCCAAGACATCGGTCAGGAT
C3              GGCTGCGATTAGACGCAGGTGTCCGGCATATCCAAGACATCGGTCAGGAT
C4              GGCTGCGATTAGACGCAGGTGTCCGGCATATCCAAGACATCGGTCAGGAT
C5              GGCTGCGATTAGACGCAGGTGTCCGGCATATCCAAGACATCGGTCAGGAT
C6              GGCTGCGATTAGACGCAGGTGTCCGGCATATCCAAGACATCGGTCAGGAT
                **************************************************

C1              CAACTGCGCGAGATGGGGTTCGAGGAGACCCACCCGCTGTGGATTGTGCG
C2              CAACTGCGCGAGATGGGGTTCGAGGAGACCCACCCGCTGTGGATTGTGCG
C3              CAACTGCGCGAGATGGGGTTCGAGGAGACCCACCCGCTGTGGATTGTGCG
C4              CAACTGCGCGAGATGGGGTTCGAGGAGACCCACCCGCTGTGGATTGTGCG
C5              CAACTGCGCGAGATGGGGTTCGAGGAGACCCACCCGCTGTGGATTGTGCG
C6              CAACTGCGCGAGATGGGGTTCGAGGAGACCCACCCGCTGTGGATTGTGCG
                **************************************************

C1              CCGCACCATGGTTGACTTGATCCGTCCGGTTGAGTTCCAGGAAATGTTGC
C2              CCGCACCATGGTTGACTTGATCCGTCCGGTTGAGTTCCAGGAAATGTTGC
C3              CCGCACCATGGTTGACTTGATCCGTCCGGTTGAGTTCCAGGAAATGTTGC
C4              CCGCACCATGGTTGACTTGATCCGTCCGGTTGAGTTCCAGGAAATGTTGC
C5              CCGCACCATGGTTGACTTGATCCGTCCGGTTGAGTTCCAGGAAATGTTGC
C6              CCGCACCATGGTTGACTTGATCCGTCCGGTTGAGTTCCAGGAAATGTTGC
                **************************************************

C1              GGCTGCGGCGGTGGTGTTCGGGTACCTCGAACCGGTGGTGTGAAATGCGT
C2              GGCTGCGGCGGTGGTGTTCGGGTACCTCGAACCGGTGGTGTGAAATGCGT
C3              GGCTGCGGCGGTGGTGTTCGGGTACCTCGAACCGGTGGTGTGAAATGCGT
C4              GGCTGCGGCGGTGGTGTTCGGGTACCTCGAACCGGTGGTGTGAAATGCGT
C5              GGCTGCGGCGGTGGTGTTCGGGTACCTCGAACCGGTGGTGTGAAATGCGT
C6              GGCTGCGGCGGTGGTGTTCGGGTACCTCGAACCGGTGGTGTGAAATGCGT
                **************************************************

C1              GTCCGTATCGATGGGCGCAAGGGTGGCCTCATCGAGTCCGAGGCGTTTTG
C2              GTCCGTATCGATGGGCGCAAGGGTGGCCTCATCGAGTCCGAGGCGTTTTG
C3              GTCCGTATCGATGGGCGCAAGGGTGGCCTCATCGAGTCCGAGGCGTTTTG
C4              GTCCGTATCGATGGGCGCAAGGGTGGCCTCATCGAGTCCGAGGCGTTTTG
C5              GTCCGTATCGATGGGCGCAAGGGTGGCCTCATCGAGTCCGAGGCGTTTTG
C6              GTCCGTATCGATGGGCGCAAGGGTGGCCTCATCGAGTCCGAGGCGTTTTG
                **************************************************

C1              GATCAACATCAACCGGGAAACTCAGATGCCGGCCCGCATCGCGGACGACT
C2              GATCAACATCAACCGGGAAACTCAGATGCCGGCCCGCATCGCGGACGACT
C3              GATCAACATCAACCGGGAAACTCAGATGCCGGCCCGCATCGCGGACGACT
C4              GATCAACATCAACCGGGAAACTCAGATGCCGGCCCGCATCGCGGACGACT
C5              GATCAACATCAACCGGGAAACTCAGATGCCGGCCCGCATCGCGGACGACT
C6              GATCAACATCAACCGGGAAACTCAGATGCCGGCCCGCATCGCGGACGACT
                **************************************************

C1              TCCTGGCGGGCCTGCACAGGACCACGTCCGTCGATAGGCTGCGGTGGAGG
C2              TCCTGGCGGGCCTGCACAGGACCACGTCCGTCGATAGGCTGCGGTGGAGG
C3              TCCTGGCGGGCCTGCACAGGACCACGTCCGTCGATAGGCTGCGGTGGAGG
C4              TCCTGGCGGGCCTGCACAGGACCACGTCCGTCGATAGGCTGCGGTGGAGG
C5              TCCTGGCGGGCCTGCACAGGACCACGTCCGTCGATAGGCTGCGGTGGAGG
C6              TCCTGGCGGGCCTGCACAGGACCACGTCCGTCGATAGGCTGCGGTGGAGG
                **************************************************

C1              GGCTATTTGCAGCCGGGTAGCCGTGACGATGCGTCGGAAATCCACGAGTT
C2              GGCTATTTGCAGCCGGGTAGCCGTGACGATGCGTCGGAAATCCACGAGTT
C3              GGCTATTTGCAGCCGGGTAGCCGTGACGATGCGTCGGAAATCCACGAGTT
C4              GGCTATTTGCAGCCGGGTAGCCGTGACGATGCGTCGGAAATCCACGAGTT
C5              GGCTATTTGCAGCCGGGTAGCCGTGACGATGCGTCGGAAATCCACGAGTT
C6              GGCTATTTGCAGCCGGGTAGCCGTGACGATGCGTCGGAAATCCACGAGTT
                **************************************************

C1              CCCGGTGCGGGTAACTGATATTGACTTGTTCGATCACATGAACAATTCGG
C2              CCCGGTGCGGGTAACTGATATTGACTTGTTCGATCACATGAACAATTCGG
C3              CCCGGTGCGGGTAACTGATATTGACTTGTTCGATCACATGAACAATTCGG
C4              CCCGGTGCGGGTAACTGATATTGACTTGTTCGATCACATGAACAATTCGG
C5              CCCGGTGCGGGTAACTGATATTGACTTGTTCGATCACATGAACAATTCGG
C6              CCCGGTGCGGGTAACTGATATTGACTTGTTCGATCACATGAACAATTCGG
                **************************************************

C1              TGTACTGGAGCGTGATCGAGGACTATTTGGTGTCTCACTCCGAACTACTC
C2              TGTACTGGAGCGTGATCGAGGACTATTTGGTGTCTCACTCCGAACTACTC
C3              TGTACTGGAGCGTGATCGAGGACTATTTGGTGTCTCACTCCGAACTACTC
C4              TGTACTGGAGCGTGATCGAGGACTATTTGGTGTCTCACTCCGAACTACTC
C5              TGTACTGGAGCGTGATCGAGGACTATTTGGTGTCTCACTCCGAACTACTC
C6              TGTACTGGAGCGTGATCGAGGACTATTTGGTGTCTCACTCCGAACTACTC
                **************************************************

C1              AAAGGGCCGCTCCGCACCACCATCGAACATGAGGCTCCCGTTGCGCTGGG
C2              AAAGGGCCGCTCCGCACCACCATCGAACATGAGGCTCCCGTTGCGCTGGG
C3              AAAGGGCCGCTCCGCACCACCATCGAACATGAGGCTCCCGTTGCGCTGGG
C4              AAAGGGCCGCTCCGCACCACCATCGAACATGAGGCTCCCGTTGCGCTGGG
C5              AAAGGGCCGCTCCGCACCACCATCGAACATGAGGCTCCCGTTGCGCTGGG
C6              AAAGGGCCGCTCCGCACCACCATCGAACATGAGGCTCCCGTTGCGCTGGG
                **************************************************

C1              CGACAAGTTGGAGATCGTTTTGCACGTTCACCCTGCTGGCTCGACTGATC
C2              CGACAAGTTGGAGATCGTTTTGCACGTTCACCCTGCTGGCTCGACTGATC
C3              CGACAAGTTGGAGATCGTTTTGCACGTTCACCCTGCTGGCTCGACTGATC
C4              CGACAAGTTGGAGATCGTTTTGCACGTTCACCCTGCTGGCTCGACTGATC
C5              CGACAAGTTGGAGATCGTTTTGCACGTTCACCCTGCTGGCTCGACTGATC
C6              CGACAAGTTGGAGATCGTTTTGCACGTTCACCCTGCTGGCTCGACTGATC
                **************************************************

C1              AATTCGGTCCTGGCTTGGTTGACCGCTCTGTTATAACGCTCACATATACG
C2              AATTCGGTCCTGGCTTGGTTGACCGCTCTGTTATAACGCTCACATATACG
C3              AATTCGGTCCTGGCTTGGTTGACCGCTCTGTTATAACGCTCACATATACG
C4              AATTCGGTCCTGGCTTGGTTGACCGCTCTGTTATAACGCTCACATATACG
C5              AATTCGGTCCTGGCTTGGTTGACCGCTCTGTTATAACGCTCACATATACG
C6              AATTCGGTCCTGGCTTGGTTGACCGCTCTGTTATAACGCTCACATATACG
                **************************************************

C1              GTTGGCGACGAGACTAAAGCCATCGCTGCGATCTTCGCGCTG
C2              GTTGGCGACGAGACTAAAGCCATCGCTGCGATCTTCGCGCTG
C3              GTTGGCGACGAGACTAAAGCCATCGCTGCGATCTTCGCGCTG
C4              GTTGGCGACGAGACTAAAGCCATCGCTGCGATCTTCGCGCTG
C5              GTTGGCGACGAGACTAAAGCCATCGCTGCGATCTTCGCGCTG
C6              GTTGGCGACGAGACTAAAGCCATCGCTGCGATCTTCGCGCTG
                ******************************************



>C1
GTGAGCCTAGACAAGATAATGATGCCGGTTCCCGAAGGTCATCCCGATGT
GTTTGATCGTGAATGGCCGCTTCGCGTAGGGGACATCGACCGCACCGGTC
GGCTGCGATTAGACGCAGGTGTCCGGCATATCCAAGACATCGGTCAGGAT
CAACTGCGCGAGATGGGGTTCGAGGAGACCCACCCGCTGTGGATTGTGCG
CCGCACCATGGTTGACTTGATCCGTCCGGTTGAGTTCCAGGAAATGTTGC
GGCTGCGGCGGTGGTGTTCGGGTACCTCGAACCGGTGGTGTGAAATGCGT
GTCCGTATCGATGGGCGCAAGGGTGGCCTCATCGAGTCCGAGGCGTTTTG
GATCAACATCAACCGGGAAACTCAGATGCCGGCCCGCATCGCGGACGACT
TCCTGGCGGGCCTGCACAGGACCACGTCCGTCGATAGGCTGCGGTGGAGG
GGCTATTTGCAGCCGGGTAGCCGTGACGATGCGTCGGAAATCCACGAGTT
CCCGGTGCGGGTAACTGATATTGACTTGTTCGATCACATGAACAATTCGG
TGTACTGGAGCGTGATCGAGGACTATTTGGTGTCTCACTCCGAACTACTC
AAAGGGCCGCTCCGCACCACCATCGAACATGAGGCTCCCGTTGCGCTGGG
CGACAAGTTGGAGATCGTTTTGCACGTTCACCCTGCTGGCTCGACTGATC
AATTCGGTCCTGGCTTGGTTGACCGCTCTGTTATAACGCTCACATATACG
GTTGGCGACGAGACTAAAGCCATCGCTGCGATCTTCGCGCTG
>C2
GTGAGCCTAGACAAGATAATGATGCCGGTTCCCGAAGGTCATCCCGATGT
GTTTGATCGTGAATGGCCGCTTCGCGTAGGGGACATCGACCGCACCGGTC
GGCTGCGATTAGACGCAGGTGTCCGGCATATCCAAGACATCGGTCAGGAT
CAACTGCGCGAGATGGGGTTCGAGGAGACCCACCCGCTGTGGATTGTGCG
CCGCACCATGGTTGACTTGATCCGTCCGGTTGAGTTCCAGGAAATGTTGC
GGCTGCGGCGGTGGTGTTCGGGTACCTCGAACCGGTGGTGTGAAATGCGT
GTCCGTATCGATGGGCGCAAGGGTGGCCTCATCGAGTCCGAGGCGTTTTG
GATCAACATCAACCGGGAAACTCAGATGCCGGCCCGCATCGCGGACGACT
TCCTGGCGGGCCTGCACAGGACCACGTCCGTCGATAGGCTGCGGTGGAGG
GGCTATTTGCAGCCGGGTAGCCGTGACGATGCGTCGGAAATCCACGAGTT
CCCGGTGCGGGTAACTGATATTGACTTGTTCGATCACATGAACAATTCGG
TGTACTGGAGCGTGATCGAGGACTATTTGGTGTCTCACTCCGAACTACTC
AAAGGGCCGCTCCGCACCACCATCGAACATGAGGCTCCCGTTGCGCTGGG
CGACAAGTTGGAGATCGTTTTGCACGTTCACCCTGCTGGCTCGACTGATC
AATTCGGTCCTGGCTTGGTTGACCGCTCTGTTATAACGCTCACATATACG
GTTGGCGACGAGACTAAAGCCATCGCTGCGATCTTCGCGCTG
>C3
GTGAGCCTAGACAAGATAATGATGCCGGTTCCCGAAGGTCATCCCGATGT
GTTTGATCGTGAATGGCCGCTTCGCGTAGGGGACATCGACCGCACCGGTC
GGCTGCGATTAGACGCAGGTGTCCGGCATATCCAAGACATCGGTCAGGAT
CAACTGCGCGAGATGGGGTTCGAGGAGACCCACCCGCTGTGGATTGTGCG
CCGCACCATGGTTGACTTGATCCGTCCGGTTGAGTTCCAGGAAATGTTGC
GGCTGCGGCGGTGGTGTTCGGGTACCTCGAACCGGTGGTGTGAAATGCGT
GTCCGTATCGATGGGCGCAAGGGTGGCCTCATCGAGTCCGAGGCGTTTTG
GATCAACATCAACCGGGAAACTCAGATGCCGGCCCGCATCGCGGACGACT
TCCTGGCGGGCCTGCACAGGACCACGTCCGTCGATAGGCTGCGGTGGAGG
GGCTATTTGCAGCCGGGTAGCCGTGACGATGCGTCGGAAATCCACGAGTT
CCCGGTGCGGGTAACTGATATTGACTTGTTCGATCACATGAACAATTCGG
TGTACTGGAGCGTGATCGAGGACTATTTGGTGTCTCACTCCGAACTACTC
AAAGGGCCGCTCCGCACCACCATCGAACATGAGGCTCCCGTTGCGCTGGG
CGACAAGTTGGAGATCGTTTTGCACGTTCACCCTGCTGGCTCGACTGATC
AATTCGGTCCTGGCTTGGTTGACCGCTCTGTTATAACGCTCACATATACG
GTTGGCGACGAGACTAAAGCCATCGCTGCGATCTTCGCGCTG
>C4
GTGAGCCTAGACAAGATAATGATGCCGGTTCCCGAAGGTCATCCCGATGT
GTTTGATCGTGAATGGCCGCTTCGCGTAGGGGACATCGACCGCACCGGTC
GGCTGCGATTAGACGCAGGTGTCCGGCATATCCAAGACATCGGTCAGGAT
CAACTGCGCGAGATGGGGTTCGAGGAGACCCACCCGCTGTGGATTGTGCG
CCGCACCATGGTTGACTTGATCCGTCCGGTTGAGTTCCAGGAAATGTTGC
GGCTGCGGCGGTGGTGTTCGGGTACCTCGAACCGGTGGTGTGAAATGCGT
GTCCGTATCGATGGGCGCAAGGGTGGCCTCATCGAGTCCGAGGCGTTTTG
GATCAACATCAACCGGGAAACTCAGATGCCGGCCCGCATCGCGGACGACT
TCCTGGCGGGCCTGCACAGGACCACGTCCGTCGATAGGCTGCGGTGGAGG
GGCTATTTGCAGCCGGGTAGCCGTGACGATGCGTCGGAAATCCACGAGTT
CCCGGTGCGGGTAACTGATATTGACTTGTTCGATCACATGAACAATTCGG
TGTACTGGAGCGTGATCGAGGACTATTTGGTGTCTCACTCCGAACTACTC
AAAGGGCCGCTCCGCACCACCATCGAACATGAGGCTCCCGTTGCGCTGGG
CGACAAGTTGGAGATCGTTTTGCACGTTCACCCTGCTGGCTCGACTGATC
AATTCGGTCCTGGCTTGGTTGACCGCTCTGTTATAACGCTCACATATACG
GTTGGCGACGAGACTAAAGCCATCGCTGCGATCTTCGCGCTG
>C5
GTGAGCCTAGACAAGATAATGATGCCGGTTCCCGAAGGTCATCCCGATGT
GTTTGATCGTGAATGGCCGCTTCGCGTAGGGGACATCGACCGCACCGGTC
GGCTGCGATTAGACGCAGGTGTCCGGCATATCCAAGACATCGGTCAGGAT
CAACTGCGCGAGATGGGGTTCGAGGAGACCCACCCGCTGTGGATTGTGCG
CCGCACCATGGTTGACTTGATCCGTCCGGTTGAGTTCCAGGAAATGTTGC
GGCTGCGGCGGTGGTGTTCGGGTACCTCGAACCGGTGGTGTGAAATGCGT
GTCCGTATCGATGGGCGCAAGGGTGGCCTCATCGAGTCCGAGGCGTTTTG
GATCAACATCAACCGGGAAACTCAGATGCCGGCCCGCATCGCGGACGACT
TCCTGGCGGGCCTGCACAGGACCACGTCCGTCGATAGGCTGCGGTGGAGG
GGCTATTTGCAGCCGGGTAGCCGTGACGATGCGTCGGAAATCCACGAGTT
CCCGGTGCGGGTAACTGATATTGACTTGTTCGATCACATGAACAATTCGG
TGTACTGGAGCGTGATCGAGGACTATTTGGTGTCTCACTCCGAACTACTC
AAAGGGCCGCTCCGCACCACCATCGAACATGAGGCTCCCGTTGCGCTGGG
CGACAAGTTGGAGATCGTTTTGCACGTTCACCCTGCTGGCTCGACTGATC
AATTCGGTCCTGGCTTGGTTGACCGCTCTGTTATAACGCTCACATATACG
GTTGGCGACGAGACTAAAGCCATCGCTGCGATCTTCGCGCTG
>C6
GTGAGCCTAGACAAGATAATGATGCCGGTTCCCGAAGGTCATCCCGATGT
GTTTGATCGTGAATGGCCGCTTCGCGTAGGGGACATCGACCGCACCGGTC
GGCTGCGATTAGACGCAGGTGTCCGGCATATCCAAGACATCGGTCAGGAT
CAACTGCGCGAGATGGGGTTCGAGGAGACCCACCCGCTGTGGATTGTGCG
CCGCACCATGGTTGACTTGATCCGTCCGGTTGAGTTCCAGGAAATGTTGC
GGCTGCGGCGGTGGTGTTCGGGTACCTCGAACCGGTGGTGTGAAATGCGT
GTCCGTATCGATGGGCGCAAGGGTGGCCTCATCGAGTCCGAGGCGTTTTG
GATCAACATCAACCGGGAAACTCAGATGCCGGCCCGCATCGCGGACGACT
TCCTGGCGGGCCTGCACAGGACCACGTCCGTCGATAGGCTGCGGTGGAGG
GGCTATTTGCAGCCGGGTAGCCGTGACGATGCGTCGGAAATCCACGAGTT
CCCGGTGCGGGTAACTGATATTGACTTGTTCGATCACATGAACAATTCGG
TGTACTGGAGCGTGATCGAGGACTATTTGGTGTCTCACTCCGAACTACTC
AAAGGGCCGCTCCGCACCACCATCGAACATGAGGCTCCCGTTGCGCTGGG
CGACAAGTTGGAGATCGTTTTGCACGTTCACCCTGCTGGCTCGACTGATC
AATTCGGTCCTGGCTTGGTTGACCGCTCTGTTATAACGCTCACATATACG
GTTGGCGACGAGACTAAAGCCATCGCTGCGATCTTCGCGCTG
>C1
VSLDKIMMPVPEGHPDVFDREWPLRVGDIDRTGRLRLDAGVRHIQDIGQD
QLREMGFEETHPLWIVRRTMVDLIRPVEFQEMLRLRRWCSGTSNRWCEMR
VRIDGRKGGLIESEAFWININRETQMPARIADDFLAGLHRTTSVDRLRWR
GYLQPGSRDDASEIHEFPVRVTDIDLFDHMNNSVYWSVIEDYLVSHSELL
KGPLRTTIEHEAPVALGDKLEIVLHVHPAGSTDQFGPGLVDRSVITLTYT
VGDETKAIAAIFAL
>C2
VSLDKIMMPVPEGHPDVFDREWPLRVGDIDRTGRLRLDAGVRHIQDIGQD
QLREMGFEETHPLWIVRRTMVDLIRPVEFQEMLRLRRWCSGTSNRWCEMR
VRIDGRKGGLIESEAFWININRETQMPARIADDFLAGLHRTTSVDRLRWR
GYLQPGSRDDASEIHEFPVRVTDIDLFDHMNNSVYWSVIEDYLVSHSELL
KGPLRTTIEHEAPVALGDKLEIVLHVHPAGSTDQFGPGLVDRSVITLTYT
VGDETKAIAAIFAL
>C3
VSLDKIMMPVPEGHPDVFDREWPLRVGDIDRTGRLRLDAGVRHIQDIGQD
QLREMGFEETHPLWIVRRTMVDLIRPVEFQEMLRLRRWCSGTSNRWCEMR
VRIDGRKGGLIESEAFWININRETQMPARIADDFLAGLHRTTSVDRLRWR
GYLQPGSRDDASEIHEFPVRVTDIDLFDHMNNSVYWSVIEDYLVSHSELL
KGPLRTTIEHEAPVALGDKLEIVLHVHPAGSTDQFGPGLVDRSVITLTYT
VGDETKAIAAIFAL
>C4
VSLDKIMMPVPEGHPDVFDREWPLRVGDIDRTGRLRLDAGVRHIQDIGQD
QLREMGFEETHPLWIVRRTMVDLIRPVEFQEMLRLRRWCSGTSNRWCEMR
VRIDGRKGGLIESEAFWININRETQMPARIADDFLAGLHRTTSVDRLRWR
GYLQPGSRDDASEIHEFPVRVTDIDLFDHMNNSVYWSVIEDYLVSHSELL
KGPLRTTIEHEAPVALGDKLEIVLHVHPAGSTDQFGPGLVDRSVITLTYT
VGDETKAIAAIFAL
>C5
VSLDKIMMPVPEGHPDVFDREWPLRVGDIDRTGRLRLDAGVRHIQDIGQD
QLREMGFEETHPLWIVRRTMVDLIRPVEFQEMLRLRRWCSGTSNRWCEMR
VRIDGRKGGLIESEAFWININRETQMPARIADDFLAGLHRTTSVDRLRWR
GYLQPGSRDDASEIHEFPVRVTDIDLFDHMNNSVYWSVIEDYLVSHSELL
KGPLRTTIEHEAPVALGDKLEIVLHVHPAGSTDQFGPGLVDRSVITLTYT
VGDETKAIAAIFAL
>C6
VSLDKIMMPVPEGHPDVFDREWPLRVGDIDRTGRLRLDAGVRHIQDIGQD
QLREMGFEETHPLWIVRRTMVDLIRPVEFQEMLRLRRWCSGTSNRWCEMR
VRIDGRKGGLIESEAFWININRETQMPARIADDFLAGLHRTTSVDRLRWR
GYLQPGSRDDASEIHEFPVRVTDIDLFDHMNNSVYWSVIEDYLVSHSELL
KGPLRTTIEHEAPVALGDKLEIVLHVHPAGSTDQFGPGLVDRSVITLTYT
VGDETKAIAAIFAL


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/9res/ML2463/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 792 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579857459
      Setting output file names to "/data/9res/ML2463/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 690553771
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5739978565
      Seed = 1967970575
      Swapseed = 1579857459
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1772.533696 -- -24.965149
         Chain 2 -- -1772.533966 -- -24.965149
         Chain 3 -- -1772.533966 -- -24.965149
         Chain 4 -- -1772.533966 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1772.533966 -- -24.965149
         Chain 2 -- -1772.533696 -- -24.965149
         Chain 3 -- -1772.533966 -- -24.965149
         Chain 4 -- -1772.533863 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1772.534] (-1772.534) (-1772.534) (-1772.534) * [-1772.534] (-1772.534) (-1772.534) (-1772.534) 
        500 -- (-1100.685) (-1106.101) (-1099.695) [-1096.291] * [-1098.802] (-1095.361) (-1102.043) (-1111.179) -- 0:00:00
       1000 -- [-1091.285] (-1096.361) (-1097.469) (-1091.363) * [-1096.381] (-1093.294) (-1094.398) (-1098.748) -- 0:00:00
       1500 -- (-1100.846) (-1100.399) (-1095.039) [-1097.293] * [-1091.209] (-1099.203) (-1102.325) (-1099.835) -- 0:00:00
       2000 -- [-1091.932] (-1099.481) (-1102.340) (-1094.393) * [-1099.124] (-1094.112) (-1092.959) (-1095.940) -- 0:00:00
       2500 -- (-1099.349) (-1099.405) [-1098.221] (-1098.119) * (-1097.585) [-1099.526] (-1093.075) (-1095.244) -- 0:00:00
       3000 -- (-1101.121) (-1098.274) (-1096.397) [-1097.652] * [-1095.786] (-1099.518) (-1108.572) (-1100.173) -- 0:00:00
       3500 -- (-1097.295) (-1099.464) (-1097.403) [-1094.519] * [-1094.612] (-1105.559) (-1093.229) (-1098.280) -- 0:00:00
       4000 -- (-1095.979) (-1102.552) [-1103.116] (-1098.532) * [-1095.598] (-1098.502) (-1094.998) (-1097.990) -- 0:04:09
       4500 -- (-1094.693) (-1101.431) (-1105.463) [-1097.313] * (-1092.725) [-1094.701] (-1098.091) (-1104.817) -- 0:03:41
       5000 -- (-1094.290) (-1105.298) (-1100.097) [-1098.360] * (-1096.604) [-1094.544] (-1098.201) (-1097.256) -- 0:03:19

      Average standard deviation of split frequencies: 0.112239

       5500 -- (-1102.771) (-1096.307) [-1095.567] (-1094.614) * (-1091.815) [-1097.763] (-1101.549) (-1095.280) -- 0:03:00
       6000 -- (-1096.130) (-1101.079) [-1098.477] (-1099.014) * (-1104.280) [-1092.276] (-1100.818) (-1101.651) -- 0:02:45
       6500 -- [-1093.956] (-1096.461) (-1099.650) (-1095.047) * [-1094.006] (-1098.185) (-1103.937) (-1107.147) -- 0:02:32
       7000 -- (-1098.511) (-1095.065) (-1097.528) [-1096.940] * (-1098.998) [-1098.047] (-1098.498) (-1103.899) -- 0:02:21
       7500 -- (-1097.235) (-1097.664) [-1098.854] (-1096.376) * [-1099.140] (-1093.433) (-1097.267) (-1094.569) -- 0:02:12
       8000 -- (-1093.711) (-1095.684) (-1104.257) [-1095.158] * (-1102.280) (-1098.393) (-1096.232) [-1103.545] -- 0:02:04
       8500 -- (-1086.415) (-1096.659) [-1102.158] (-1099.133) * (-1094.475) [-1090.148] (-1098.320) (-1097.241) -- 0:01:56
       9000 -- (-1085.678) (-1096.608) (-1105.916) [-1092.907] * [-1102.089] (-1106.636) (-1097.122) (-1092.656) -- 0:01:50
       9500 -- [-1085.619] (-1097.938) (-1103.141) (-1098.456) * (-1092.902) [-1097.784] (-1091.699) (-1088.688) -- 0:01:44
      10000 -- [-1088.447] (-1092.499) (-1097.054) (-1102.161) * [-1099.994] (-1096.687) (-1092.892) (-1091.069) -- 0:01:39

      Average standard deviation of split frequencies: 0.090598

      10500 -- (-1091.587) [-1096.760] (-1093.306) (-1101.785) * (-1101.013) [-1091.456] (-1100.318) (-1091.395) -- 0:01:34
      11000 -- (-1090.234) (-1097.092) [-1093.620] (-1093.471) * (-1098.323) (-1104.123) [-1097.043] (-1087.759) -- 0:01:29
      11500 -- (-1088.291) (-1096.514) (-1095.219) [-1095.932] * (-1096.213) [-1092.349] (-1093.968) (-1087.361) -- 0:01:25
      12000 -- (-1090.446) [-1092.452] (-1098.177) (-1114.466) * [-1097.839] (-1096.106) (-1098.389) (-1086.811) -- 0:01:22
      12500 -- [-1086.427] (-1093.458) (-1095.852) (-1101.356) * (-1102.423) (-1102.922) [-1092.631] (-1086.973) -- 0:01:19
      13000 -- (-1088.012) (-1104.095) [-1090.296] (-1096.523) * (-1095.388) [-1095.885] (-1095.967) (-1090.714) -- 0:01:15
      13500 -- (-1087.447) [-1094.520] (-1099.177) (-1095.206) * (-1104.816) (-1097.259) [-1099.337] (-1090.722) -- 0:01:13
      14000 -- [-1085.623] (-1097.258) (-1096.337) (-1095.601) * [-1099.129] (-1091.905) (-1092.411) (-1090.584) -- 0:01:10
      14500 -- (-1085.596) [-1099.388] (-1100.410) (-1094.798) * (-1098.675) (-1101.223) (-1098.548) [-1089.699] -- 0:01:07
      15000 -- (-1085.657) (-1100.439) (-1096.607) [-1097.342] * [-1095.349] (-1098.046) (-1090.931) (-1088.175) -- 0:01:05

      Average standard deviation of split frequencies: 0.075130

      15500 -- (-1085.625) (-1098.268) (-1093.055) [-1097.413] * (-1096.834) (-1102.071) (-1090.959) [-1087.944] -- 0:01:03
      16000 -- [-1085.632] (-1099.519) (-1097.967) (-1108.913) * (-1092.728) [-1097.699] (-1100.529) (-1086.832) -- 0:01:01
      16500 -- (-1090.032) (-1098.619) [-1091.759] (-1106.130) * (-1100.797) (-1101.555) [-1101.738] (-1088.591) -- 0:00:59
      17000 -- (-1087.637) [-1096.334] (-1094.959) (-1096.712) * [-1091.363] (-1100.991) (-1102.753) (-1088.194) -- 0:00:57
      17500 -- (-1086.789) [-1093.574] (-1095.800) (-1096.350) * (-1103.840) (-1095.625) [-1103.888] (-1086.932) -- 0:00:56
      18000 -- (-1085.630) (-1108.770) (-1096.967) [-1095.321] * (-1099.246) [-1091.052] (-1101.800) (-1090.240) -- 0:00:54
      18500 -- (-1085.715) (-1097.944) (-1095.155) [-1099.423] * [-1096.304] (-1100.598) (-1089.649) (-1086.718) -- 0:00:53
      19000 -- (-1086.590) [-1100.755] (-1099.826) (-1094.540) * (-1098.285) [-1091.269] (-1088.579) (-1088.894) -- 0:00:51
      19500 -- [-1085.935] (-1095.929) (-1103.083) (-1108.919) * (-1099.156) (-1106.132) [-1089.867] (-1088.205) -- 0:01:40
      20000 -- [-1085.712] (-1102.905) (-1097.902) (-1096.742) * (-1101.627) (-1099.384) [-1087.983] (-1088.107) -- 0:01:38

      Average standard deviation of split frequencies: 0.063063

      20500 -- (-1087.681) [-1093.051] (-1100.530) (-1096.732) * (-1096.873) (-1098.569) [-1088.272] (-1091.213) -- 0:01:35
      21000 -- (-1086.050) [-1100.051] (-1093.920) (-1095.479) * (-1091.815) (-1103.465) [-1088.602] (-1093.209) -- 0:01:33
      21500 -- [-1086.977] (-1095.803) (-1094.957) (-1097.692) * [-1098.095] (-1095.112) (-1086.909) (-1088.691) -- 0:01:31
      22000 -- (-1088.020) (-1096.244) (-1094.860) [-1091.594] * (-1095.789) (-1099.375) [-1087.258] (-1088.720) -- 0:01:28
      22500 -- (-1089.750) [-1096.965] (-1096.237) (-1091.954) * [-1093.191] (-1101.301) (-1086.756) (-1089.045) -- 0:01:26
      23000 -- (-1090.803) [-1097.613] (-1096.279) (-1092.836) * (-1098.469) [-1093.557] (-1088.304) (-1086.902) -- 0:01:24
      23500 -- (-1086.075) (-1104.866) (-1096.688) [-1097.334] * [-1095.584] (-1098.224) (-1086.689) (-1086.461) -- 0:01:23
      24000 -- (-1087.866) [-1096.589] (-1105.089) (-1096.344) * (-1095.427) [-1102.440] (-1087.057) (-1086.284) -- 0:01:21
      24500 -- (-1087.023) [-1099.375] (-1097.854) (-1095.150) * (-1094.113) (-1091.043) (-1086.126) [-1086.293] -- 0:01:19
      25000 -- (-1090.965) [-1090.976] (-1097.081) (-1101.268) * [-1093.649] (-1088.132) (-1091.234) (-1087.814) -- 0:01:18

      Average standard deviation of split frequencies: 0.040795

      25500 -- [-1087.982] (-1131.366) (-1093.437) (-1094.882) * (-1092.340) [-1090.372] (-1088.958) (-1086.642) -- 0:01:16
      26000 -- (-1086.559) (-1112.327) [-1092.647] (-1095.517) * (-1097.990) [-1086.475] (-1088.060) (-1086.234) -- 0:01:14
      26500 -- (-1085.863) (-1088.633) [-1097.344] (-1095.038) * [-1089.629] (-1095.507) (-1088.233) (-1087.104) -- 0:01:13
      27000 -- (-1085.651) (-1086.501) [-1094.723] (-1098.531) * [-1101.885] (-1096.694) (-1087.820) (-1090.638) -- 0:01:12
      27500 -- (-1086.332) [-1086.491] (-1093.098) (-1103.420) * (-1089.651) [-1087.721] (-1086.885) (-1088.246) -- 0:01:10
      28000 -- (-1085.656) (-1087.709) [-1099.092] (-1102.185) * (-1096.189) (-1088.597) (-1087.632) [-1087.689] -- 0:01:09
      28500 -- [-1087.068] (-1087.515) (-1097.370) (-1102.275) * (-1094.767) (-1087.534) [-1086.635] (-1088.481) -- 0:01:08
      29000 -- (-1090.905) (-1087.886) [-1097.552] (-1092.284) * (-1094.558) (-1087.449) [-1086.533] (-1090.028) -- 0:01:06
      29500 -- (-1089.770) (-1087.462) [-1099.975] (-1098.269) * (-1095.743) (-1090.922) [-1093.423] (-1088.533) -- 0:01:05
      30000 -- (-1090.587) [-1089.699] (-1096.247) (-1093.476) * [-1094.450] (-1087.928) (-1086.846) (-1088.297) -- 0:01:04

      Average standard deviation of split frequencies: 0.034160

      30500 -- [-1086.791] (-1087.686) (-1099.147) (-1097.117) * (-1097.059) (-1086.663) (-1091.000) [-1089.191] -- 0:01:03
      31000 -- (-1087.137) (-1089.144) [-1095.016] (-1096.325) * (-1095.797) (-1086.817) [-1085.937] (-1088.433) -- 0:01:02
      31500 -- [-1086.502] (-1088.285) (-1108.884) (-1096.207) * [-1097.608] (-1087.994) (-1086.037) (-1092.940) -- 0:01:01
      32000 -- (-1090.061) [-1086.445] (-1096.909) (-1106.589) * [-1095.508] (-1087.766) (-1086.899) (-1089.487) -- 0:01:00
      32500 -- (-1087.883) (-1088.069) [-1094.186] (-1091.257) * [-1093.070] (-1090.251) (-1087.493) (-1088.630) -- 0:00:59
      33000 -- (-1092.971) [-1087.363] (-1094.677) (-1098.100) * (-1102.079) [-1087.709] (-1091.247) (-1087.943) -- 0:00:58
      33500 -- (-1089.500) (-1087.018) [-1097.290] (-1101.606) * (-1094.457) (-1086.832) (-1086.119) [-1091.447] -- 0:00:57
      34000 -- [-1088.100] (-1087.324) (-1110.795) (-1092.659) * (-1098.927) (-1089.554) (-1088.778) [-1094.824] -- 0:00:56
      34500 -- [-1086.310] (-1087.099) (-1095.240) (-1090.517) * (-1105.316) [-1085.625] (-1088.977) (-1088.811) -- 0:00:55
      35000 -- (-1090.998) (-1090.743) (-1100.052) [-1088.389] * (-1105.513) [-1089.276] (-1089.094) (-1090.687) -- 0:00:55

      Average standard deviation of split frequencies: 0.024734

      35500 -- (-1090.786) [-1088.912] (-1097.111) (-1087.077) * [-1092.901] (-1088.453) (-1090.246) (-1090.431) -- 0:01:21
      36000 -- (-1094.005) (-1088.862) (-1099.411) [-1087.044] * [-1092.077] (-1090.106) (-1093.092) (-1090.854) -- 0:01:20
      36500 -- [-1088.889] (-1088.894) (-1098.805) (-1087.410) * (-1093.005) (-1087.853) (-1086.307) [-1090.258] -- 0:01:19
      37000 -- (-1091.850) (-1091.033) (-1097.828) [-1088.330] * (-1106.716) (-1086.932) [-1086.597] (-1088.859) -- 0:01:18
      37500 -- (-1086.306) [-1087.802] (-1091.034) (-1089.175) * (-1102.792) (-1087.234) (-1087.278) [-1090.469] -- 0:01:17
      38000 -- (-1087.033) [-1088.282] (-1093.634) (-1087.762) * (-1097.392) [-1087.003] (-1090.267) (-1088.419) -- 0:01:15
      38500 -- (-1087.616) (-1092.071) [-1092.322] (-1086.913) * (-1095.412) [-1088.692] (-1086.917) (-1086.156) -- 0:01:14
      39000 -- (-1087.132) (-1089.665) (-1096.011) [-1086.798] * (-1102.242) (-1088.742) [-1086.388] (-1085.972) -- 0:01:13
      39500 -- (-1086.867) (-1088.078) [-1096.664] (-1086.703) * [-1096.915] (-1088.765) (-1087.765) (-1087.633) -- 0:01:12
      40000 -- [-1089.552] (-1093.429) (-1093.638) (-1087.560) * (-1100.904) [-1088.444] (-1085.661) (-1086.517) -- 0:01:12

      Average standard deviation of split frequencies: 0.023866

      40500 -- (-1088.432) (-1089.198) (-1097.458) [-1086.799] * (-1094.611) [-1088.615] (-1085.602) (-1086.485) -- 0:01:11
      41000 -- (-1088.362) (-1089.079) [-1092.915] (-1087.501) * (-1096.461) (-1088.242) (-1087.195) [-1086.363] -- 0:01:10
      41500 -- (-1088.382) (-1090.242) [-1095.381] (-1088.380) * [-1097.416] (-1088.057) (-1086.385) (-1087.974) -- 0:01:09
      42000 -- (-1087.206) (-1089.214) (-1101.246) [-1088.990] * (-1096.155) (-1090.275) (-1087.459) [-1086.851] -- 0:01:08
      42500 -- [-1085.721] (-1090.160) (-1103.843) (-1088.296) * [-1093.283] (-1088.867) (-1090.766) (-1087.788) -- 0:01:07
      43000 -- [-1086.651] (-1088.691) (-1099.329) (-1088.057) * (-1096.888) (-1089.741) (-1088.814) [-1088.321] -- 0:01:06
      43500 -- [-1088.520] (-1094.297) (-1089.598) (-1086.453) * (-1100.244) (-1087.462) (-1085.964) [-1086.956] -- 0:01:05
      44000 -- [-1086.603] (-1089.892) (-1086.106) (-1087.186) * (-1093.682) [-1086.765] (-1085.790) (-1089.474) -- 0:01:05
      44500 -- [-1086.782] (-1089.492) (-1086.893) (-1087.514) * (-1090.165) [-1087.323] (-1087.295) (-1088.781) -- 0:01:04
      45000 -- (-1087.091) [-1090.448] (-1086.285) (-1087.702) * (-1095.373) (-1087.815) [-1088.378] (-1086.616) -- 0:01:03

      Average standard deviation of split frequencies: 0.022114

      45500 -- (-1086.396) (-1086.414) (-1087.410) [-1087.307] * (-1099.809) (-1087.428) [-1088.343] (-1087.906) -- 0:01:02
      46000 -- (-1087.944) (-1086.047) (-1086.990) [-1088.134] * [-1096.174] (-1087.631) (-1088.960) (-1087.803) -- 0:01:02
      46500 -- (-1089.377) (-1086.804) [-1087.404] (-1090.421) * (-1098.301) (-1087.347) [-1089.339] (-1087.350) -- 0:01:01
      47000 -- [-1088.119] (-1087.106) (-1088.574) (-1089.300) * (-1095.220) (-1087.396) [-1089.210] (-1088.860) -- 0:01:00
      47500 -- (-1087.700) [-1085.829] (-1085.650) (-1086.085) * (-1093.282) [-1087.907] (-1085.426) (-1086.288) -- 0:01:00
      48000 -- (-1087.486) [-1086.071] (-1085.831) (-1086.354) * (-1095.571) (-1088.598) [-1086.147] (-1086.002) -- 0:00:59
      48500 -- (-1086.222) (-1086.778) [-1085.984] (-1086.779) * [-1094.943] (-1087.168) (-1085.747) (-1088.714) -- 0:00:58
      49000 -- (-1087.608) [-1087.238] (-1088.584) (-1088.231) * (-1091.593) [-1086.723] (-1085.994) (-1085.655) -- 0:00:58
      49500 -- (-1086.392) [-1087.291] (-1090.421) (-1088.079) * (-1093.083) (-1086.620) (-1086.306) [-1087.977] -- 0:00:57
      50000 -- (-1086.708) (-1086.460) (-1087.484) [-1087.004] * (-1095.359) [-1086.988] (-1087.380) (-1087.964) -- 0:00:57

      Average standard deviation of split frequencies: 0.024081

      50500 -- (-1086.044) (-1093.978) [-1086.650] (-1089.594) * (-1093.043) [-1087.115] (-1086.415) (-1085.830) -- 0:00:56
      51000 -- (-1087.685) [-1090.681] (-1087.106) (-1091.239) * (-1096.914) (-1088.994) (-1087.429) [-1087.195] -- 0:00:55
      51500 -- (-1085.974) [-1094.102] (-1086.730) (-1088.137) * (-1096.285) (-1087.178) [-1087.424] (-1089.773) -- 0:01:13
      52000 -- (-1088.373) (-1092.875) (-1086.259) [-1090.361] * (-1103.246) (-1086.170) (-1087.508) [-1088.660] -- 0:01:12
      52500 -- (-1086.669) [-1088.836] (-1086.469) (-1089.326) * [-1093.064] (-1086.732) (-1093.483) (-1089.839) -- 0:01:12
      53000 -- [-1087.401] (-1089.931) (-1086.450) (-1087.180) * (-1096.871) [-1086.867] (-1090.787) (-1091.015) -- 0:01:11
      53500 -- [-1086.053] (-1088.718) (-1087.277) (-1087.275) * (-1106.009) (-1087.064) (-1087.360) [-1088.293] -- 0:01:10
      54000 -- [-1086.327] (-1086.804) (-1086.323) (-1092.146) * (-1103.818) (-1087.306) (-1087.084) [-1091.359] -- 0:01:10
      54500 -- [-1094.487] (-1087.144) (-1086.277) (-1091.298) * (-1101.425) (-1088.553) [-1088.063] (-1088.793) -- 0:01:09
      55000 -- (-1085.834) [-1086.547] (-1086.534) (-1091.997) * (-1109.868) (-1088.923) (-1088.838) [-1089.225] -- 0:01:08

      Average standard deviation of split frequencies: 0.022915

      55500 -- [-1087.390] (-1089.394) (-1088.031) (-1088.374) * (-1093.658) (-1087.606) [-1086.844] (-1087.077) -- 0:01:08
      56000 -- (-1087.414) (-1086.271) (-1086.685) [-1088.748] * (-1098.216) (-1088.436) (-1087.139) [-1087.875] -- 0:01:07
      56500 -- (-1089.990) [-1086.713] (-1088.035) (-1089.033) * (-1093.291) [-1088.442] (-1087.280) (-1087.158) -- 0:01:06
      57000 -- (-1086.277) [-1086.690] (-1086.243) (-1088.371) * (-1095.798) (-1092.442) [-1088.566] (-1087.160) -- 0:01:06
      57500 -- (-1087.872) (-1086.866) [-1086.591] (-1088.702) * (-1100.024) (-1090.061) (-1089.837) [-1092.623] -- 0:01:05
      58000 -- (-1089.238) (-1091.315) (-1088.126) [-1085.653] * [-1094.469] (-1092.121) (-1086.628) (-1092.876) -- 0:01:04
      58500 -- (-1091.662) (-1095.038) (-1088.558) [-1086.065] * [-1103.898] (-1090.341) (-1087.073) (-1088.215) -- 0:01:04
      59000 -- (-1088.548) [-1090.062] (-1088.012) (-1087.981) * (-1098.347) (-1086.158) (-1088.544) [-1087.281] -- 0:01:03
      59500 -- (-1085.815) (-1091.133) (-1086.956) [-1087.839] * (-1102.890) [-1088.291] (-1087.538) (-1086.654) -- 0:01:03
      60000 -- (-1087.535) (-1089.843) (-1088.174) [-1089.987] * (-1096.316) (-1086.647) (-1088.525) [-1087.081] -- 0:01:02

      Average standard deviation of split frequencies: 0.023743

      60500 -- (-1087.895) [-1086.688] (-1087.170) (-1091.422) * (-1096.091) (-1085.391) (-1093.432) [-1087.094] -- 0:01:02
      61000 -- (-1088.037) [-1087.366] (-1088.337) (-1088.904) * [-1102.087] (-1085.418) (-1086.976) (-1085.996) -- 0:01:01
      61500 -- [-1088.914] (-1088.133) (-1085.955) (-1087.966) * [-1091.420] (-1086.311) (-1090.315) (-1086.456) -- 0:01:01
      62000 -- (-1088.643) (-1087.725) [-1086.267] (-1087.822) * [-1091.281] (-1089.580) (-1086.430) (-1086.429) -- 0:01:00
      62500 -- (-1088.020) (-1086.251) [-1087.596] (-1087.684) * (-1095.463) [-1085.834] (-1085.502) (-1087.998) -- 0:01:00
      63000 -- [-1087.610] (-1087.578) (-1088.193) (-1086.238) * (-1101.822) [-1086.156] (-1086.093) (-1093.430) -- 0:00:59
      63500 -- (-1088.392) (-1086.993) (-1088.008) [-1086.338] * (-1095.631) (-1087.486) [-1086.852] (-1092.726) -- 0:00:58
      64000 -- (-1089.064) [-1087.062] (-1087.141) (-1086.984) * [-1094.528] (-1087.414) (-1086.468) (-1087.107) -- 0:00:58
      64500 -- [-1088.244] (-1088.620) (-1092.765) (-1086.838) * (-1107.487) [-1089.353] (-1087.493) (-1088.239) -- 0:00:58
      65000 -- (-1087.275) (-1087.311) (-1091.176) [-1087.275] * (-1091.280) (-1087.666) (-1086.905) [-1085.910] -- 0:00:57

      Average standard deviation of split frequencies: 0.023927

      65500 -- (-1086.285) [-1088.361] (-1088.668) (-1087.894) * [-1086.253] (-1088.952) (-1088.341) (-1087.817) -- 0:00:57
      66000 -- [-1087.818] (-1088.647) (-1094.542) (-1088.102) * [-1089.954] (-1090.288) (-1087.740) (-1087.198) -- 0:00:56
      66500 -- (-1087.659) (-1087.527) [-1088.310] (-1090.042) * (-1087.875) (-1086.718) (-1087.351) [-1086.788] -- 0:00:56
      67000 -- (-1086.221) (-1086.182) (-1089.115) [-1087.194] * (-1087.090) (-1085.852) [-1087.618] (-1086.822) -- 0:00:55
      67500 -- (-1086.506) (-1086.133) [-1088.446] (-1089.568) * (-1088.939) (-1085.850) (-1085.937) [-1088.985] -- 0:01:09
      68000 -- (-1086.548) [-1086.117] (-1091.536) (-1090.082) * (-1087.591) (-1086.689) [-1085.831] (-1086.227) -- 0:01:08
      68500 -- [-1089.261] (-1088.568) (-1087.380) (-1088.943) * (-1089.874) (-1086.923) [-1086.320] (-1086.124) -- 0:01:07
      69000 -- [-1086.430] (-1089.716) (-1090.513) (-1093.878) * (-1090.213) (-1086.485) [-1087.117] (-1088.210) -- 0:01:07
      69500 -- (-1087.897) [-1090.030] (-1089.727) (-1088.875) * [-1087.689] (-1088.645) (-1089.335) (-1089.852) -- 0:01:06
      70000 -- (-1088.788) (-1091.022) (-1089.270) [-1088.705] * (-1091.400) [-1087.451] (-1091.000) (-1087.411) -- 0:01:06

      Average standard deviation of split frequencies: 0.019679

      70500 -- [-1090.510] (-1086.573) (-1089.141) (-1089.801) * (-1091.235) [-1087.484] (-1087.053) (-1088.686) -- 0:01:05
      71000 -- [-1089.417] (-1087.776) (-1087.597) (-1088.412) * (-1091.164) (-1087.630) [-1086.497] (-1086.805) -- 0:01:05
      71500 -- (-1087.170) [-1087.740] (-1090.126) (-1089.194) * [-1092.408] (-1088.481) (-1087.011) (-1088.421) -- 0:01:04
      72000 -- (-1089.552) (-1090.056) (-1091.276) [-1091.487] * [-1089.330] (-1089.585) (-1087.175) (-1086.688) -- 0:01:04
      72500 -- (-1089.141) (-1092.282) (-1089.892) [-1089.804] * [-1088.863] (-1086.685) (-1086.488) (-1087.988) -- 0:01:03
      73000 -- (-1088.555) (-1088.155) (-1087.069) [-1086.356] * (-1088.266) (-1087.389) (-1086.275) [-1089.437] -- 0:01:03
      73500 -- (-1089.024) [-1088.021] (-1088.877) (-1086.747) * (-1086.940) (-1091.228) [-1088.816] (-1091.422) -- 0:01:03
      74000 -- (-1086.130) (-1091.063) (-1086.802) [-1086.680] * [-1087.164] (-1092.133) (-1087.520) (-1090.264) -- 0:01:02
      74500 -- (-1088.527) (-1085.746) [-1091.421] (-1087.942) * (-1087.284) [-1088.871] (-1088.243) (-1090.199) -- 0:01:02
      75000 -- [-1087.702] (-1086.633) (-1089.991) (-1087.463) * (-1086.546) (-1088.462) [-1087.571] (-1088.547) -- 0:01:01

      Average standard deviation of split frequencies: 0.018282

      75500 -- (-1090.862) [-1087.399] (-1087.363) (-1087.601) * (-1088.631) [-1088.997] (-1088.374) (-1086.940) -- 0:01:01
      76000 -- (-1088.124) [-1086.889] (-1085.937) (-1088.905) * (-1087.411) [-1088.292] (-1087.662) (-1086.940) -- 0:01:00
      76500 -- (-1087.431) (-1091.569) (-1088.535) [-1087.384] * (-1087.613) (-1086.412) [-1087.048] (-1087.988) -- 0:01:00
      77000 -- (-1086.725) (-1086.313) [-1089.982] (-1086.683) * (-1088.108) (-1086.986) [-1089.823] (-1085.879) -- 0:00:59
      77500 -- (-1087.729) [-1089.250] (-1091.295) (-1087.170) * (-1087.713) (-1086.550) (-1088.409) [-1087.261] -- 0:00:59
      78000 -- (-1088.030) (-1089.684) (-1090.432) [-1090.871] * [-1086.939] (-1087.484) (-1088.687) (-1087.401) -- 0:00:59
      78500 -- (-1087.197) [-1085.780] (-1091.335) (-1094.713) * (-1086.787) (-1087.457) [-1086.184] (-1089.799) -- 0:00:58
      79000 -- (-1089.057) [-1087.508] (-1086.976) (-1090.171) * [-1087.641] (-1087.937) (-1087.355) (-1086.255) -- 0:00:58
      79500 -- (-1087.822) (-1086.506) [-1087.042] (-1087.118) * (-1086.537) (-1087.744) [-1087.522] (-1088.999) -- 0:00:57
      80000 -- [-1087.727] (-1086.809) (-1087.421) (-1087.577) * (-1087.656) (-1086.729) [-1086.481] (-1091.677) -- 0:00:57

      Average standard deviation of split frequencies: 0.020300

      80500 -- (-1088.370) [-1088.749] (-1089.384) (-1086.730) * [-1087.051] (-1087.303) (-1087.888) (-1089.396) -- 0:00:57
      81000 -- (-1087.761) (-1086.964) (-1090.777) [-1089.987] * (-1087.382) (-1087.301) (-1089.351) [-1086.769] -- 0:00:56
      81500 -- [-1088.341] (-1092.443) (-1093.689) (-1090.180) * (-1089.275) (-1087.519) (-1086.851) [-1086.953] -- 0:00:56
      82000 -- (-1087.990) [-1090.402] (-1090.763) (-1090.416) * (-1088.500) [-1086.811] (-1089.703) (-1085.984) -- 0:00:55
      82500 -- (-1090.281) (-1087.860) (-1094.294) [-1086.721] * [-1089.304] (-1088.999) (-1091.128) (-1085.626) -- 0:00:55
      83000 -- (-1089.940) (-1089.464) [-1093.333] (-1085.865) * (-1087.835) [-1087.044] (-1089.301) (-1086.578) -- 0:00:55
      83500 -- (-1087.371) (-1089.399) (-1090.169) [-1087.254] * [-1088.917] (-1090.741) (-1088.951) (-1086.368) -- 0:01:05
      84000 -- (-1089.148) (-1093.870) (-1085.989) [-1088.272] * [-1086.887] (-1087.544) (-1088.885) (-1087.220) -- 0:01:05
      84500 -- [-1086.165] (-1090.065) (-1086.530) (-1089.492) * (-1089.389) (-1087.812) [-1089.390] (-1087.851) -- 0:01:05
      85000 -- (-1085.742) [-1087.585] (-1088.938) (-1085.510) * (-1088.501) (-1089.237) (-1091.690) [-1090.429] -- 0:01:04

      Average standard deviation of split frequencies: 0.020483

      85500 -- (-1090.982) (-1088.223) (-1086.177) [-1085.907] * [-1087.696] (-1086.894) (-1090.989) (-1088.005) -- 0:01:04
      86000 -- (-1092.888) (-1087.442) [-1086.041] (-1089.540) * (-1087.520) [-1086.899] (-1090.059) (-1088.322) -- 0:01:03
      86500 -- (-1091.890) [-1086.907] (-1087.237) (-1087.610) * [-1088.968] (-1086.517) (-1089.123) (-1086.426) -- 0:01:03
      87000 -- [-1086.974] (-1087.178) (-1086.457) (-1087.146) * (-1090.049) (-1088.239) [-1088.948] (-1088.693) -- 0:01:02
      87500 -- [-1086.781] (-1086.264) (-1087.489) (-1087.125) * (-1089.240) [-1087.928] (-1089.465) (-1088.945) -- 0:01:02
      88000 -- (-1086.825) (-1087.927) (-1089.756) [-1086.077] * (-1087.469) [-1087.338] (-1089.306) (-1087.213) -- 0:01:02
      88500 -- [-1087.963] (-1087.130) (-1086.221) (-1086.036) * (-1086.749) [-1087.623] (-1092.081) (-1087.235) -- 0:01:01
      89000 -- (-1087.416) [-1085.534] (-1087.177) (-1087.652) * (-1086.644) [-1086.430] (-1091.544) (-1085.715) -- 0:01:01
      89500 -- [-1087.275] (-1085.611) (-1086.720) (-1086.761) * (-1087.951) (-1087.486) [-1087.490] (-1097.656) -- 0:01:01
      90000 -- (-1086.617) (-1087.293) (-1087.642) [-1085.891] * (-1089.095) [-1088.686] (-1087.145) (-1090.499) -- 0:01:00

      Average standard deviation of split frequencies: 0.021086

      90500 -- (-1086.061) (-1089.557) [-1089.160] (-1087.550) * [-1088.697] (-1093.755) (-1088.712) (-1090.609) -- 0:01:00
      91000 -- (-1087.100) (-1086.189) [-1088.064] (-1088.814) * (-1088.741) (-1090.941) [-1088.660] (-1087.726) -- 0:00:59
      91500 -- [-1089.106] (-1087.023) (-1086.873) (-1087.212) * [-1087.319] (-1088.647) (-1095.284) (-1090.125) -- 0:00:59
      92000 -- (-1087.097) (-1090.282) [-1087.738] (-1087.212) * (-1090.429) (-1088.803) (-1089.183) [-1087.544] -- 0:00:59
      92500 -- (-1086.061) (-1089.154) (-1096.335) [-1088.672] * [-1090.763] (-1088.116) (-1090.448) (-1092.496) -- 0:00:58
      93000 -- (-1086.439) [-1088.327] (-1095.877) (-1089.145) * (-1091.478) [-1088.734] (-1091.667) (-1089.053) -- 0:00:58
      93500 -- (-1088.080) (-1090.651) (-1091.747) [-1087.023] * (-1090.159) (-1088.640) [-1088.758] (-1087.915) -- 0:00:58
      94000 -- (-1085.849) [-1088.350] (-1090.678) (-1086.854) * (-1086.434) [-1086.962] (-1090.884) (-1088.901) -- 0:00:57
      94500 -- (-1087.858) (-1088.487) (-1088.581) [-1085.976] * (-1087.776) (-1087.925) [-1088.058] (-1087.508) -- 0:00:57
      95000 -- [-1086.541] (-1087.430) (-1088.221) (-1088.525) * [-1088.620] (-1087.476) (-1086.183) (-1090.272) -- 0:00:57

      Average standard deviation of split frequencies: 0.018551

      95500 -- [-1088.603] (-1087.252) (-1086.362) (-1089.104) * [-1087.773] (-1091.148) (-1086.822) (-1087.912) -- 0:00:56
      96000 -- [-1088.707] (-1089.138) (-1089.225) (-1087.735) * (-1088.339) [-1091.040] (-1085.569) (-1086.712) -- 0:00:56
      96500 -- (-1092.163) [-1086.325] (-1087.921) (-1090.698) * (-1088.570) (-1086.653) [-1086.580] (-1091.517) -- 0:00:56
      97000 -- (-1088.897) (-1086.567) (-1086.307) [-1088.505] * (-1087.119) (-1088.364) [-1087.904] (-1086.199) -- 0:00:55
      97500 -- [-1086.245] (-1086.646) (-1086.753) (-1086.934) * (-1086.901) [-1087.650] (-1087.235) (-1089.268) -- 0:00:55
      98000 -- (-1088.869) [-1087.213] (-1088.874) (-1085.956) * (-1087.151) [-1088.795] (-1087.803) (-1086.483) -- 0:00:55
      98500 -- [-1088.008] (-1088.122) (-1088.489) (-1086.678) * (-1087.193) (-1087.301) [-1087.407] (-1088.209) -- 0:00:54
      99000 -- (-1089.676) (-1085.693) (-1089.024) [-1087.906] * (-1087.057) (-1087.685) [-1087.334] (-1091.413) -- 0:00:54
      99500 -- [-1087.094] (-1089.417) (-1088.401) (-1086.274) * (-1087.355) [-1086.754] (-1087.135) (-1091.419) -- 0:00:54
      100000 -- (-1086.160) (-1088.736) [-1085.671] (-1091.018) * (-1088.817) [-1088.449] (-1087.135) (-1086.720) -- 0:01:02

      Average standard deviation of split frequencies: 0.020813

      100500 -- [-1089.535] (-1087.010) (-1091.725) (-1087.167) * (-1088.414) (-1087.341) [-1085.485] (-1087.400) -- 0:01:02
      101000 -- [-1090.878] (-1089.868) (-1085.687) (-1087.681) * (-1088.921) (-1089.517) (-1085.499) [-1087.920] -- 0:01:02
      101500 -- [-1091.247] (-1089.940) (-1086.238) (-1087.156) * (-1087.758) (-1089.327) (-1086.877) [-1087.987] -- 0:01:01
      102000 -- [-1087.906] (-1088.635) (-1086.007) (-1088.730) * [-1092.206] (-1087.801) (-1089.577) (-1088.002) -- 0:01:01
      102500 -- (-1088.126) [-1087.486] (-1086.588) (-1089.704) * (-1091.633) (-1087.222) (-1087.153) [-1088.951] -- 0:01:01
      103000 -- (-1090.052) [-1089.078] (-1088.053) (-1088.990) * [-1094.445] (-1087.985) (-1089.152) (-1087.594) -- 0:01:00
      103500 -- (-1088.486) (-1089.327) [-1086.329] (-1086.968) * [-1087.048] (-1087.345) (-1088.589) (-1087.839) -- 0:01:00
      104000 -- [-1090.364] (-1086.066) (-1086.705) (-1089.304) * [-1087.564] (-1087.674) (-1086.353) (-1088.509) -- 0:01:00
      104500 -- (-1086.691) [-1086.107] (-1087.144) (-1088.800) * (-1087.767) [-1087.028] (-1087.694) (-1087.852) -- 0:00:59
      105000 -- [-1090.380] (-1088.248) (-1086.289) (-1090.037) * (-1086.185) (-1086.988) (-1089.068) [-1088.981] -- 0:00:59

      Average standard deviation of split frequencies: 0.020012

      105500 -- (-1087.112) (-1086.498) [-1087.430] (-1087.665) * (-1089.049) [-1086.445] (-1087.176) (-1087.671) -- 0:00:59
      106000 -- (-1089.328) (-1085.904) [-1086.039] (-1086.203) * (-1086.900) (-1087.189) [-1086.458] (-1085.820) -- 0:00:59
      106500 -- (-1086.208) (-1087.366) (-1086.781) [-1089.504] * (-1088.526) (-1086.575) (-1089.687) [-1087.304] -- 0:00:58
      107000 -- [-1085.631] (-1087.183) (-1088.078) (-1088.905) * (-1086.816) (-1089.387) (-1087.649) [-1087.774] -- 0:00:58
      107500 -- (-1086.355) [-1088.566] (-1091.126) (-1088.749) * (-1088.707) (-1089.225) [-1088.379] (-1089.524) -- 0:00:58
      108000 -- [-1088.056] (-1088.209) (-1090.558) (-1087.851) * (-1090.362) (-1093.852) (-1090.370) [-1087.104] -- 0:00:57
      108500 -- [-1086.135] (-1086.510) (-1090.332) (-1089.042) * (-1089.962) (-1090.119) [-1088.218] (-1086.018) -- 0:00:57
      109000 -- (-1085.918) (-1086.624) [-1089.808] (-1087.091) * (-1089.269) [-1086.665] (-1087.081) (-1089.390) -- 0:00:57
      109500 -- [-1086.673] (-1088.422) (-1090.942) (-1086.122) * (-1085.601) (-1088.107) [-1087.294] (-1087.156) -- 0:00:56
      110000 -- (-1088.474) [-1088.280] (-1088.203) (-1086.595) * (-1090.445) [-1086.365] (-1089.617) (-1086.627) -- 0:00:56

      Average standard deviation of split frequencies: 0.020115

      110500 -- (-1088.051) (-1086.969) (-1087.013) [-1087.678] * [-1087.672] (-1086.997) (-1086.745) (-1087.038) -- 0:00:56
      111000 -- (-1088.389) (-1085.964) [-1086.819] (-1088.295) * [-1087.610] (-1085.826) (-1086.245) (-1086.775) -- 0:00:56
      111500 -- (-1088.192) (-1088.333) (-1087.663) [-1089.325] * [-1087.016] (-1086.193) (-1086.896) (-1086.125) -- 0:00:55
      112000 -- [-1089.533] (-1088.908) (-1088.388) (-1087.409) * (-1085.575) [-1088.688] (-1086.526) (-1087.495) -- 0:00:55
      112500 -- [-1086.756] (-1089.326) (-1090.674) (-1088.839) * (-1090.537) (-1088.688) (-1086.595) [-1088.454] -- 0:00:55
      113000 -- (-1085.950) [-1089.321] (-1088.295) (-1090.225) * (-1089.569) [-1087.103] (-1089.078) (-1087.202) -- 0:00:54
      113500 -- (-1088.735) (-1088.015) [-1089.249] (-1088.937) * (-1090.156) (-1087.387) [-1087.169] (-1086.426) -- 0:00:54
      114000 -- (-1089.251) (-1086.948) [-1087.104] (-1087.708) * (-1089.910) [-1087.503] (-1087.160) (-1087.652) -- 0:00:54
      114500 -- (-1091.947) [-1088.068] (-1086.675) (-1085.751) * [-1085.468] (-1086.229) (-1089.309) (-1097.130) -- 0:00:54
      115000 -- (-1089.872) (-1088.426) [-1087.721] (-1090.745) * [-1088.711] (-1087.688) (-1087.430) (-1093.158) -- 0:00:53

      Average standard deviation of split frequencies: 0.020771

      115500 -- [-1088.190] (-1087.401) (-1091.828) (-1094.781) * [-1086.501] (-1086.888) (-1088.225) (-1090.659) -- 0:00:53
      116000 -- (-1089.030) (-1089.873) (-1088.653) [-1087.912] * (-1086.851) [-1087.302] (-1087.348) (-1087.727) -- 0:01:00
      116500 -- (-1087.094) [-1087.116] (-1086.304) (-1089.193) * [-1087.161] (-1088.627) (-1088.505) (-1087.138) -- 0:01:00
      117000 -- (-1087.003) (-1086.246) (-1086.545) [-1086.581] * (-1086.902) (-1086.965) [-1087.172] (-1086.944) -- 0:01:00
      117500 -- (-1089.588) (-1089.630) [-1086.366] (-1086.761) * [-1085.856] (-1086.787) (-1087.025) (-1088.529) -- 0:01:00
      118000 -- (-1086.965) [-1087.835] (-1088.935) (-1086.922) * [-1086.945] (-1089.055) (-1086.744) (-1087.312) -- 0:00:59
      118500 -- (-1088.732) (-1087.751) (-1088.634) [-1087.182] * (-1088.501) (-1086.998) (-1086.408) [-1087.769] -- 0:00:59
      119000 -- [-1086.969] (-1088.491) (-1088.402) (-1086.038) * (-1087.571) (-1090.358) [-1086.353] (-1086.302) -- 0:00:59
      119500 -- (-1089.944) (-1086.271) [-1086.832] (-1088.819) * (-1089.771) [-1087.526] (-1086.037) (-1087.025) -- 0:00:58
      120000 -- [-1093.754] (-1090.958) (-1095.168) (-1087.669) * [-1088.750] (-1087.768) (-1086.037) (-1088.240) -- 0:00:58

      Average standard deviation of split frequencies: 0.019099

      120500 -- (-1087.046) (-1088.108) (-1088.748) [-1086.890] * (-1086.948) [-1086.112] (-1087.715) (-1087.431) -- 0:00:58
      121000 -- (-1087.664) [-1086.079] (-1086.552) (-1086.446) * (-1090.258) [-1087.362] (-1087.796) (-1087.224) -- 0:00:58
      121500 -- (-1089.869) [-1086.754] (-1086.949) (-1087.338) * (-1086.056) [-1088.851] (-1087.611) (-1088.553) -- 0:00:57
      122000 -- (-1088.254) (-1088.253) (-1089.326) [-1086.587] * (-1087.197) (-1087.777) [-1092.133] (-1085.952) -- 0:00:57
      122500 -- (-1090.105) (-1087.317) (-1092.162) [-1086.096] * [-1090.869] (-1089.194) (-1088.182) (-1085.809) -- 0:00:57
      123000 -- [-1086.888] (-1088.135) (-1087.171) (-1086.635) * [-1090.445] (-1088.476) (-1088.320) (-1086.947) -- 0:00:57
      123500 -- (-1087.707) [-1086.660] (-1100.291) (-1087.535) * [-1088.999] (-1086.637) (-1091.046) (-1091.587) -- 0:00:56
      124000 -- (-1087.061) [-1086.284] (-1088.654) (-1091.655) * (-1088.465) (-1088.689) (-1085.863) [-1086.896] -- 0:00:56
      124500 -- (-1087.000) [-1087.252] (-1086.567) (-1087.024) * (-1090.383) [-1087.360] (-1089.930) (-1088.037) -- 0:00:56
      125000 -- (-1087.848) (-1089.380) [-1088.988] (-1093.049) * [-1086.934] (-1087.104) (-1086.070) (-1086.068) -- 0:00:56

      Average standard deviation of split frequencies: 0.018903

      125500 -- [-1087.457] (-1089.965) (-1086.760) (-1091.544) * (-1089.319) [-1086.894] (-1087.680) (-1085.864) -- 0:00:55
      126000 -- (-1089.518) (-1088.810) (-1087.096) [-1087.612] * [-1088.864] (-1087.015) (-1086.444) (-1088.314) -- 0:00:55
      126500 -- (-1088.478) (-1086.810) [-1088.124] (-1086.408) * (-1088.708) (-1087.801) (-1086.726) [-1088.084] -- 0:00:55
      127000 -- [-1087.067] (-1087.647) (-1089.299) (-1091.569) * (-1086.832) (-1087.796) [-1086.896] (-1090.720) -- 0:00:54
      127500 -- (-1088.665) [-1090.574] (-1089.620) (-1094.843) * [-1086.335] (-1088.234) (-1087.095) (-1089.492) -- 0:00:54
      128000 -- (-1087.512) (-1089.501) [-1086.233] (-1090.607) * (-1086.146) [-1089.241] (-1088.505) (-1087.399) -- 0:00:54
      128500 -- (-1087.206) [-1088.648] (-1086.596) (-1087.660) * (-1085.824) (-1087.667) [-1085.719] (-1088.134) -- 0:00:54
      129000 -- (-1086.258) (-1089.853) [-1086.670] (-1087.631) * (-1088.777) [-1089.247] (-1088.685) (-1089.829) -- 0:00:54
      129500 -- (-1085.735) (-1087.371) (-1085.905) [-1088.180] * [-1089.342] (-1088.604) (-1090.508) (-1087.356) -- 0:00:53
      130000 -- (-1092.894) (-1092.494) (-1088.437) [-1089.296] * (-1092.234) [-1091.201] (-1090.436) (-1086.339) -- 0:00:53

      Average standard deviation of split frequencies: 0.019842

      130500 -- [-1086.909] (-1087.403) (-1085.714) (-1088.914) * (-1088.864) (-1088.789) [-1086.334] (-1089.916) -- 0:00:53
      131000 -- (-1085.791) (-1087.353) [-1087.115] (-1090.673) * (-1089.056) [-1087.031] (-1086.287) (-1090.034) -- 0:00:53
      131500 -- [-1085.705] (-1088.842) (-1086.226) (-1090.394) * (-1087.286) (-1091.123) [-1086.213] (-1090.374) -- 0:00:52
      132000 -- (-1089.227) (-1089.644) [-1088.785] (-1089.270) * (-1087.606) [-1086.113] (-1093.249) (-1088.031) -- 0:00:59
      132500 -- [-1086.835] (-1089.089) (-1088.390) (-1087.776) * (-1088.894) [-1091.487] (-1088.774) (-1087.498) -- 0:00:58
      133000 -- (-1086.185) [-1088.405] (-1087.867) (-1087.853) * [-1086.435] (-1086.707) (-1088.573) (-1087.962) -- 0:00:58
      133500 -- (-1089.910) [-1089.627] (-1089.360) (-1089.172) * (-1085.654) [-1090.100] (-1086.445) (-1090.342) -- 0:00:58
      134000 -- [-1088.821] (-1088.241) (-1088.546) (-1088.311) * (-1086.816) [-1088.839] (-1086.643) (-1089.358) -- 0:00:58
      134500 -- (-1092.555) (-1088.383) (-1088.199) [-1087.492] * [-1087.554] (-1092.095) (-1087.951) (-1087.668) -- 0:00:57
      135000 -- [-1086.750] (-1088.117) (-1089.541) (-1087.520) * (-1086.056) (-1086.914) (-1086.779) [-1087.416] -- 0:00:57

      Average standard deviation of split frequencies: 0.022439

      135500 -- (-1090.472) (-1087.953) [-1088.202] (-1088.119) * (-1085.425) (-1089.164) (-1088.943) [-1086.771] -- 0:00:57
      136000 -- (-1091.337) (-1093.018) [-1087.297] (-1086.592) * (-1089.473) (-1087.381) [-1091.048] (-1089.759) -- 0:00:57
      136500 -- (-1088.463) (-1091.372) [-1088.673] (-1087.017) * (-1093.200) (-1087.939) (-1088.066) [-1090.173] -- 0:00:56
      137000 -- (-1087.508) (-1088.216) (-1092.349) [-1089.483] * (-1088.136) (-1086.648) [-1086.451] (-1088.317) -- 0:00:56
      137500 -- (-1089.531) (-1088.882) [-1087.014] (-1089.376) * (-1086.186) (-1085.984) [-1089.077] (-1086.832) -- 0:00:56
      138000 -- [-1087.787] (-1089.839) (-1088.963) (-1086.778) * (-1088.072) (-1086.481) (-1092.229) [-1090.478] -- 0:00:56
      138500 -- (-1089.235) (-1089.274) [-1085.959] (-1086.660) * (-1087.628) (-1086.604) [-1085.974] (-1088.940) -- 0:00:55
      139000 -- (-1087.064) (-1088.244) [-1086.309] (-1093.875) * (-1088.273) (-1090.118) [-1087.212] (-1088.552) -- 0:00:55
      139500 -- (-1094.198) (-1088.064) [-1085.720] (-1087.109) * (-1088.264) (-1088.880) (-1087.331) [-1088.087] -- 0:00:55
      140000 -- (-1086.527) [-1088.940] (-1085.780) (-1088.441) * (-1088.625) (-1086.988) (-1087.792) [-1086.224] -- 0:00:55

      Average standard deviation of split frequencies: 0.021871

      140500 -- (-1086.482) (-1088.392) [-1086.323] (-1087.986) * (-1088.346) [-1088.940] (-1092.511) (-1086.231) -- 0:00:55
      141000 -- (-1086.925) (-1088.720) [-1088.804] (-1088.246) * (-1089.672) [-1088.239] (-1090.601) (-1086.380) -- 0:00:54
      141500 -- (-1087.520) (-1087.368) [-1088.441] (-1088.395) * (-1089.339) [-1090.810] (-1088.393) (-1086.750) -- 0:00:54
      142000 -- [-1088.071] (-1087.652) (-1086.602) (-1093.869) * (-1088.212) (-1089.242) (-1086.021) [-1085.781] -- 0:00:54
      142500 -- (-1086.338) [-1088.469] (-1087.988) (-1091.522) * (-1087.287) (-1088.786) [-1085.888] (-1085.909) -- 0:00:54
      143000 -- (-1086.373) (-1087.132) (-1086.739) [-1087.343] * [-1090.183] (-1086.205) (-1086.401) (-1086.803) -- 0:00:53
      143500 -- [-1088.421] (-1086.070) (-1087.166) (-1090.427) * [-1086.161] (-1085.703) (-1087.054) (-1087.802) -- 0:00:53
      144000 -- (-1086.683) (-1087.557) [-1087.373] (-1086.816) * (-1086.012) (-1087.607) [-1086.787] (-1087.890) -- 0:00:53
      144500 -- (-1088.326) (-1087.830) (-1088.092) [-1088.922] * (-1086.429) (-1092.370) (-1085.543) [-1087.019] -- 0:00:53
      145000 -- (-1088.288) (-1087.644) [-1089.879] (-1093.652) * (-1087.561) (-1086.164) (-1086.766) [-1087.292] -- 0:00:53

      Average standard deviation of split frequencies: 0.019753

      145500 -- (-1087.371) (-1085.948) (-1087.273) [-1092.069] * [-1086.650] (-1086.840) (-1089.203) (-1088.501) -- 0:00:52
      146000 -- (-1087.247) (-1085.644) [-1087.310] (-1089.855) * [-1087.374] (-1086.247) (-1095.999) (-1089.420) -- 0:00:52
      146500 -- [-1089.049] (-1085.891) (-1087.382) (-1087.042) * (-1089.751) [-1086.942] (-1086.329) (-1087.375) -- 0:00:52
      147000 -- (-1090.512) (-1086.169) [-1086.265] (-1092.300) * (-1089.883) (-1087.711) (-1085.879) [-1086.667] -- 0:00:52
      147500 -- [-1089.810] (-1086.476) (-1086.446) (-1092.296) * (-1088.753) (-1087.072) (-1086.630) [-1086.544] -- 0:00:52
      148000 -- (-1088.750) (-1086.468) (-1086.952) [-1088.285] * [-1087.409] (-1086.622) (-1087.226) (-1086.412) -- 0:00:51
      148500 -- (-1088.745) (-1087.291) [-1087.335] (-1091.533) * (-1088.369) (-1087.327) [-1087.677] (-1086.819) -- 0:00:57
      149000 -- (-1090.567) (-1088.270) [-1087.038] (-1090.412) * (-1086.998) [-1086.420] (-1086.799) (-1086.022) -- 0:00:57
      149500 -- (-1088.699) (-1087.613) [-1086.201] (-1088.265) * (-1089.783) (-1087.218) [-1086.761] (-1086.187) -- 0:00:56
      150000 -- (-1088.977) (-1092.826) (-1088.259) [-1085.798] * (-1088.013) (-1089.868) (-1088.727) [-1086.976] -- 0:00:56

      Average standard deviation of split frequencies: 0.019693

      150500 -- (-1088.564) [-1088.639] (-1092.340) (-1086.117) * (-1087.616) (-1091.079) (-1087.639) [-1089.426] -- 0:00:56
      151000 -- (-1087.678) (-1087.132) (-1089.324) [-1087.913] * (-1087.692) (-1090.636) (-1089.001) [-1087.090] -- 0:00:56
      151500 -- [-1088.169] (-1089.287) (-1086.336) (-1087.756) * [-1085.993] (-1088.516) (-1089.166) (-1085.800) -- 0:00:56
      152000 -- [-1086.932] (-1091.747) (-1089.162) (-1089.329) * (-1089.797) (-1086.575) [-1087.292] (-1086.299) -- 0:00:55
      152500 -- (-1091.281) (-1088.649) (-1088.722) [-1090.533] * (-1086.539) (-1090.732) (-1088.605) [-1085.370] -- 0:00:55
      153000 -- (-1089.526) (-1086.524) (-1090.763) [-1087.056] * (-1088.002) (-1087.676) [-1090.421] (-1086.969) -- 0:00:55
      153500 -- (-1089.759) [-1086.704] (-1088.957) (-1088.405) * (-1086.934) (-1087.726) [-1087.213] (-1086.577) -- 0:00:55
      154000 -- (-1086.321) (-1086.056) (-1087.157) [-1088.963] * [-1086.534] (-1088.792) (-1086.409) (-1088.830) -- 0:00:54
      154500 -- (-1088.010) [-1089.701] (-1090.634) (-1088.434) * [-1085.450] (-1087.795) (-1086.636) (-1088.236) -- 0:00:54
      155000 -- (-1087.789) [-1087.350] (-1097.512) (-1088.386) * (-1087.166) (-1091.687) [-1087.453] (-1088.479) -- 0:00:54

      Average standard deviation of split frequencies: 0.017598

      155500 -- [-1089.849] (-1090.083) (-1088.060) (-1088.182) * (-1089.018) [-1087.755] (-1089.312) (-1087.559) -- 0:00:54
      156000 -- (-1090.184) (-1089.057) (-1087.356) [-1086.994] * (-1091.818) [-1086.932] (-1088.319) (-1088.316) -- 0:00:54
      156500 -- (-1089.727) [-1088.576] (-1087.304) (-1085.958) * (-1092.188) [-1087.481] (-1088.840) (-1087.284) -- 0:00:53
      157000 -- (-1089.354) (-1088.644) (-1087.908) [-1086.028] * (-1087.603) (-1087.931) (-1088.074) [-1087.970] -- 0:00:53
      157500 -- (-1087.068) (-1089.934) [-1085.582] (-1086.938) * [-1090.377] (-1087.805) (-1087.823) (-1086.774) -- 0:00:53
      158000 -- (-1089.002) (-1089.505) (-1087.710) [-1087.281] * (-1089.582) (-1088.303) (-1088.245) [-1087.665] -- 0:00:53
      158500 -- (-1089.222) (-1087.704) (-1086.682) [-1086.911] * (-1088.491) (-1090.452) [-1090.027] (-1088.702) -- 0:00:53
      159000 -- (-1086.042) [-1086.837] (-1087.217) (-1087.754) * (-1088.893) (-1088.979) (-1086.272) [-1086.756] -- 0:00:52
      159500 -- (-1086.315) [-1086.577] (-1089.873) (-1088.138) * (-1087.660) [-1087.761] (-1094.638) (-1087.505) -- 0:00:52
      160000 -- (-1088.031) (-1086.183) [-1087.459] (-1087.689) * [-1088.259] (-1087.868) (-1091.740) (-1087.690) -- 0:00:52

      Average standard deviation of split frequencies: 0.018338

      160500 -- [-1089.026] (-1095.429) (-1086.305) (-1087.489) * (-1086.641) (-1085.670) [-1095.345] (-1087.082) -- 0:00:52
      161000 -- (-1087.507) (-1086.724) [-1088.154] (-1089.897) * (-1087.925) (-1086.418) [-1087.270] (-1089.003) -- 0:00:52
      161500 -- [-1086.381] (-1086.947) (-1088.363) (-1088.143) * (-1086.798) [-1086.825] (-1087.608) (-1086.207) -- 0:00:51
      162000 -- (-1086.871) (-1086.632) [-1086.476] (-1087.415) * [-1087.273] (-1088.643) (-1092.187) (-1088.589) -- 0:00:51
      162500 -- (-1087.872) (-1086.632) [-1088.122] (-1092.281) * (-1087.444) [-1087.595] (-1089.461) (-1087.989) -- 0:00:51
      163000 -- (-1086.886) [-1088.445] (-1088.945) (-1088.287) * [-1087.995] (-1087.797) (-1086.370) (-1090.038) -- 0:00:51
      163500 -- (-1089.378) (-1089.561) (-1087.654) [-1086.228] * (-1086.128) [-1087.986] (-1088.889) (-1089.409) -- 0:00:51
      164000 -- (-1087.411) (-1085.875) [-1089.446] (-1087.828) * [-1087.642] (-1088.262) (-1087.360) (-1088.011) -- 0:00:50
      164500 -- [-1086.610] (-1085.875) (-1086.852) (-1089.960) * (-1087.659) [-1086.075] (-1089.697) (-1088.920) -- 0:00:55
      165000 -- (-1088.075) [-1088.029] (-1085.995) (-1089.117) * (-1086.339) [-1086.177] (-1090.078) (-1089.470) -- 0:00:55

      Average standard deviation of split frequencies: 0.015974

      165500 -- (-1087.557) (-1086.571) [-1088.277] (-1086.443) * (-1087.724) (-1086.479) (-1090.686) [-1087.677] -- 0:00:55
      166000 -- [-1086.215] (-1089.735) (-1088.570) (-1086.378) * [-1086.219] (-1087.424) (-1090.513) (-1087.328) -- 0:00:55
      166500 -- (-1088.335) [-1091.687] (-1086.757) (-1088.172) * (-1088.249) [-1088.562] (-1087.931) (-1086.381) -- 0:00:55
      167000 -- (-1090.174) (-1090.491) (-1087.158) [-1087.513] * (-1087.774) (-1092.823) (-1086.621) [-1085.849] -- 0:00:54
      167500 -- (-1089.339) [-1088.244] (-1085.976) (-1087.655) * [-1087.058] (-1087.909) (-1087.672) (-1087.780) -- 0:00:54
      168000 -- (-1088.398) [-1087.514] (-1088.035) (-1086.207) * [-1087.200] (-1086.987) (-1085.803) (-1088.114) -- 0:00:54
      168500 -- (-1089.066) [-1091.224] (-1086.940) (-1087.584) * (-1086.099) (-1086.765) [-1088.399] (-1092.031) -- 0:00:54
      169000 -- (-1088.711) (-1092.606) [-1087.941] (-1089.202) * (-1085.722) [-1087.048] (-1087.252) (-1089.995) -- 0:00:54
      169500 -- [-1086.737] (-1088.484) (-1086.825) (-1088.220) * (-1085.722) (-1086.898) [-1088.583] (-1089.141) -- 0:00:53
      170000 -- [-1086.125] (-1088.094) (-1088.203) (-1087.773) * (-1085.903) (-1090.061) (-1086.666) [-1089.139] -- 0:00:53

      Average standard deviation of split frequencies: 0.016745

      170500 -- (-1088.587) (-1089.045) [-1088.753] (-1087.846) * (-1085.426) [-1088.425] (-1088.817) (-1087.046) -- 0:00:53
      171000 -- (-1090.005) (-1088.744) [-1088.673] (-1087.378) * (-1086.259) (-1088.407) [-1085.488] (-1088.110) -- 0:00:53
      171500 -- (-1089.246) (-1088.339) [-1087.726] (-1088.007) * (-1085.819) [-1088.070] (-1085.734) (-1088.534) -- 0:00:53
      172000 -- (-1088.467) (-1088.142) (-1089.026) [-1087.209] * (-1087.125) (-1090.282) (-1085.751) [-1085.747] -- 0:00:52
      172500 -- (-1086.616) (-1086.984) (-1088.569) [-1085.571] * (-1086.168) [-1087.745] (-1087.228) (-1088.598) -- 0:00:52
      173000 -- (-1088.051) [-1088.308] (-1091.228) (-1086.203) * (-1086.466) (-1089.360) [-1088.147] (-1086.322) -- 0:00:52
      173500 -- (-1086.355) (-1086.782) (-1092.520) [-1088.205] * (-1086.180) (-1087.810) [-1086.491] (-1086.307) -- 0:00:52
      174000 -- (-1088.652) [-1086.069] (-1091.166) (-1087.367) * (-1088.356) (-1087.504) (-1088.628) [-1086.760] -- 0:00:52
      174500 -- (-1087.274) [-1086.314] (-1088.207) (-1088.878) * (-1089.789) (-1095.275) (-1088.761) [-1086.595] -- 0:00:52
      175000 -- (-1087.324) (-1090.802) (-1087.172) [-1086.753] * (-1089.291) [-1089.564] (-1088.983) (-1086.458) -- 0:00:51

      Average standard deviation of split frequencies: 0.018119

      175500 -- (-1091.115) (-1091.201) [-1085.731] (-1088.166) * (-1086.487) [-1087.904] (-1090.850) (-1091.296) -- 0:00:51
      176000 -- (-1091.704) [-1088.670] (-1089.201) (-1087.685) * (-1087.620) [-1085.968] (-1089.539) (-1088.018) -- 0:00:51
      176500 -- (-1091.063) [-1090.176] (-1087.129) (-1086.728) * (-1085.844) [-1086.861] (-1087.501) (-1087.870) -- 0:00:51
      177000 -- [-1086.443] (-1088.867) (-1087.503) (-1087.780) * [-1088.163] (-1087.197) (-1087.253) (-1088.287) -- 0:00:51
      177500 -- [-1087.696] (-1086.942) (-1087.699) (-1090.067) * (-1086.635) (-1090.013) [-1089.188] (-1096.714) -- 0:00:50
      178000 -- [-1087.589] (-1086.198) (-1088.177) (-1091.958) * [-1088.939] (-1090.422) (-1088.053) (-1092.148) -- 0:00:50
      178500 -- (-1088.850) (-1086.695) (-1090.202) [-1089.597] * [-1086.222] (-1087.855) (-1091.906) (-1091.519) -- 0:00:50
      179000 -- (-1090.344) [-1089.687] (-1086.971) (-1086.489) * [-1086.389] (-1088.097) (-1088.163) (-1086.020) -- 0:00:50
      179500 -- (-1092.630) [-1086.914] (-1088.828) (-1086.776) * [-1087.105] (-1088.068) (-1089.202) (-1087.883) -- 0:00:50
      180000 -- (-1086.722) [-1086.852] (-1088.059) (-1088.880) * [-1086.401] (-1088.720) (-1090.754) (-1088.680) -- 0:00:50

      Average standard deviation of split frequencies: 0.018700

      180500 -- [-1087.511] (-1088.574) (-1091.851) (-1091.684) * (-1088.301) (-1087.542) [-1087.389] (-1089.129) -- 0:00:49
      181000 -- (-1087.406) (-1094.234) [-1088.179] (-1092.501) * (-1088.154) (-1090.883) (-1087.357) [-1089.227] -- 0:00:54
      181500 -- [-1087.686] (-1091.514) (-1089.882) (-1087.485) * (-1087.151) (-1088.823) (-1087.428) [-1090.554] -- 0:00:54
      182000 -- (-1088.958) [-1087.612] (-1087.190) (-1088.908) * (-1087.353) [-1087.492] (-1087.396) (-1091.159) -- 0:00:53
      182500 -- (-1087.673) (-1087.526) (-1086.571) [-1090.080] * [-1088.319] (-1087.442) (-1088.465) (-1087.256) -- 0:00:53
      183000 -- (-1088.477) [-1086.790] (-1087.062) (-1087.911) * (-1087.609) [-1087.044] (-1087.907) (-1087.308) -- 0:00:53
      183500 -- (-1087.392) (-1086.877) [-1089.126] (-1087.879) * [-1087.768] (-1090.183) (-1087.125) (-1086.335) -- 0:00:53
      184000 -- (-1086.572) (-1086.187) (-1087.059) [-1087.033] * (-1090.575) (-1086.673) [-1085.927] (-1087.567) -- 0:00:53
      184500 -- [-1088.651] (-1086.192) (-1086.391) (-1088.009) * (-1087.798) [-1086.678] (-1085.953) (-1088.124) -- 0:00:53
      185000 -- [-1088.514] (-1088.034) (-1086.288) (-1088.457) * (-1089.865) [-1086.919] (-1086.110) (-1088.620) -- 0:00:52

      Average standard deviation of split frequencies: 0.017882

      185500 -- [-1088.549] (-1086.161) (-1089.102) (-1086.665) * (-1089.124) (-1087.789) [-1085.936] (-1086.401) -- 0:00:52
      186000 -- (-1089.361) [-1093.106] (-1086.447) (-1089.962) * (-1086.588) [-1087.737] (-1089.107) (-1087.145) -- 0:00:52
      186500 -- (-1092.064) (-1090.183) (-1088.250) [-1088.393] * (-1089.054) (-1087.613) (-1086.675) [-1086.490] -- 0:00:52
      187000 -- (-1087.428) (-1088.305) (-1088.275) [-1089.452] * [-1087.317] (-1091.613) (-1087.495) (-1087.195) -- 0:00:52
      187500 -- (-1086.004) [-1086.596] (-1090.108) (-1090.343) * [-1090.299] (-1094.923) (-1089.929) (-1087.440) -- 0:00:52
      188000 -- (-1087.243) [-1088.001] (-1088.252) (-1088.549) * (-1087.887) (-1090.158) (-1088.109) [-1088.992] -- 0:00:51
      188500 -- [-1088.182] (-1089.409) (-1087.496) (-1087.884) * (-1087.335) (-1085.692) [-1089.660] (-1088.065) -- 0:00:51
      189000 -- (-1088.813) (-1087.569) [-1089.687] (-1087.451) * (-1089.488) (-1086.888) (-1090.353) [-1086.164] -- 0:00:51
      189500 -- [-1086.249] (-1088.570) (-1088.070) (-1087.439) * (-1093.142) (-1089.197) [-1086.403] (-1087.333) -- 0:00:51
      190000 -- [-1086.606] (-1088.280) (-1086.231) (-1088.774) * (-1089.477) (-1091.815) [-1086.645] (-1092.624) -- 0:00:51

      Average standard deviation of split frequencies: 0.017719

      190500 -- (-1088.199) (-1087.461) (-1091.026) [-1090.821] * (-1087.521) (-1089.884) (-1086.066) [-1087.505] -- 0:00:50
      191000 -- (-1086.915) (-1087.000) [-1089.521] (-1087.922) * (-1088.620) (-1087.436) (-1085.984) [-1087.572] -- 0:00:50
      191500 -- (-1086.002) (-1087.989) [-1087.973] (-1086.350) * [-1089.973] (-1087.305) (-1086.832) (-1086.854) -- 0:00:50
      192000 -- (-1086.608) (-1088.072) (-1094.444) [-1086.528] * [-1087.545] (-1086.845) (-1089.680) (-1089.170) -- 0:00:50
      192500 -- [-1087.259] (-1092.167) (-1088.940) (-1086.450) * (-1086.076) (-1088.176) [-1088.778] (-1087.491) -- 0:00:50
      193000 -- [-1086.059] (-1087.737) (-1088.026) (-1087.754) * (-1089.873) (-1086.991) [-1085.587] (-1092.044) -- 0:00:50
      193500 -- (-1088.682) (-1087.766) (-1089.644) [-1089.110] * [-1087.035] (-1088.223) (-1091.537) (-1091.614) -- 0:00:50
      194000 -- (-1094.255) (-1088.951) [-1086.810] (-1085.790) * (-1090.436) [-1090.574] (-1087.247) (-1094.992) -- 0:00:49
      194500 -- (-1091.911) (-1087.670) (-1087.739) [-1089.333] * (-1089.727) (-1087.915) [-1086.132] (-1093.419) -- 0:00:49
      195000 -- (-1086.062) (-1087.911) (-1087.678) [-1086.657] * (-1089.370) (-1089.896) (-1089.949) [-1087.802] -- 0:00:49

      Average standard deviation of split frequencies: 0.016411

      195500 -- (-1086.743) (-1087.716) (-1088.559) [-1086.300] * (-1086.319) [-1085.562] (-1086.747) (-1091.595) -- 0:00:49
      196000 -- [-1086.743] (-1087.756) (-1090.034) (-1085.726) * (-1088.418) [-1086.408] (-1088.251) (-1086.996) -- 0:00:49
      196500 -- (-1087.486) (-1088.828) [-1086.881] (-1085.871) * [-1086.628] (-1088.496) (-1089.259) (-1090.300) -- 0:00:49
      197000 -- (-1086.868) [-1087.221] (-1087.966) (-1085.907) * (-1085.882) [-1086.213] (-1095.164) (-1088.642) -- 0:00:52
      197500 -- (-1088.028) [-1091.571] (-1090.921) (-1087.359) * (-1086.484) (-1086.914) [-1090.776] (-1092.180) -- 0:00:52
      198000 -- (-1088.716) (-1088.006) (-1088.409) [-1089.903] * [-1086.497] (-1088.163) (-1087.283) (-1089.572) -- 0:00:52
      198500 -- (-1086.702) [-1086.973] (-1088.264) (-1086.804) * (-1085.520) (-1087.751) [-1091.424] (-1087.227) -- 0:00:52
      199000 -- (-1087.381) (-1088.923) (-1092.196) [-1087.523] * (-1086.335) (-1087.330) (-1088.255) [-1086.551] -- 0:00:52
      199500 -- [-1088.626] (-1089.796) (-1088.302) (-1087.723) * (-1087.364) [-1086.194] (-1090.499) (-1086.325) -- 0:00:52
      200000 -- (-1087.866) (-1090.220) (-1086.298) [-1088.882] * (-1092.478) (-1086.163) [-1090.802] (-1086.945) -- 0:00:51

      Average standard deviation of split frequencies: 0.016314

      200500 -- (-1087.954) (-1089.592) (-1086.004) [-1086.721] * (-1091.275) [-1086.263] (-1087.812) (-1086.016) -- 0:00:51
      201000 -- (-1086.818) (-1086.890) [-1086.174] (-1088.912) * (-1090.862) [-1087.034] (-1086.918) (-1087.019) -- 0:00:51
      201500 -- (-1092.705) (-1087.773) (-1090.129) [-1090.675] * (-1089.182) [-1087.266] (-1089.811) (-1087.245) -- 0:00:51
      202000 -- (-1096.190) (-1086.057) (-1089.097) [-1087.325] * (-1091.560) (-1089.837) [-1087.652] (-1088.215) -- 0:00:51
      202500 -- [-1088.195] (-1086.513) (-1089.698) (-1086.384) * (-1086.699) (-1096.241) (-1086.882) [-1086.433] -- 0:00:51
      203000 -- (-1087.065) [-1087.701] (-1089.665) (-1087.533) * (-1087.289) (-1088.133) (-1094.797) [-1085.713] -- 0:00:51
      203500 -- (-1087.819) (-1086.795) [-1088.030] (-1087.510) * [-1087.858] (-1087.326) (-1092.598) (-1087.367) -- 0:00:50
      204000 -- (-1089.661) [-1087.707] (-1087.217) (-1087.145) * (-1088.116) (-1087.060) (-1089.093) [-1087.648] -- 0:00:50
      204500 -- (-1089.515) (-1086.234) (-1086.687) [-1086.937] * (-1087.036) (-1087.312) [-1089.820] (-1088.974) -- 0:00:50
      205000 -- [-1086.452] (-1086.034) (-1087.949) (-1089.347) * (-1087.854) (-1089.884) [-1088.546] (-1089.025) -- 0:00:50

      Average standard deviation of split frequencies: 0.014493

      205500 -- [-1087.514] (-1088.480) (-1087.704) (-1089.231) * (-1086.442) [-1088.900] (-1085.842) (-1086.630) -- 0:00:50
      206000 -- (-1091.005) [-1086.638] (-1087.441) (-1091.704) * (-1087.895) (-1088.325) [-1088.015] (-1086.842) -- 0:00:50
      206500 -- (-1087.423) (-1087.885) (-1086.839) [-1090.031] * [-1086.909] (-1086.932) (-1088.661) (-1087.925) -- 0:00:49
      207000 -- [-1086.334] (-1089.753) (-1089.173) (-1090.056) * (-1088.214) (-1087.351) (-1090.117) [-1087.686] -- 0:00:49
      207500 -- (-1086.743) (-1090.444) [-1086.864] (-1088.256) * (-1092.965) (-1090.222) [-1086.549] (-1090.377) -- 0:00:49
      208000 -- [-1086.280] (-1091.878) (-1088.492) (-1088.427) * (-1089.198) (-1086.493) (-1087.870) [-1086.791] -- 0:00:49
      208500 -- (-1087.038) [-1088.507] (-1086.819) (-1086.716) * [-1090.834] (-1085.673) (-1087.179) (-1087.105) -- 0:00:49
      209000 -- [-1088.384] (-1086.472) (-1086.704) (-1087.874) * [-1089.635] (-1087.354) (-1092.528) (-1087.662) -- 0:00:49
      209500 -- (-1091.106) (-1087.596) (-1086.340) [-1086.229] * [-1088.148] (-1089.213) (-1088.494) (-1086.442) -- 0:00:49
      210000 -- (-1090.152) (-1095.317) (-1085.809) [-1086.881] * (-1087.919) [-1089.374] (-1090.578) (-1086.300) -- 0:00:48

      Average standard deviation of split frequencies: 0.014296

      210500 -- [-1089.004] (-1087.398) (-1087.316) (-1086.304) * (-1090.955) (-1087.423) [-1087.008] (-1087.626) -- 0:00:48
      211000 -- (-1086.475) (-1090.508) [-1087.205] (-1087.075) * (-1087.491) (-1088.615) [-1085.831] (-1091.493) -- 0:00:48
      211500 -- [-1086.522] (-1091.613) (-1087.096) (-1089.816) * (-1085.966) (-1086.398) (-1088.740) [-1090.731] -- 0:00:48
      212000 -- [-1086.259] (-1097.975) (-1087.410) (-1087.506) * [-1086.720] (-1086.260) (-1091.415) (-1085.516) -- 0:00:48
      212500 -- [-1085.830] (-1088.179) (-1097.546) (-1087.442) * (-1086.101) [-1086.370] (-1088.675) (-1085.521) -- 0:00:48
      213000 -- (-1085.442) (-1088.494) (-1097.100) [-1087.965] * (-1086.970) (-1087.302) (-1089.563) [-1089.288] -- 0:00:48
      213500 -- [-1086.595] (-1088.253) (-1094.502) (-1089.184) * (-1086.993) (-1088.617) (-1088.764) [-1088.256] -- 0:00:51
      214000 -- (-1085.674) [-1087.232] (-1092.653) (-1093.371) * [-1086.679] (-1085.474) (-1086.738) (-1088.543) -- 0:00:51
      214500 -- (-1085.913) (-1087.042) (-1090.274) [-1086.518] * (-1087.968) (-1086.874) (-1086.425) [-1089.703] -- 0:00:51
      215000 -- (-1086.893) (-1088.323) [-1089.484] (-1086.434) * [-1086.754] (-1089.077) (-1088.723) (-1085.930) -- 0:00:51

      Average standard deviation of split frequencies: 0.013943

      215500 -- [-1086.451] (-1087.261) (-1087.809) (-1086.405) * [-1086.839] (-1088.804) (-1088.729) (-1089.459) -- 0:00:50
      216000 -- (-1086.312) [-1085.896] (-1088.496) (-1086.716) * [-1086.333] (-1089.661) (-1089.010) (-1086.976) -- 0:00:50
      216500 -- [-1085.816] (-1086.835) (-1090.146) (-1086.825) * [-1087.670] (-1086.769) (-1087.596) (-1086.796) -- 0:00:50
      217000 -- (-1085.838) [-1088.333] (-1086.578) (-1086.281) * (-1087.868) (-1088.126) (-1086.933) [-1086.639] -- 0:00:50
      217500 -- [-1085.672] (-1090.290) (-1090.433) (-1087.629) * (-1086.533) [-1087.938] (-1088.761) (-1086.364) -- 0:00:50
      218000 -- (-1086.142) (-1090.857) (-1088.999) [-1087.097] * (-1087.719) [-1086.892] (-1085.923) (-1087.878) -- 0:00:50
      218500 -- [-1087.063] (-1092.389) (-1089.987) (-1086.870) * (-1092.960) (-1087.143) (-1086.836) [-1087.803] -- 0:00:50
      219000 -- (-1085.566) (-1091.359) [-1090.053] (-1086.553) * [-1088.894] (-1088.063) (-1090.755) (-1086.783) -- 0:00:49
      219500 -- [-1085.339] (-1091.223) (-1090.499) (-1088.928) * (-1089.168) (-1089.171) (-1088.989) [-1086.292] -- 0:00:49
      220000 -- [-1087.546] (-1088.542) (-1085.669) (-1089.942) * [-1088.157] (-1091.055) (-1086.808) (-1091.375) -- 0:00:49

      Average standard deviation of split frequencies: 0.012441

      220500 -- (-1085.458) [-1088.704] (-1086.055) (-1088.297) * (-1086.895) [-1087.512] (-1086.573) (-1088.811) -- 0:00:49
      221000 -- [-1086.198] (-1087.768) (-1086.873) (-1087.687) * (-1087.499) [-1087.338] (-1087.353) (-1089.431) -- 0:00:49
      221500 -- (-1088.905) (-1086.690) (-1086.013) [-1087.654] * (-1087.065) [-1091.907] (-1089.520) (-1085.993) -- 0:00:49
      222000 -- (-1089.638) (-1085.820) [-1085.965] (-1085.954) * (-1085.924) (-1087.242) [-1089.551] (-1089.025) -- 0:00:49
      222500 -- (-1090.021) [-1086.701] (-1088.482) (-1087.411) * (-1087.966) (-1086.686) (-1087.253) [-1088.100] -- 0:00:48
      223000 -- (-1087.389) (-1085.679) (-1088.464) [-1085.539] * (-1090.728) (-1089.816) [-1086.236] (-1087.380) -- 0:00:48
      223500 -- (-1087.114) [-1088.469] (-1090.353) (-1085.529) * (-1089.646) (-1087.237) [-1090.144] (-1093.238) -- 0:00:48
      224000 -- (-1087.465) [-1088.191] (-1090.689) (-1087.921) * (-1088.452) (-1087.083) (-1089.297) [-1086.419] -- 0:00:48
      224500 -- [-1086.476] (-1091.199) (-1096.441) (-1091.141) * [-1085.424] (-1086.827) (-1096.614) (-1087.864) -- 0:00:48
      225000 -- (-1089.418) (-1087.973) (-1088.571) [-1089.112] * (-1086.585) (-1089.820) [-1088.849] (-1087.189) -- 0:00:48

      Average standard deviation of split frequencies: 0.012385

      225500 -- (-1086.208) [-1091.324] (-1087.686) (-1087.472) * [-1087.469] (-1086.577) (-1090.701) (-1088.289) -- 0:00:48
      226000 -- (-1085.749) (-1091.253) (-1088.921) [-1085.973] * [-1087.292] (-1089.267) (-1089.090) (-1087.197) -- 0:00:47
      226500 -- (-1088.352) (-1091.872) (-1088.467) [-1086.093] * (-1089.602) (-1090.520) (-1088.338) [-1086.081] -- 0:00:47
      227000 -- (-1088.581) (-1089.869) [-1087.074] (-1085.651) * (-1088.046) [-1091.226] (-1087.967) (-1087.504) -- 0:00:47
      227500 -- (-1087.990) (-1088.819) (-1085.978) [-1085.645] * (-1089.161) [-1089.579] (-1088.348) (-1088.035) -- 0:00:47
      228000 -- (-1090.244) [-1087.031] (-1087.010) (-1085.651) * (-1087.594) [-1086.435] (-1090.624) (-1085.961) -- 0:00:47
      228500 -- (-1094.967) [-1086.709] (-1088.705) (-1085.759) * (-1089.225) (-1086.829) (-1087.339) [-1087.209] -- 0:00:47
      229000 -- [-1092.022] (-1087.771) (-1085.895) (-1085.590) * (-1088.320) [-1088.691] (-1094.972) (-1086.608) -- 0:00:50
      229500 -- (-1090.884) (-1092.360) (-1087.776) [-1086.902] * (-1088.082) (-1088.172) [-1087.646] (-1087.258) -- 0:00:50
      230000 -- (-1089.194) (-1091.298) (-1089.079) [-1085.483] * [-1087.652] (-1088.477) (-1087.684) (-1088.934) -- 0:00:50

      Average standard deviation of split frequencies: 0.010459

      230500 -- (-1086.960) (-1089.885) [-1087.299] (-1085.522) * (-1087.002) [-1086.574] (-1088.234) (-1088.069) -- 0:00:50
      231000 -- (-1086.786) (-1089.787) [-1086.446] (-1088.079) * (-1088.138) [-1087.324] (-1088.718) (-1086.190) -- 0:00:49
      231500 -- (-1088.312) [-1088.118] (-1087.004) (-1090.954) * (-1089.386) (-1088.828) (-1086.967) [-1086.329] -- 0:00:49
      232000 -- [-1088.955] (-1089.995) (-1090.693) (-1086.266) * (-1088.564) [-1090.458] (-1086.557) (-1087.956) -- 0:00:49
      232500 -- (-1086.223) (-1088.256) [-1090.694] (-1087.462) * [-1089.636] (-1090.615) (-1087.464) (-1087.666) -- 0:00:49
      233000 -- [-1086.745] (-1088.351) (-1088.639) (-1087.524) * (-1093.351) (-1086.634) (-1088.906) [-1087.611] -- 0:00:49
      233500 -- (-1088.634) [-1085.426] (-1088.342) (-1090.202) * (-1091.643) (-1086.622) [-1087.080] (-1088.827) -- 0:00:49
      234000 -- (-1087.464) [-1086.960] (-1090.827) (-1091.488) * (-1090.800) (-1087.514) (-1089.619) [-1086.953] -- 0:00:49
      234500 -- (-1087.553) [-1088.016] (-1089.476) (-1090.706) * (-1093.788) (-1090.956) (-1088.712) [-1085.762] -- 0:00:48
      235000 -- (-1087.977) [-1087.945] (-1090.260) (-1091.634) * (-1091.419) [-1086.640] (-1093.530) (-1088.372) -- 0:00:48

      Average standard deviation of split frequencies: 0.009987

      235500 -- [-1086.662] (-1089.155) (-1087.257) (-1087.636) * (-1089.878) [-1086.020] (-1093.917) (-1088.962) -- 0:00:48
      236000 -- (-1087.655) (-1087.664) [-1087.773] (-1087.003) * (-1086.043) [-1086.254] (-1086.674) (-1089.357) -- 0:00:48
      236500 -- (-1089.882) (-1088.191) [-1087.841] (-1087.023) * (-1088.185) [-1087.426] (-1086.071) (-1088.168) -- 0:00:48
      237000 -- (-1086.838) (-1089.284) [-1090.554] (-1087.540) * (-1087.106) [-1086.726] (-1087.339) (-1087.013) -- 0:00:48
      237500 -- [-1091.796] (-1089.418) (-1092.356) (-1086.844) * [-1086.786] (-1087.064) (-1088.992) (-1088.685) -- 0:00:48
      238000 -- (-1087.782) (-1089.760) [-1087.120] (-1087.026) * (-1086.076) (-1087.695) [-1087.999] (-1086.143) -- 0:00:48
      238500 -- (-1088.990) (-1089.701) [-1086.731] (-1087.862) * (-1086.076) (-1087.164) (-1087.912) [-1085.838] -- 0:00:47
      239000 -- (-1088.670) (-1087.680) (-1088.693) [-1088.104] * (-1085.630) [-1088.211] (-1089.609) (-1088.244) -- 0:00:47
      239500 -- (-1088.213) (-1087.999) [-1085.601] (-1088.352) * (-1086.542) (-1088.875) (-1086.585) [-1087.062] -- 0:00:47
      240000 -- (-1087.623) (-1086.649) [-1086.988] (-1086.025) * (-1087.540) (-1089.248) [-1087.668] (-1086.492) -- 0:00:47

      Average standard deviation of split frequencies: 0.010577

      240500 -- (-1088.581) (-1085.829) [-1087.247] (-1087.383) * (-1086.798) (-1087.723) (-1088.813) [-1089.124] -- 0:00:47
      241000 -- (-1086.567) (-1086.570) (-1089.662) [-1086.011] * [-1087.247] (-1086.329) (-1087.542) (-1089.047) -- 0:00:47
      241500 -- (-1086.508) [-1087.481] (-1089.726) (-1086.488) * (-1087.350) (-1087.846) (-1089.860) [-1088.566] -- 0:00:47
      242000 -- (-1089.242) (-1085.911) (-1090.029) [-1085.917] * (-1088.744) (-1090.173) (-1090.795) [-1091.136] -- 0:00:46
      242500 -- [-1091.473] (-1085.802) (-1089.577) (-1086.603) * (-1089.143) (-1089.998) (-1088.455) [-1090.040] -- 0:00:46
      243000 -- (-1093.687) (-1087.828) [-1086.517] (-1088.519) * (-1086.485) (-1087.248) [-1089.659] (-1089.988) -- 0:00:46
      243500 -- (-1088.324) (-1087.046) (-1086.868) [-1087.403] * (-1086.847) (-1087.137) (-1087.641) [-1089.115] -- 0:00:46
      244000 -- (-1091.065) (-1095.050) [-1088.912] (-1089.432) * (-1087.244) (-1087.869) (-1088.237) [-1085.906] -- 0:00:49
      244500 -- (-1086.296) (-1085.890) [-1088.686] (-1086.279) * [-1088.069] (-1086.667) (-1090.721) (-1086.557) -- 0:00:49
      245000 -- [-1089.163] (-1086.734) (-1087.435) (-1086.177) * (-1089.126) (-1089.447) (-1090.216) [-1086.487] -- 0:00:49

      Average standard deviation of split frequencies: 0.010060

      245500 -- (-1089.824) [-1088.151] (-1086.659) (-1086.883) * (-1087.884) [-1088.515] (-1088.349) (-1090.790) -- 0:00:49
      246000 -- (-1086.924) [-1088.408] (-1090.231) (-1086.838) * (-1087.507) (-1086.138) [-1086.575] (-1087.960) -- 0:00:49
      246500 -- [-1086.337] (-1088.809) (-1089.099) (-1086.908) * (-1086.814) (-1088.955) (-1086.711) [-1085.831] -- 0:00:48
      247000 -- (-1087.132) (-1085.789) (-1089.366) [-1088.846] * (-1087.344) [-1086.593] (-1089.341) (-1086.325) -- 0:00:48
      247500 -- (-1087.787) (-1087.159) [-1088.495] (-1087.120) * (-1090.288) (-1086.549) (-1089.600) [-1086.344] -- 0:00:48
      248000 -- (-1089.368) (-1091.266) [-1087.123] (-1089.196) * (-1088.963) (-1086.543) [-1089.981] (-1086.232) -- 0:00:48
      248500 -- (-1093.064) [-1087.400] (-1086.873) (-1090.439) * (-1087.837) [-1085.788] (-1089.342) (-1089.173) -- 0:00:48
      249000 -- (-1089.490) (-1085.619) [-1087.550] (-1088.497) * (-1088.631) (-1086.337) (-1091.760) [-1087.576] -- 0:00:48
      249500 -- (-1087.924) (-1090.454) (-1090.074) [-1088.929] * (-1088.647) (-1085.461) (-1091.409) [-1086.753] -- 0:00:48
      250000 -- (-1087.786) (-1086.346) (-1088.835) [-1086.011] * [-1087.932] (-1090.137) (-1088.211) (-1086.274) -- 0:00:48

      Average standard deviation of split frequencies: 0.009050

      250500 -- (-1088.750) [-1085.472] (-1087.175) (-1086.394) * (-1086.151) (-1085.834) (-1086.057) [-1087.292] -- 0:00:47
      251000 -- (-1086.302) (-1085.471) (-1085.750) [-1086.585] * (-1085.892) [-1086.811] (-1090.068) (-1090.167) -- 0:00:47
      251500 -- (-1086.189) [-1085.465] (-1087.656) (-1086.652) * (-1085.999) (-1087.963) [-1089.612] (-1090.885) -- 0:00:47
      252000 -- (-1086.019) [-1086.717] (-1088.096) (-1088.344) * (-1089.507) (-1091.295) (-1086.752) [-1091.131] -- 0:00:47
      252500 -- [-1086.342] (-1086.892) (-1087.283) (-1088.765) * (-1094.689) (-1089.372) (-1087.247) [-1089.003] -- 0:00:47
      253000 -- (-1086.182) (-1087.676) [-1086.700] (-1093.879) * (-1089.047) (-1091.874) [-1089.522] (-1087.640) -- 0:00:47
      253500 -- (-1086.305) (-1086.959) [-1087.609] (-1092.440) * (-1086.140) (-1085.968) (-1087.490) [-1086.706] -- 0:00:47
      254000 -- (-1089.772) [-1089.001] (-1088.756) (-1093.790) * [-1085.774] (-1086.229) (-1087.466) (-1087.414) -- 0:00:46
      254500 -- (-1088.268) (-1086.605) (-1087.531) [-1087.237] * (-1087.417) [-1085.859] (-1088.251) (-1087.085) -- 0:00:46
      255000 -- (-1085.912) (-1088.988) [-1087.097] (-1087.126) * (-1086.484) (-1085.867) [-1089.281] (-1087.473) -- 0:00:46

      Average standard deviation of split frequencies: 0.010507

      255500 -- (-1087.670) (-1089.407) (-1089.578) [-1086.969] * [-1086.458] (-1087.456) (-1086.079) (-1086.988) -- 0:00:46
      256000 -- [-1089.099] (-1086.696) (-1090.196) (-1087.662) * (-1086.433) (-1086.192) (-1085.968) [-1091.273] -- 0:00:46
      256500 -- (-1086.772) (-1087.003) (-1088.028) [-1087.499] * (-1085.922) (-1086.351) (-1087.619) [-1088.148] -- 0:00:46
      257000 -- (-1087.928) [-1088.319] (-1087.404) (-1088.111) * (-1086.648) (-1086.547) [-1086.194] (-1086.616) -- 0:00:46
      257500 -- (-1092.240) (-1087.418) [-1089.622] (-1087.658) * (-1091.817) [-1088.116] (-1085.688) (-1090.058) -- 0:00:46
      258000 -- (-1091.206) [-1087.386] (-1092.421) (-1087.631) * (-1092.542) (-1089.302) [-1085.688] (-1087.654) -- 0:00:46
      258500 -- [-1087.720] (-1087.130) (-1091.360) (-1089.137) * (-1093.333) (-1087.031) (-1085.446) [-1087.820] -- 0:00:45
      259000 -- (-1087.627) (-1085.446) (-1091.670) [-1086.722] * (-1089.362) (-1092.819) [-1085.464] (-1087.087) -- 0:00:48
      259500 -- (-1086.502) (-1089.643) [-1090.020] (-1086.472) * (-1086.758) [-1090.004] (-1085.690) (-1090.034) -- 0:00:48
      260000 -- (-1086.591) (-1085.787) [-1088.119] (-1089.469) * (-1086.557) (-1093.256) [-1088.805] (-1091.485) -- 0:00:48

      Average standard deviation of split frequencies: 0.011276

      260500 -- [-1086.333] (-1087.291) (-1088.816) (-1089.016) * (-1086.940) (-1089.266) (-1088.790) [-1088.243] -- 0:00:48
      261000 -- (-1086.249) (-1086.433) (-1087.033) [-1085.854] * (-1088.500) (-1087.173) (-1088.749) [-1087.631] -- 0:00:48
      261500 -- [-1087.421] (-1087.546) (-1086.172) (-1087.807) * (-1087.830) (-1088.550) [-1086.508] (-1086.944) -- 0:00:48
      262000 -- (-1086.638) (-1087.705) (-1086.295) [-1086.151] * (-1087.803) (-1089.877) (-1087.055) [-1086.573] -- 0:00:47
      262500 -- (-1086.528) (-1090.159) [-1086.507] (-1089.538) * [-1086.952] (-1089.830) (-1086.357) (-1089.862) -- 0:00:47
      263000 -- [-1086.135] (-1088.075) (-1090.148) (-1087.943) * (-1088.796) (-1088.253) [-1086.806] (-1089.249) -- 0:00:47
      263500 -- [-1086.631] (-1088.140) (-1088.937) (-1086.988) * (-1087.947) [-1091.209] (-1087.681) (-1093.881) -- 0:00:47
      264000 -- (-1091.842) (-1088.147) [-1091.360] (-1087.552) * [-1087.014] (-1090.136) (-1087.384) (-1088.663) -- 0:00:47
      264500 -- (-1087.640) [-1086.122] (-1091.942) (-1087.353) * (-1086.501) (-1089.239) (-1088.186) [-1087.563] -- 0:00:47
      265000 -- [-1086.460] (-1087.168) (-1088.967) (-1087.822) * (-1086.934) (-1095.613) [-1088.017] (-1088.659) -- 0:00:47

      Average standard deviation of split frequencies: 0.009903

      265500 -- (-1088.042) [-1088.175] (-1090.368) (-1085.860) * (-1086.766) (-1086.530) (-1086.798) [-1087.922] -- 0:00:47
      266000 -- [-1087.194] (-1087.668) (-1086.907) (-1086.117) * (-1087.850) (-1086.244) (-1086.304) [-1086.317] -- 0:00:46
      266500 -- [-1087.201] (-1086.590) (-1086.195) (-1086.876) * (-1086.800) [-1086.342] (-1089.039) (-1086.771) -- 0:00:46
      267000 -- (-1087.078) [-1086.815] (-1085.734) (-1089.771) * [-1087.582] (-1086.342) (-1088.443) (-1088.416) -- 0:00:46
      267500 -- (-1086.743) (-1087.154) [-1086.672] (-1089.849) * [-1090.840] (-1086.966) (-1088.666) (-1090.289) -- 0:00:46
      268000 -- (-1086.786) (-1086.877) [-1088.340] (-1087.618) * (-1089.564) [-1086.051] (-1089.390) (-1087.234) -- 0:00:46
      268500 -- (-1086.309) [-1086.949] (-1090.389) (-1088.055) * (-1088.070) (-1087.779) [-1090.382] (-1087.613) -- 0:00:46
      269000 -- (-1086.305) (-1088.444) [-1089.528] (-1089.428) * [-1087.379] (-1088.302) (-1087.928) (-1086.636) -- 0:00:46
      269500 -- (-1087.867) [-1087.266] (-1087.279) (-1086.158) * (-1085.793) (-1089.429) [-1087.166] (-1090.611) -- 0:00:46
      270000 -- (-1086.637) [-1088.064] (-1090.662) (-1086.022) * (-1086.208) (-1087.023) (-1087.265) [-1088.633] -- 0:00:45

      Average standard deviation of split frequencies: 0.010837

      270500 -- [-1087.616] (-1087.241) (-1091.967) (-1086.421) * [-1088.041] (-1087.630) (-1087.731) (-1086.036) -- 0:00:45
      271000 -- [-1086.924] (-1087.257) (-1088.817) (-1087.745) * (-1089.099) [-1088.973] (-1087.535) (-1088.158) -- 0:00:45
      271500 -- (-1087.763) (-1086.725) [-1089.296] (-1088.404) * (-1094.123) (-1088.062) (-1089.625) [-1087.241] -- 0:00:45
      272000 -- (-1087.669) (-1087.239) (-1089.545) [-1087.432] * (-1091.764) (-1088.733) [-1086.156] (-1086.801) -- 0:00:45
      272500 -- (-1087.178) (-1093.975) (-1087.841) [-1086.946] * (-1091.807) (-1088.702) [-1089.594] (-1092.987) -- 0:00:45
      273000 -- (-1088.014) [-1092.056] (-1089.085) (-1086.330) * (-1086.549) (-1089.311) [-1086.405] (-1089.265) -- 0:00:45
      273500 -- (-1087.618) [-1089.889] (-1089.468) (-1088.244) * [-1090.199] (-1088.180) (-1085.975) (-1087.031) -- 0:00:45
      274000 -- (-1086.713) (-1092.326) (-1087.239) [-1085.948] * [-1087.373] (-1088.381) (-1086.266) (-1087.217) -- 0:00:45
      274500 -- (-1089.345) (-1088.088) [-1093.004] (-1085.820) * (-1089.525) (-1090.157) [-1086.776] (-1086.204) -- 0:00:44
      275000 -- (-1085.898) (-1087.345) [-1088.589] (-1085.623) * (-1090.300) (-1088.168) [-1086.637] (-1089.465) -- 0:00:44

      Average standard deviation of split frequencies: 0.011209

      275500 -- (-1088.175) (-1087.584) [-1087.125] (-1086.160) * (-1088.841) [-1087.203] (-1089.083) (-1090.207) -- 0:00:47
      276000 -- (-1089.093) (-1089.508) [-1088.422] (-1086.626) * (-1088.676) (-1087.590) [-1087.624] (-1088.494) -- 0:00:47
      276500 -- (-1090.433) (-1086.239) (-1088.933) [-1086.714] * (-1089.654) (-1087.710) (-1088.184) [-1086.573] -- 0:00:47
      277000 -- (-1089.847) [-1085.607] (-1090.591) (-1087.578) * [-1089.585] (-1089.175) (-1086.307) (-1087.304) -- 0:00:46
      277500 -- (-1088.574) (-1087.026) [-1086.195] (-1086.913) * (-1088.835) (-1091.478) [-1086.042] (-1088.223) -- 0:00:46
      278000 -- (-1086.307) (-1089.867) (-1091.390) [-1088.703] * (-1089.879) (-1087.211) [-1086.396] (-1089.413) -- 0:00:46
      278500 -- [-1086.085] (-1087.577) (-1091.642) (-1088.483) * [-1086.989] (-1087.628) (-1086.476) (-1086.716) -- 0:00:46
      279000 -- (-1086.079) (-1087.394) [-1088.522] (-1092.327) * [-1090.261] (-1087.861) (-1087.869) (-1087.476) -- 0:00:46
      279500 -- (-1088.511) [-1087.515] (-1087.137) (-1087.020) * (-1088.123) (-1089.612) [-1088.014] (-1087.051) -- 0:00:46
      280000 -- [-1088.496] (-1089.211) (-1087.592) (-1091.610) * [-1087.186] (-1086.724) (-1092.049) (-1092.251) -- 0:00:46

      Average standard deviation of split frequencies: 0.012449

      280500 -- [-1087.994] (-1086.182) (-1088.125) (-1089.033) * (-1086.797) (-1086.642) (-1087.166) [-1087.762] -- 0:00:46
      281000 -- [-1088.324] (-1088.629) (-1088.237) (-1087.258) * (-1087.781) [-1088.690] (-1088.228) (-1087.361) -- 0:00:46
      281500 -- (-1087.984) [-1086.687] (-1089.685) (-1090.463) * (-1086.842) [-1089.922] (-1089.977) (-1089.690) -- 0:00:45
      282000 -- (-1086.879) (-1087.015) (-1088.397) [-1086.583] * (-1088.153) (-1092.586) (-1090.410) [-1087.020] -- 0:00:45
      282500 -- (-1086.236) [-1087.952] (-1090.695) (-1089.885) * (-1086.180) [-1086.644] (-1087.686) (-1090.536) -- 0:00:45
      283000 -- (-1086.952) [-1087.547] (-1092.607) (-1089.794) * (-1086.859) [-1086.598] (-1089.602) (-1089.744) -- 0:00:45
      283500 -- [-1086.299] (-1088.559) (-1091.544) (-1087.520) * (-1086.495) [-1086.393] (-1086.301) (-1091.321) -- 0:00:45
      284000 -- (-1087.330) (-1090.967) [-1093.029] (-1092.995) * (-1087.221) [-1086.855] (-1086.664) (-1089.759) -- 0:00:45
      284500 -- (-1092.690) (-1086.840) (-1089.868) [-1089.776] * (-1089.334) (-1087.222) [-1086.626] (-1086.327) -- 0:00:45
      285000 -- (-1089.765) (-1086.997) [-1086.832] (-1090.030) * (-1086.723) (-1088.576) [-1085.752] (-1087.414) -- 0:00:45

      Average standard deviation of split frequencies: 0.012798

      285500 -- [-1088.034] (-1086.567) (-1088.342) (-1086.022) * (-1087.723) (-1087.968) [-1086.014] (-1087.073) -- 0:00:45
      286000 -- (-1085.707) (-1089.053) [-1086.891] (-1090.387) * [-1088.105] (-1088.159) (-1086.198) (-1089.136) -- 0:00:44
      286500 -- [-1086.570] (-1087.782) (-1092.686) (-1090.170) * (-1085.523) (-1087.586) [-1086.330] (-1086.089) -- 0:00:44
      287000 -- [-1088.476] (-1087.844) (-1087.580) (-1088.067) * (-1085.614) [-1088.008] (-1088.957) (-1086.304) -- 0:00:44
      287500 -- [-1089.854] (-1087.140) (-1088.808) (-1092.086) * (-1086.162) (-1086.010) [-1086.316] (-1085.784) -- 0:00:44
      288000 -- (-1089.927) [-1085.839] (-1087.880) (-1092.174) * (-1088.764) (-1085.633) [-1086.785] (-1088.031) -- 0:00:44
      288500 -- [-1089.193] (-1087.479) (-1086.982) (-1087.128) * (-1088.235) (-1085.852) [-1087.163] (-1085.786) -- 0:00:44
      289000 -- [-1087.742] (-1088.542) (-1089.067) (-1094.064) * (-1086.720) (-1090.596) (-1087.373) [-1085.874] -- 0:00:44
      289500 -- [-1087.669] (-1088.524) (-1090.173) (-1087.001) * (-1088.866) [-1088.899] (-1089.248) (-1085.875) -- 0:00:44
      290000 -- (-1086.999) (-1087.053) (-1088.294) [-1088.425] * (-1087.244) (-1090.032) [-1086.713] (-1085.993) -- 0:00:44

      Average standard deviation of split frequencies: 0.014692

      290500 -- [-1088.874] (-1087.765) (-1088.649) (-1087.528) * (-1088.966) (-1087.558) (-1090.879) [-1090.058] -- 0:00:43
      291000 -- [-1088.237] (-1087.154) (-1089.288) (-1086.148) * (-1087.772) (-1089.658) [-1090.228] (-1087.674) -- 0:00:43
      291500 -- (-1090.539) (-1087.388) [-1088.865] (-1089.562) * (-1085.683) [-1085.780] (-1089.190) (-1087.372) -- 0:00:46
      292000 -- (-1086.925) [-1088.003] (-1087.352) (-1087.695) * [-1086.065] (-1085.771) (-1086.272) (-1086.716) -- 0:00:46
      292500 -- [-1086.081] (-1089.146) (-1086.576) (-1087.379) * (-1086.447) [-1085.778] (-1088.814) (-1087.495) -- 0:00:45
      293000 -- [-1085.849] (-1091.501) (-1087.930) (-1088.121) * (-1085.842) (-1085.615) [-1089.083] (-1086.266) -- 0:00:45
      293500 -- (-1086.189) (-1091.834) [-1092.230] (-1086.118) * [-1089.380] (-1087.589) (-1088.877) (-1088.183) -- 0:00:45
      294000 -- (-1089.650) [-1087.087] (-1088.777) (-1086.429) * [-1089.196] (-1087.488) (-1088.710) (-1085.557) -- 0:00:45
      294500 -- (-1087.118) [-1086.826] (-1087.919) (-1090.940) * (-1088.602) (-1086.657) [-1089.332] (-1090.229) -- 0:00:45
      295000 -- (-1086.660) (-1089.862) (-1086.795) [-1087.830] * (-1088.660) (-1088.135) (-1090.471) [-1088.387] -- 0:00:45

      Average standard deviation of split frequencies: 0.014614

      295500 -- (-1093.096) (-1088.747) (-1086.749) [-1088.629] * (-1091.765) (-1086.845) (-1089.374) [-1089.110] -- 0:00:45
      296000 -- [-1089.134] (-1086.764) (-1090.267) (-1086.381) * (-1087.984) [-1085.881] (-1089.738) (-1090.760) -- 0:00:45
      296500 -- [-1085.596] (-1086.823) (-1090.062) (-1089.158) * (-1091.346) [-1087.218] (-1090.475) (-1089.538) -- 0:00:45
      297000 -- (-1087.363) [-1086.031] (-1089.086) (-1089.188) * (-1088.974) (-1090.375) (-1089.007) [-1088.933] -- 0:00:44
      297500 -- (-1088.536) (-1086.059) (-1089.279) [-1088.452] * [-1088.146] (-1089.726) (-1087.939) (-1089.997) -- 0:00:44
      298000 -- (-1090.013) (-1086.901) (-1089.113) [-1089.822] * [-1088.656] (-1089.628) (-1087.368) (-1088.161) -- 0:00:44
      298500 -- (-1088.156) [-1086.717] (-1091.062) (-1087.054) * (-1091.468) (-1093.683) [-1088.025] (-1088.303) -- 0:00:44
      299000 -- (-1085.536) (-1086.185) [-1088.844] (-1092.199) * (-1094.215) [-1091.965] (-1088.943) (-1086.560) -- 0:00:44
      299500 -- (-1086.357) [-1090.277] (-1092.698) (-1089.516) * (-1088.449) (-1087.857) (-1087.953) [-1085.941] -- 0:00:44
      300000 -- (-1086.298) (-1092.083) (-1088.127) [-1087.255] * [-1087.451] (-1087.213) (-1088.230) (-1086.097) -- 0:00:44

      Average standard deviation of split frequencies: 0.014480

      300500 -- (-1086.247) (-1086.427) [-1088.629] (-1087.199) * (-1087.672) (-1088.921) [-1088.183] (-1086.521) -- 0:00:44
      301000 -- (-1087.723) [-1086.572] (-1086.664) (-1088.634) * (-1086.346) (-1089.678) (-1086.171) [-1087.656] -- 0:00:44
      301500 -- (-1086.419) (-1085.904) [-1086.079] (-1088.137) * [-1086.615] (-1089.503) (-1086.000) (-1086.103) -- 0:00:44
      302000 -- (-1088.618) (-1085.826) [-1085.730] (-1087.528) * (-1088.962) (-1089.997) [-1086.777] (-1087.979) -- 0:00:43
      302500 -- (-1088.917) (-1087.015) [-1087.503] (-1086.557) * (-1089.003) (-1089.889) [-1087.306] (-1086.969) -- 0:00:43
      303000 -- [-1086.726] (-1086.097) (-1088.822) (-1087.181) * (-1087.321) (-1087.999) [-1087.621] (-1088.263) -- 0:00:43
      303500 -- (-1090.389) (-1091.394) (-1087.449) [-1090.143] * (-1086.333) (-1095.771) [-1087.126] (-1087.620) -- 0:00:43
      304000 -- (-1087.531) [-1088.629] (-1087.335) (-1088.894) * [-1089.998] (-1091.396) (-1091.077) (-1086.527) -- 0:00:43
      304500 -- (-1089.087) (-1092.384) (-1091.896) [-1087.705] * [-1087.959] (-1090.909) (-1092.845) (-1087.199) -- 0:00:43
      305000 -- (-1089.880) (-1089.843) (-1086.231) [-1086.347] * [-1087.814] (-1089.267) (-1087.947) (-1087.261) -- 0:00:43

      Average standard deviation of split frequencies: 0.015243

      305500 -- (-1088.690) (-1092.649) [-1086.377] (-1088.017) * [-1087.387] (-1089.565) (-1091.366) (-1087.373) -- 0:00:43
      306000 -- [-1087.383] (-1087.285) (-1088.805) (-1088.779) * (-1088.569) (-1088.715) (-1091.956) [-1087.709] -- 0:00:43
      306500 -- (-1086.582) (-1091.500) (-1090.290) [-1088.674] * (-1089.569) (-1090.202) (-1087.580) [-1091.417] -- 0:00:42
      307000 -- (-1085.774) [-1087.402] (-1090.778) (-1091.149) * (-1090.651) [-1090.219] (-1087.580) (-1089.602) -- 0:00:45
      307500 -- (-1086.762) (-1088.928) (-1088.498) [-1088.580] * [-1092.081] (-1087.770) (-1087.172) (-1088.008) -- 0:00:45
      308000 -- (-1092.202) (-1090.186) (-1090.139) [-1089.506] * (-1088.876) (-1088.575) [-1087.060] (-1086.860) -- 0:00:44
      308500 -- (-1091.289) (-1087.389) (-1086.776) [-1088.071] * (-1089.657) (-1089.862) (-1090.339) [-1094.319] -- 0:00:44
      309000 -- (-1090.258) (-1087.824) (-1086.728) [-1087.176] * (-1094.027) (-1086.534) (-1091.475) [-1087.640] -- 0:00:44
      309500 -- (-1087.483) (-1088.453) [-1090.784] (-1088.413) * [-1094.976] (-1086.233) (-1087.432) (-1090.508) -- 0:00:44
      310000 -- (-1088.138) (-1086.998) (-1087.449) [-1090.970] * (-1092.301) (-1086.581) (-1087.556) [-1087.372] -- 0:00:44

      Average standard deviation of split frequencies: 0.015595

      310500 -- (-1091.151) (-1089.209) [-1086.547] (-1089.992) * [-1087.212] (-1088.410) (-1088.009) (-1088.024) -- 0:00:44
      311000 -- (-1087.256) (-1087.334) (-1086.539) [-1089.976] * [-1092.056] (-1089.195) (-1088.755) (-1090.870) -- 0:00:44
      311500 -- (-1086.583) (-1089.856) [-1088.091] (-1087.864) * (-1090.638) (-1090.183) (-1091.144) [-1086.705] -- 0:00:44
      312000 -- (-1087.986) (-1091.026) (-1086.033) [-1089.403] * (-1089.269) (-1087.921) [-1088.756] (-1086.590) -- 0:00:44
      312500 -- (-1087.310) [-1085.694] (-1091.537) (-1087.769) * [-1088.943] (-1088.502) (-1092.182) (-1086.574) -- 0:00:44
      313000 -- (-1088.150) (-1089.737) [-1089.491] (-1086.346) * [-1086.498] (-1087.291) (-1086.670) (-1089.294) -- 0:00:43
      313500 -- (-1088.378) [-1090.354] (-1088.994) (-1088.962) * (-1085.799) [-1087.246] (-1086.621) (-1088.525) -- 0:00:43
      314000 -- [-1088.024] (-1090.465) (-1088.219) (-1088.857) * (-1086.904) (-1086.299) [-1087.757] (-1087.188) -- 0:00:43
      314500 -- (-1088.501) (-1088.493) (-1087.477) [-1087.889] * (-1086.484) (-1087.196) (-1085.898) [-1088.830] -- 0:00:43
      315000 -- (-1086.226) (-1087.582) (-1087.575) [-1087.134] * (-1086.853) [-1088.329] (-1088.399) (-1086.361) -- 0:00:43

      Average standard deviation of split frequencies: 0.015664

      315500 -- (-1086.540) (-1085.852) (-1088.598) [-1088.650] * (-1087.903) (-1086.839) (-1086.853) [-1086.692] -- 0:00:43
      316000 -- (-1087.662) (-1086.325) [-1086.463] (-1088.229) * (-1088.129) [-1088.084] (-1086.397) (-1087.806) -- 0:00:43
      316500 -- (-1089.290) [-1090.328] (-1090.327) (-1086.939) * (-1090.850) (-1091.714) [-1086.916] (-1085.834) -- 0:00:43
      317000 -- (-1087.842) [-1087.503] (-1089.413) (-1086.400) * (-1086.577) [-1088.332] (-1089.897) (-1086.989) -- 0:00:43
      317500 -- (-1087.974) (-1093.414) (-1087.350) [-1088.098] * [-1086.679] (-1089.464) (-1089.050) (-1088.750) -- 0:00:42
      318000 -- [-1088.590] (-1094.069) (-1088.258) (-1088.565) * [-1089.293] (-1086.386) (-1088.134) (-1087.946) -- 0:00:42
      318500 -- (-1088.608) (-1095.620) (-1086.890) [-1085.891] * (-1085.979) (-1086.671) [-1088.438] (-1091.055) -- 0:00:42
      319000 -- (-1087.923) (-1088.968) (-1086.626) [-1088.570] * (-1086.577) (-1088.431) (-1089.706) [-1090.067] -- 0:00:42
      319500 -- (-1088.364) (-1089.238) (-1087.561) [-1086.753] * (-1091.541) [-1086.549] (-1089.204) (-1088.661) -- 0:00:42
      320000 -- (-1087.841) (-1087.251) (-1088.981) [-1087.926] * (-1088.371) (-1089.973) [-1088.219] (-1088.666) -- 0:00:42

      Average standard deviation of split frequencies: 0.016079

      320500 -- (-1088.084) (-1085.914) (-1087.137) [-1085.784] * [-1087.868] (-1087.809) (-1087.243) (-1086.772) -- 0:00:42
      321000 -- (-1086.779) (-1088.696) [-1087.133] (-1087.480) * (-1087.976) (-1087.121) [-1087.561] (-1087.275) -- 0:00:42
      321500 -- (-1086.653) (-1087.782) (-1089.115) [-1087.942] * [-1087.262] (-1087.541) (-1088.264) (-1087.533) -- 0:00:42
      322000 -- (-1088.948) (-1089.041) [-1087.391] (-1085.734) * (-1088.516) (-1094.762) (-1087.342) [-1087.229] -- 0:00:42
      322500 -- (-1088.638) [-1087.424] (-1088.957) (-1085.393) * (-1089.212) (-1086.662) [-1087.078] (-1086.106) -- 0:00:42
      323000 -- (-1087.070) [-1086.899] (-1089.490) (-1094.145) * (-1086.222) [-1086.205] (-1090.918) (-1087.425) -- 0:00:44
      323500 -- (-1087.716) [-1092.719] (-1090.122) (-1091.723) * (-1089.327) [-1086.222] (-1087.962) (-1087.426) -- 0:00:43
      324000 -- (-1086.818) [-1086.607] (-1089.024) (-1088.621) * (-1088.999) (-1087.724) [-1088.646] (-1088.800) -- 0:00:43
      324500 -- [-1089.610] (-1091.728) (-1089.659) (-1092.317) * (-1087.583) (-1087.566) [-1087.504] (-1088.311) -- 0:00:43
      325000 -- (-1085.705) (-1087.116) [-1089.520] (-1094.374) * (-1086.476) [-1088.922] (-1089.281) (-1086.537) -- 0:00:43

      Average standard deviation of split frequencies: 0.015103

      325500 -- [-1085.833] (-1086.676) (-1086.809) (-1089.357) * (-1088.436) [-1088.866] (-1086.949) (-1086.265) -- 0:00:43
      326000 -- (-1094.504) (-1086.820) [-1086.952] (-1090.235) * [-1088.474] (-1086.364) (-1086.644) (-1087.369) -- 0:00:43
      326500 -- (-1088.635) (-1088.554) (-1087.149) [-1091.390] * (-1089.107) [-1087.387] (-1086.511) (-1086.753) -- 0:00:43
      327000 -- (-1088.547) (-1087.581) [-1088.485] (-1091.001) * (-1088.839) (-1087.568) [-1085.662] (-1087.110) -- 0:00:43
      327500 -- (-1089.566) (-1086.411) (-1085.330) [-1089.392] * (-1087.955) (-1086.741) (-1088.271) [-1087.437] -- 0:00:43
      328000 -- (-1092.421) (-1086.005) [-1088.089] (-1087.197) * (-1086.332) [-1088.727] (-1092.278) (-1085.835) -- 0:00:43
      328500 -- [-1087.398] (-1086.879) (-1087.922) (-1087.312) * [-1086.502] (-1087.641) (-1090.127) (-1087.402) -- 0:00:42
      329000 -- (-1087.189) (-1086.299) [-1089.675] (-1088.449) * (-1086.612) [-1089.242] (-1089.878) (-1088.384) -- 0:00:42
      329500 -- (-1085.712) [-1086.591] (-1090.111) (-1088.294) * [-1086.134] (-1092.450) (-1088.153) (-1087.015) -- 0:00:42
      330000 -- (-1087.274) (-1086.157) [-1087.143] (-1088.505) * (-1086.542) [-1087.962] (-1087.687) (-1086.755) -- 0:00:42

      Average standard deviation of split frequencies: 0.016157

      330500 -- (-1089.847) (-1085.614) (-1088.561) [-1088.754] * (-1089.471) (-1086.236) (-1087.783) [-1088.889] -- 0:00:42
      331000 -- [-1088.105] (-1086.538) (-1086.734) (-1090.359) * (-1087.964) (-1087.814) [-1086.141] (-1088.820) -- 0:00:42
      331500 -- [-1087.243] (-1092.279) (-1088.357) (-1093.354) * (-1087.292) (-1087.490) [-1086.327] (-1087.659) -- 0:00:42
      332000 -- (-1086.590) [-1090.137] (-1096.177) (-1085.923) * (-1086.210) (-1086.472) [-1086.924] (-1090.802) -- 0:00:42
      332500 -- [-1086.642] (-1088.329) (-1094.425) (-1087.948) * (-1088.498) (-1086.236) [-1087.727] (-1089.966) -- 0:00:42
      333000 -- (-1086.640) (-1086.444) (-1088.110) [-1088.071] * (-1090.744) (-1085.953) [-1085.963] (-1086.535) -- 0:00:42
      333500 -- (-1086.713) (-1086.109) [-1086.985] (-1091.030) * [-1088.010] (-1085.639) (-1089.556) (-1086.518) -- 0:00:41
      334000 -- (-1087.634) (-1086.378) [-1088.757] (-1091.339) * (-1085.939) [-1087.906] (-1088.150) (-1086.529) -- 0:00:41
      334500 -- (-1088.285) [-1089.841] (-1089.836) (-1087.798) * (-1085.753) [-1087.141] (-1086.810) (-1088.295) -- 0:00:41
      335000 -- (-1090.506) (-1086.289) [-1088.973] (-1088.770) * [-1086.366] (-1087.324) (-1089.253) (-1086.650) -- 0:00:41

      Average standard deviation of split frequencies: 0.017083

      335500 -- (-1088.988) [-1085.988] (-1088.104) (-1091.087) * (-1089.897) (-1089.828) (-1086.087) [-1087.961] -- 0:00:41
      336000 -- (-1086.994) (-1088.424) (-1087.597) [-1090.847] * (-1091.742) (-1093.013) (-1087.070) [-1087.860] -- 0:00:41
      336500 -- [-1090.289] (-1087.072) (-1087.308) (-1086.603) * (-1086.968) (-1088.801) (-1093.212) [-1090.010] -- 0:00:41
      337000 -- (-1087.866) (-1087.043) (-1090.204) [-1087.118] * (-1087.296) (-1088.344) (-1088.795) [-1087.169] -- 0:00:41
      337500 -- (-1086.885) [-1086.694] (-1086.791) (-1086.591) * (-1087.559) (-1086.388) (-1087.760) [-1086.246] -- 0:00:41
      338000 -- (-1087.315) (-1086.576) [-1087.487] (-1086.354) * (-1089.531) (-1088.221) [-1086.905] (-1090.870) -- 0:00:41
      338500 -- (-1086.159) [-1085.849] (-1087.617) (-1088.743) * (-1086.363) [-1087.219] (-1091.009) (-1087.086) -- 0:00:42
      339000 -- (-1090.702) (-1087.279) (-1089.102) [-1087.105] * [-1086.180] (-1087.824) (-1090.519) (-1088.023) -- 0:00:42
      339500 -- (-1086.238) (-1088.258) [-1086.742] (-1089.265) * [-1091.072] (-1086.618) (-1090.182) (-1088.755) -- 0:00:42
      340000 -- [-1088.628] (-1091.240) (-1091.635) (-1088.036) * (-1092.170) [-1086.681] (-1087.946) (-1085.987) -- 0:00:42

      Average standard deviation of split frequencies: 0.017012

      340500 -- [-1093.396] (-1086.711) (-1087.924) (-1087.610) * (-1091.607) (-1086.353) [-1085.706] (-1086.247) -- 0:00:42
      341000 -- (-1091.766) [-1088.487] (-1087.661) (-1089.870) * [-1089.415] (-1086.177) (-1085.807) (-1091.487) -- 0:00:42
      341500 -- [-1085.769] (-1086.982) (-1090.719) (-1089.860) * [-1088.368] (-1089.873) (-1088.237) (-1086.902) -- 0:00:42
      342000 -- [-1087.789] (-1087.041) (-1088.274) (-1087.683) * (-1087.644) (-1091.994) (-1086.120) [-1086.946] -- 0:00:42
      342500 -- (-1089.837) (-1086.170) (-1088.510) [-1087.912] * [-1086.667] (-1088.972) (-1088.154) (-1089.379) -- 0:00:42
      343000 -- (-1091.167) (-1086.170) (-1089.252) [-1087.721] * (-1085.858) [-1087.396] (-1088.417) (-1087.793) -- 0:00:42
      343500 -- [-1088.246] (-1085.494) (-1093.780) (-1097.564) * (-1086.158) (-1088.182) (-1090.184) [-1087.588] -- 0:00:42
      344000 -- (-1087.006) (-1085.563) (-1089.275) [-1088.693] * (-1091.317) (-1091.702) (-1088.470) [-1085.952] -- 0:00:41
      344500 -- (-1091.352) [-1085.549] (-1086.977) (-1088.396) * (-1090.750) (-1086.790) (-1086.566) [-1088.061] -- 0:00:41
      345000 -- (-1092.541) [-1088.174] (-1086.149) (-1089.149) * [-1087.348] (-1088.360) (-1086.412) (-1088.415) -- 0:00:41

      Average standard deviation of split frequencies: 0.016047

      345500 -- [-1089.790] (-1088.655) (-1087.125) (-1087.608) * [-1085.915] (-1088.446) (-1087.949) (-1087.762) -- 0:00:41
      346000 -- (-1087.937) (-1088.085) (-1086.246) [-1087.337] * (-1086.057) (-1087.894) (-1091.532) [-1090.339] -- 0:00:41
      346500 -- (-1089.926) (-1086.567) [-1086.893] (-1087.675) * (-1089.448) (-1091.934) (-1089.719) [-1086.804] -- 0:00:41
      347000 -- (-1087.981) [-1088.739] (-1086.768) (-1094.455) * [-1088.221] (-1089.579) (-1089.469) (-1087.113) -- 0:00:41
      347500 -- (-1087.052) (-1087.030) (-1089.908) [-1088.142] * (-1092.239) (-1086.264) [-1088.887] (-1088.802) -- 0:00:41
      348000 -- [-1087.562] (-1086.246) (-1088.521) (-1088.839) * (-1086.043) [-1088.043] (-1090.203) (-1088.934) -- 0:00:41
      348500 -- (-1087.404) [-1091.361] (-1091.776) (-1086.863) * (-1086.981) [-1088.723] (-1088.433) (-1087.626) -- 0:00:41
      349000 -- (-1086.342) (-1086.965) [-1089.438] (-1088.323) * [-1090.174] (-1086.247) (-1087.016) (-1087.957) -- 0:00:41
      349500 -- [-1087.744] (-1087.608) (-1090.400) (-1087.251) * (-1085.743) (-1087.772) (-1091.901) [-1087.804] -- 0:00:40
      350000 -- (-1087.806) (-1088.382) [-1086.419] (-1089.448) * (-1088.388) (-1087.935) [-1089.187] (-1089.369) -- 0:00:40

      Average standard deviation of split frequencies: 0.016655

      350500 -- (-1088.951) [-1085.636] (-1087.520) (-1088.229) * (-1086.433) (-1088.306) (-1094.260) [-1088.029] -- 0:00:40
      351000 -- (-1088.273) (-1086.946) [-1086.947] (-1087.609) * (-1090.773) (-1087.223) (-1090.376) [-1087.009] -- 0:00:40
      351500 -- (-1085.754) (-1087.905) [-1086.858] (-1088.904) * (-1088.562) (-1094.168) (-1089.102) [-1087.053] -- 0:00:40
      352000 -- (-1087.607) (-1086.087) (-1087.213) [-1087.044] * [-1088.055] (-1086.632) (-1086.399) (-1086.884) -- 0:00:40
      352500 -- [-1087.139] (-1088.982) (-1086.771) (-1090.085) * [-1086.682] (-1087.741) (-1087.381) (-1086.545) -- 0:00:40
      353000 -- (-1089.331) (-1087.065) [-1086.194] (-1085.963) * (-1087.840) (-1088.760) (-1089.134) [-1087.225] -- 0:00:40
      353500 -- (-1089.787) (-1088.285) [-1085.960] (-1090.430) * (-1092.374) (-1089.541) [-1088.578] (-1086.650) -- 0:00:40
      354000 -- (-1089.069) (-1088.252) (-1086.326) [-1085.891] * (-1088.215) (-1087.547) (-1087.782) [-1090.076] -- 0:00:40
      354500 -- (-1088.934) (-1086.525) (-1086.326) [-1088.572] * (-1087.054) [-1088.279] (-1094.521) (-1087.615) -- 0:00:40
      355000 -- (-1092.677) [-1087.057] (-1091.116) (-1087.873) * (-1086.685) (-1088.374) [-1087.184] (-1089.650) -- 0:00:41

      Average standard deviation of split frequencies: 0.015345

      355500 -- (-1086.503) (-1087.803) (-1086.895) [-1085.984] * (-1086.571) [-1087.967] (-1088.123) (-1086.857) -- 0:00:41
      356000 -- (-1087.420) [-1088.484] (-1087.772) (-1087.874) * (-1086.542) [-1086.626] (-1088.271) (-1085.954) -- 0:00:41
      356500 -- [-1085.755] (-1089.360) (-1086.501) (-1088.372) * (-1086.473) (-1088.233) (-1088.778) [-1085.987] -- 0:00:41
      357000 -- (-1086.950) (-1090.490) (-1086.147) [-1086.010] * [-1086.495] (-1090.678) (-1088.632) (-1088.038) -- 0:00:41
      357500 -- (-1087.862) (-1092.084) (-1085.825) [-1086.582] * (-1085.892) (-1086.780) (-1085.974) [-1086.450] -- 0:00:41
      358000 -- (-1087.745) (-1093.219) [-1089.523] (-1086.434) * (-1087.736) [-1088.794] (-1085.514) (-1086.710) -- 0:00:41
      358500 -- (-1087.635) [-1086.346] (-1087.747) (-1088.438) * [-1087.424] (-1086.527) (-1087.597) (-1086.421) -- 0:00:41
      359000 -- (-1091.077) [-1088.091] (-1086.201) (-1088.335) * [-1087.522] (-1094.775) (-1090.726) (-1087.444) -- 0:00:41
      359500 -- (-1089.233) (-1088.129) (-1087.534) [-1086.100] * (-1089.433) [-1089.110] (-1090.493) (-1087.210) -- 0:00:40
      360000 -- (-1093.804) (-1086.686) (-1088.538) [-1086.093] * [-1088.728] (-1090.307) (-1087.345) (-1088.367) -- 0:00:40

      Average standard deviation of split frequencies: 0.015859

      360500 -- (-1088.385) (-1089.111) (-1089.451) [-1085.749] * (-1086.038) (-1088.020) [-1086.362] (-1092.554) -- 0:00:40
      361000 -- [-1087.854] (-1085.840) (-1086.979) (-1087.589) * [-1087.985] (-1088.944) (-1087.636) (-1086.257) -- 0:00:40
      361500 -- (-1089.268) [-1087.482] (-1088.102) (-1086.269) * (-1085.827) (-1086.507) [-1087.557] (-1087.692) -- 0:00:40
      362000 -- [-1088.951] (-1085.977) (-1094.252) (-1088.590) * (-1087.574) [-1086.465] (-1086.696) (-1086.771) -- 0:00:40
      362500 -- (-1085.900) (-1087.859) (-1091.654) [-1086.105] * [-1088.193] (-1086.001) (-1087.019) (-1087.668) -- 0:00:40
      363000 -- [-1086.031] (-1087.353) (-1088.546) (-1086.039) * (-1087.169) [-1087.346] (-1086.739) (-1087.837) -- 0:00:40
      363500 -- (-1089.945) (-1087.924) [-1087.115] (-1087.513) * (-1087.419) (-1086.764) [-1087.349] (-1087.917) -- 0:00:40
      364000 -- (-1088.361) (-1088.006) [-1086.459] (-1087.122) * (-1087.841) (-1085.930) (-1090.759) [-1087.588] -- 0:00:40
      364500 -- (-1088.953) [-1088.343] (-1085.940) (-1087.124) * (-1092.510) (-1086.104) (-1090.912) [-1088.927] -- 0:00:40
      365000 -- (-1087.611) (-1086.270) [-1087.787] (-1088.260) * (-1091.994) (-1090.126) (-1087.218) [-1087.999] -- 0:00:40

      Average standard deviation of split frequencies: 0.015375

      365500 -- (-1086.537) [-1088.047] (-1088.486) (-1086.443) * [-1088.876] (-1088.367) (-1090.360) (-1087.138) -- 0:00:39
      366000 -- (-1086.832) [-1087.233] (-1087.218) (-1092.063) * [-1088.803] (-1087.412) (-1086.953) (-1089.842) -- 0:00:39
      366500 -- (-1085.989) [-1087.792] (-1086.913) (-1088.628) * (-1086.542) [-1089.387] (-1088.416) (-1086.472) -- 0:00:39
      367000 -- (-1089.969) (-1089.651) [-1086.664] (-1088.648) * (-1087.360) (-1088.248) [-1090.206] (-1087.636) -- 0:00:39
      367500 -- (-1088.568) [-1087.618] (-1087.607) (-1090.200) * (-1093.002) (-1091.428) [-1089.324] (-1085.960) -- 0:00:39
      368000 -- [-1086.783] (-1090.034) (-1089.090) (-1087.747) * (-1088.530) (-1087.904) [-1086.382] (-1090.849) -- 0:00:39
      368500 -- (-1087.399) (-1087.171) [-1086.381] (-1087.346) * [-1086.543] (-1089.748) (-1088.944) (-1089.393) -- 0:00:39
      369000 -- [-1087.182] (-1090.144) (-1086.333) (-1087.678) * (-1087.414) [-1087.575] (-1088.818) (-1090.938) -- 0:00:39
      369500 -- (-1088.163) [-1091.093] (-1086.713) (-1088.719) * [-1087.375] (-1086.738) (-1088.915) (-1090.891) -- 0:00:39
      370000 -- (-1088.477) [-1087.250] (-1086.994) (-1090.197) * (-1090.314) (-1086.662) (-1088.447) [-1088.969] -- 0:00:39

      Average standard deviation of split frequencies: 0.016109

      370500 -- (-1087.458) (-1089.227) [-1087.083] (-1087.520) * [-1088.473] (-1087.744) (-1088.796) (-1091.305) -- 0:00:39
      371000 -- [-1087.609] (-1089.275) (-1086.380) (-1089.006) * (-1086.626) (-1089.065) (-1088.770) [-1089.995] -- 0:00:40
      371500 -- [-1087.915] (-1090.853) (-1085.919) (-1086.526) * (-1087.201) [-1088.455] (-1088.006) (-1087.971) -- 0:00:40
      372000 -- (-1090.119) (-1088.336) (-1088.216) [-1087.560] * (-1090.030) [-1089.105] (-1085.294) (-1087.112) -- 0:00:40
      372500 -- (-1090.222) (-1087.259) (-1088.382) [-1089.829] * (-1089.671) [-1090.766] (-1087.151) (-1087.166) -- 0:00:40
      373000 -- (-1089.943) (-1086.662) [-1087.438] (-1088.346) * (-1089.271) [-1089.699] (-1089.393) (-1088.176) -- 0:00:40
      373500 -- (-1091.390) (-1089.412) (-1086.734) [-1086.599] * (-1087.752) (-1090.259) [-1087.769] (-1086.243) -- 0:00:40
      374000 -- [-1086.358] (-1089.378) (-1087.186) (-1091.347) * (-1089.285) (-1091.307) (-1089.610) [-1087.366] -- 0:00:40
      374500 -- (-1087.289) (-1089.113) [-1085.583] (-1087.773) * (-1089.030) (-1090.860) (-1089.644) [-1086.901] -- 0:00:40
      375000 -- (-1088.418) (-1088.211) (-1087.534) [-1087.556] * [-1087.844] (-1088.805) (-1088.586) (-1087.932) -- 0:00:40

      Average standard deviation of split frequencies: 0.015782

      375500 -- (-1086.922) (-1090.133) [-1089.101] (-1086.875) * (-1086.840) (-1089.735) (-1086.909) [-1087.614] -- 0:00:39
      376000 -- (-1087.606) (-1088.325) (-1088.311) [-1088.655] * (-1088.784) (-1089.242) [-1088.378] (-1087.322) -- 0:00:39
      376500 -- [-1087.393] (-1090.086) (-1085.978) (-1091.017) * (-1086.928) [-1088.107] (-1092.914) (-1090.191) -- 0:00:39
      377000 -- (-1089.869) (-1090.222) [-1092.200] (-1086.781) * (-1086.300) (-1087.915) [-1088.253] (-1086.818) -- 0:00:39
      377500 -- (-1089.121) [-1088.633] (-1087.797) (-1087.327) * [-1085.956] (-1094.051) (-1087.550) (-1087.515) -- 0:00:39
      378000 -- (-1088.480) (-1088.037) (-1089.407) [-1086.736] * (-1085.769) (-1092.657) [-1087.706] (-1086.131) -- 0:00:39
      378500 -- (-1089.723) (-1086.724) (-1089.009) [-1085.858] * (-1086.072) (-1088.409) (-1088.890) [-1088.084] -- 0:00:39
      379000 -- [-1085.994] (-1086.077) (-1088.146) (-1090.906) * (-1088.469) (-1089.285) (-1088.558) [-1085.925] -- 0:00:39
      379500 -- (-1086.355) (-1086.066) [-1087.914] (-1085.852) * (-1087.358) (-1088.888) (-1086.241) [-1086.218] -- 0:00:39
      380000 -- (-1085.452) (-1086.448) (-1086.320) [-1089.522] * (-1087.969) (-1087.553) [-1086.512] (-1086.431) -- 0:00:39

      Average standard deviation of split frequencies: 0.016176

      380500 -- (-1088.278) (-1087.441) [-1086.761] (-1089.255) * (-1089.122) [-1085.607] (-1088.590) (-1085.794) -- 0:00:39
      381000 -- (-1086.227) [-1086.891] (-1088.128) (-1086.502) * [-1088.313] (-1085.862) (-1088.725) (-1091.242) -- 0:00:38
      381500 -- (-1088.785) (-1090.109) (-1087.728) [-1089.397] * (-1089.441) (-1087.014) [-1085.987] (-1088.282) -- 0:00:38
      382000 -- (-1092.092) (-1089.156) [-1086.292] (-1090.510) * [-1085.909] (-1085.757) (-1090.766) (-1089.839) -- 0:00:38
      382500 -- (-1089.663) (-1088.379) [-1086.998] (-1086.268) * (-1087.187) [-1087.079] (-1087.005) (-1089.723) -- 0:00:38
      383000 -- (-1090.495) (-1086.335) (-1087.242) [-1086.080] * (-1089.705) [-1086.397] (-1087.484) (-1087.255) -- 0:00:38
      383500 -- [-1091.328] (-1086.916) (-1090.391) (-1094.477) * (-1089.367) (-1088.130) (-1088.097) [-1086.203] -- 0:00:38
      384000 -- (-1088.102) (-1093.663) [-1088.375] (-1093.238) * (-1086.836) [-1088.409] (-1088.192) (-1088.474) -- 0:00:38
      384500 -- (-1087.296) [-1089.071] (-1089.111) (-1090.292) * [-1089.206] (-1097.080) (-1085.847) (-1092.004) -- 0:00:38
      385000 -- (-1092.514) (-1090.631) [-1088.897] (-1088.048) * (-1085.751) (-1091.798) [-1087.859] (-1086.097) -- 0:00:38

      Average standard deviation of split frequencies: 0.015302

      385500 -- (-1087.667) (-1090.191) (-1090.775) [-1085.787] * (-1089.014) (-1092.122) (-1089.972) [-1087.475] -- 0:00:38
      386000 -- [-1092.212] (-1088.824) (-1088.245) (-1088.463) * (-1087.695) [-1089.489] (-1088.254) (-1087.296) -- 0:00:38
      386500 -- (-1087.136) (-1087.877) [-1089.109] (-1091.733) * (-1087.673) (-1089.489) (-1088.130) [-1087.324] -- 0:00:38
      387000 -- (-1086.274) (-1086.621) (-1086.380) [-1092.191] * (-1088.814) (-1087.781) (-1089.513) [-1086.592] -- 0:00:38
      387500 -- (-1090.416) [-1086.678] (-1087.252) (-1092.072) * [-1088.790] (-1087.690) (-1087.755) (-1088.112) -- 0:00:39
      388000 -- [-1089.948] (-1087.624) (-1090.096) (-1087.967) * (-1086.539) (-1087.151) [-1089.238] (-1089.972) -- 0:00:39
      388500 -- (-1085.758) (-1086.801) (-1087.493) [-1087.692] * (-1091.267) (-1087.395) [-1087.607] (-1088.261) -- 0:00:39
      389000 -- (-1086.643) [-1089.698] (-1086.474) (-1089.839) * (-1087.266) (-1087.195) [-1087.402] (-1086.787) -- 0:00:39
      389500 -- (-1088.136) (-1086.886) [-1087.540] (-1089.779) * (-1086.650) [-1085.967] (-1086.685) (-1086.834) -- 0:00:39
      390000 -- (-1087.352) [-1085.744] (-1087.181) (-1086.449) * [-1093.671] (-1087.310) (-1086.308) (-1090.006) -- 0:00:39

      Average standard deviation of split frequencies: 0.016008

      390500 -- (-1088.871) [-1085.679] (-1086.702) (-1086.547) * (-1093.181) [-1086.601] (-1087.937) (-1086.374) -- 0:00:39
      391000 -- (-1093.722) (-1086.726) (-1089.929) [-1085.828] * (-1087.694) (-1091.236) [-1089.459] (-1089.810) -- 0:00:38
      391500 -- (-1090.857) (-1094.351) (-1087.190) [-1085.829] * (-1088.091) (-1096.253) [-1086.514] (-1089.024) -- 0:00:38
      392000 -- (-1091.088) (-1087.188) [-1087.252] (-1086.099) * (-1086.653) [-1086.447] (-1087.703) (-1086.906) -- 0:00:38
      392500 -- (-1086.043) (-1090.462) (-1087.367) [-1087.916] * (-1086.643) (-1086.766) [-1088.599] (-1087.706) -- 0:00:38
      393000 -- [-1087.235] (-1088.406) (-1087.714) (-1088.017) * (-1088.562) [-1092.295] (-1087.888) (-1085.675) -- 0:00:38
      393500 -- [-1086.172] (-1088.975) (-1089.759) (-1090.999) * (-1094.647) (-1092.046) [-1086.626] (-1085.526) -- 0:00:38
      394000 -- [-1086.763] (-1091.373) (-1092.059) (-1087.134) * [-1090.480] (-1089.178) (-1089.069) (-1086.415) -- 0:00:38
      394500 -- [-1086.370] (-1088.110) (-1086.454) (-1085.524) * (-1087.018) (-1089.147) (-1086.059) [-1087.336] -- 0:00:38
      395000 -- (-1085.358) [-1086.687] (-1089.796) (-1086.628) * (-1087.722) (-1087.075) [-1086.835] (-1089.304) -- 0:00:38

      Average standard deviation of split frequencies: 0.015317

      395500 -- [-1087.927] (-1087.754) (-1091.106) (-1088.719) * (-1092.239) (-1086.688) (-1089.615) [-1089.844] -- 0:00:38
      396000 -- (-1088.051) [-1086.546] (-1086.780) (-1088.459) * (-1088.143) (-1091.150) [-1090.608] (-1086.871) -- 0:00:38
      396500 -- (-1092.149) (-1087.989) [-1088.079] (-1087.840) * (-1088.881) (-1094.416) (-1087.292) [-1086.846] -- 0:00:38
      397000 -- (-1087.124) [-1087.647] (-1087.549) (-1086.971) * (-1088.994) (-1086.275) (-1090.771) [-1090.931] -- 0:00:37
      397500 -- [-1095.103] (-1088.577) (-1086.683) (-1086.854) * (-1088.811) (-1087.876) [-1087.015] (-1089.282) -- 0:00:37
      398000 -- (-1091.994) (-1086.611) (-1088.067) [-1085.968] * (-1086.743) (-1087.720) [-1089.329] (-1088.712) -- 0:00:37
      398500 -- (-1089.147) (-1087.665) (-1086.177) [-1087.297] * [-1086.992] (-1087.720) (-1094.576) (-1087.676) -- 0:00:37
      399000 -- [-1088.339] (-1090.168) (-1087.180) (-1087.295) * (-1086.664) (-1090.078) [-1086.116] (-1094.647) -- 0:00:37
      399500 -- (-1090.230) [-1089.965] (-1088.933) (-1087.125) * (-1089.782) [-1088.428] (-1087.462) (-1086.683) -- 0:00:37
      400000 -- [-1091.458] (-1086.753) (-1087.463) (-1087.492) * [-1089.055] (-1095.480) (-1087.929) (-1087.864) -- 0:00:37

      Average standard deviation of split frequencies: 0.014511

      400500 -- (-1088.217) (-1090.498) [-1087.378] (-1086.894) * [-1086.086] (-1089.502) (-1099.075) (-1085.716) -- 0:00:37
      401000 -- (-1086.510) (-1088.496) (-1085.675) [-1087.018] * (-1086.229) (-1087.476) [-1088.569] (-1086.186) -- 0:00:37
      401500 -- (-1088.813) (-1085.884) (-1087.378) [-1087.258] * (-1088.318) (-1087.368) (-1092.290) [-1086.268] -- 0:00:37
      402000 -- [-1090.292] (-1086.033) (-1088.509) (-1087.292) * (-1088.359) [-1086.241] (-1092.263) (-1086.557) -- 0:00:37
      402500 -- (-1090.939) (-1087.537) [-1087.018] (-1086.118) * [-1087.527] (-1085.872) (-1091.526) (-1086.391) -- 0:00:37
      403000 -- [-1086.677] (-1086.466) (-1087.078) (-1088.067) * (-1087.527) (-1086.116) [-1086.892] (-1085.691) -- 0:00:38
      403500 -- (-1086.427) [-1087.864] (-1086.356) (-1087.605) * (-1086.594) (-1087.345) [-1086.383] (-1086.066) -- 0:00:38
      404000 -- (-1086.490) [-1085.869] (-1086.051) (-1089.549) * (-1087.430) (-1085.677) (-1087.454) [-1085.686] -- 0:00:38
      404500 -- (-1086.753) (-1088.443) (-1086.048) [-1087.792] * (-1086.890) (-1086.109) (-1086.831) [-1085.796] -- 0:00:38
      405000 -- (-1085.985) [-1087.372] (-1086.453) (-1093.283) * (-1090.593) [-1092.452] (-1087.333) (-1087.426) -- 0:00:38

      Average standard deviation of split frequencies: 0.014320

      405500 -- (-1086.175) (-1087.506) [-1086.571] (-1097.490) * (-1089.008) (-1087.424) (-1088.085) [-1087.531] -- 0:00:38
      406000 -- (-1086.780) (-1087.921) [-1086.584] (-1089.810) * (-1087.094) [-1086.945] (-1086.871) (-1088.053) -- 0:00:38
      406500 -- (-1086.764) [-1088.352] (-1088.782) (-1087.667) * [-1086.693] (-1087.438) (-1087.817) (-1086.939) -- 0:00:37
      407000 -- (-1088.163) (-1087.527) (-1088.087) [-1091.657] * [-1088.092] (-1088.500) (-1088.569) (-1089.828) -- 0:00:37
      407500 -- (-1086.772) (-1087.348) [-1086.599] (-1088.742) * (-1090.301) (-1088.059) [-1089.592] (-1091.061) -- 0:00:37
      408000 -- (-1087.057) [-1086.382] (-1087.591) (-1087.375) * [-1088.706] (-1086.687) (-1088.172) (-1087.555) -- 0:00:37
      408500 -- (-1090.654) [-1086.486] (-1086.595) (-1090.039) * [-1086.836] (-1087.111) (-1086.084) (-1086.190) -- 0:00:37
      409000 -- (-1088.263) [-1086.553] (-1086.316) (-1090.958) * (-1089.860) (-1090.948) (-1088.500) [-1085.616] -- 0:00:37
      409500 -- (-1087.356) (-1088.379) [-1085.515] (-1092.203) * (-1089.193) (-1086.728) (-1088.297) [-1086.500] -- 0:00:37
      410000 -- (-1087.206) [-1089.380] (-1086.825) (-1090.976) * (-1088.085) (-1086.495) (-1087.702) [-1086.102] -- 0:00:37

      Average standard deviation of split frequencies: 0.014310

      410500 -- (-1086.606) [-1086.046] (-1088.365) (-1087.214) * (-1086.805) (-1085.843) (-1087.841) [-1088.232] -- 0:00:37
      411000 -- [-1086.975] (-1089.084) (-1087.694) (-1090.233) * (-1086.157) (-1088.630) (-1085.702) [-1090.026] -- 0:00:37
      411500 -- [-1086.575] (-1087.179) (-1086.150) (-1092.335) * (-1086.699) [-1088.239] (-1086.786) (-1086.738) -- 0:00:37
      412000 -- [-1088.601] (-1086.169) (-1086.153) (-1089.182) * (-1088.739) (-1087.807) [-1088.928] (-1087.741) -- 0:00:37
      412500 -- (-1089.635) [-1089.094] (-1086.118) (-1089.254) * (-1088.213) (-1088.758) (-1086.381) [-1086.952] -- 0:00:37
      413000 -- (-1086.314) [-1085.650] (-1088.475) (-1088.823) * [-1085.766] (-1087.289) (-1087.576) (-1087.339) -- 0:00:36
      413500 -- (-1090.456) [-1087.190] (-1087.825) (-1087.389) * [-1086.447] (-1088.648) (-1088.808) (-1087.090) -- 0:00:36
      414000 -- [-1087.273] (-1086.386) (-1085.865) (-1085.809) * (-1087.824) [-1087.794] (-1088.442) (-1088.967) -- 0:00:36
      414500 -- (-1085.583) (-1087.410) (-1086.774) [-1085.824] * (-1087.021) (-1089.175) (-1088.113) [-1086.474] -- 0:00:36
      415000 -- (-1085.993) (-1090.216) (-1087.882) [-1087.473] * (-1090.015) (-1088.540) [-1088.033] (-1088.149) -- 0:00:36

      Average standard deviation of split frequencies: 0.013523

      415500 -- (-1086.006) (-1086.445) [-1087.271] (-1093.493) * (-1085.971) (-1087.588) (-1087.504) [-1087.434] -- 0:00:36
      416000 -- (-1086.996) (-1085.992) (-1089.619) [-1091.869] * (-1086.341) (-1086.027) [-1089.927] (-1090.553) -- 0:00:36
      416500 -- (-1087.463) [-1087.851] (-1089.777) (-1090.142) * (-1087.232) (-1085.869) [-1086.494] (-1089.476) -- 0:00:36
      417000 -- (-1087.986) (-1086.484) (-1087.377) [-1091.264] * (-1087.397) [-1086.346] (-1089.781) (-1087.738) -- 0:00:36
      417500 -- (-1086.722) (-1090.518) (-1087.364) [-1088.409] * (-1089.743) [-1088.583] (-1088.010) (-1087.832) -- 0:00:36
      418000 -- (-1087.574) [-1087.596] (-1090.382) (-1088.944) * (-1089.366) (-1087.369) [-1085.509] (-1087.733) -- 0:00:36
      418500 -- (-1087.696) [-1088.522] (-1086.059) (-1087.324) * (-1088.992) (-1086.829) [-1087.063] (-1090.205) -- 0:00:36
      419000 -- [-1086.672] (-1087.759) (-1087.633) (-1087.324) * (-1086.044) (-1086.892) (-1087.040) [-1087.030] -- 0:00:37
      419500 -- [-1088.890] (-1087.424) (-1089.721) (-1089.211) * (-1087.910) [-1088.729] (-1086.749) (-1086.609) -- 0:00:37
      420000 -- [-1087.614] (-1087.389) (-1088.075) (-1087.304) * (-1086.809) (-1087.958) (-1087.462) [-1086.883] -- 0:00:37

      Average standard deviation of split frequencies: 0.013373

      420500 -- (-1088.465) [-1087.315] (-1088.706) (-1089.546) * (-1087.040) (-1085.800) [-1086.426] (-1087.674) -- 0:00:37
      421000 -- (-1089.572) (-1086.341) (-1089.241) [-1087.498] * (-1087.521) (-1086.031) (-1086.834) [-1088.996] -- 0:00:37
      421500 -- (-1091.625) (-1086.541) (-1086.522) [-1086.956] * [-1086.380] (-1086.314) (-1086.064) (-1085.722) -- 0:00:37
      422000 -- [-1089.119] (-1090.517) (-1086.390) (-1088.551) * (-1087.134) (-1089.155) [-1086.067] (-1087.314) -- 0:00:36
      422500 -- (-1086.449) [-1086.940] (-1089.998) (-1085.874) * (-1087.718) (-1090.363) [-1086.266] (-1088.260) -- 0:00:36
      423000 -- [-1088.194] (-1087.263) (-1090.817) (-1086.331) * (-1088.166) [-1091.336] (-1088.136) (-1091.985) -- 0:00:36
      423500 -- (-1089.197) (-1088.176) (-1087.457) [-1086.489] * (-1091.295) (-1086.424) (-1086.527) [-1092.374] -- 0:00:36
      424000 -- [-1089.650] (-1090.734) (-1087.296) (-1086.388) * (-1087.803) (-1086.484) [-1085.893] (-1089.503) -- 0:00:36
      424500 -- [-1090.039] (-1090.087) (-1090.840) (-1087.820) * (-1087.209) (-1087.693) [-1086.531] (-1088.489) -- 0:00:36
      425000 -- [-1087.720] (-1089.513) (-1087.662) (-1090.377) * [-1087.817] (-1087.496) (-1087.734) (-1088.598) -- 0:00:36

      Average standard deviation of split frequencies: 0.012984

      425500 -- (-1088.144) [-1087.341] (-1086.192) (-1086.782) * (-1087.865) [-1088.242] (-1094.275) (-1087.951) -- 0:00:36
      426000 -- [-1086.253] (-1085.892) (-1088.186) (-1087.013) * (-1087.940) (-1088.516) (-1087.138) [-1088.288] -- 0:00:36
      426500 -- (-1085.534) (-1098.317) (-1086.667) [-1090.069] * [-1086.189] (-1090.077) (-1087.556) (-1088.958) -- 0:00:36
      427000 -- [-1087.094] (-1095.033) (-1091.187) (-1087.633) * [-1085.856] (-1086.659) (-1091.786) (-1089.208) -- 0:00:36
      427500 -- (-1087.145) (-1092.284) [-1087.375] (-1087.978) * (-1086.265) (-1086.806) (-1090.316) [-1085.688] -- 0:00:36
      428000 -- (-1087.324) (-1090.643) [-1086.376] (-1089.243) * (-1088.440) (-1089.078) (-1087.980) [-1086.060] -- 0:00:36
      428500 -- (-1091.843) [-1088.553] (-1087.936) (-1091.882) * [-1086.017] (-1089.317) (-1088.547) (-1085.957) -- 0:00:36
      429000 -- (-1088.893) (-1088.777) (-1087.828) [-1086.783] * [-1088.032] (-1087.700) (-1091.551) (-1086.582) -- 0:00:35
      429500 -- (-1088.503) (-1086.162) (-1086.151) [-1087.303] * (-1087.188) (-1087.352) (-1089.670) [-1086.457] -- 0:00:35
      430000 -- (-1087.032) (-1086.176) (-1094.953) [-1090.015] * (-1087.179) (-1087.344) [-1086.840] (-1087.934) -- 0:00:35

      Average standard deviation of split frequencies: 0.014298

      430500 -- (-1086.170) [-1086.436] (-1087.347) (-1090.783) * [-1088.098] (-1087.618) (-1090.642) (-1087.302) -- 0:00:35
      431000 -- (-1086.928) (-1088.756) [-1086.924] (-1088.385) * (-1087.232) [-1086.792] (-1091.612) (-1098.709) -- 0:00:35
      431500 -- (-1091.714) (-1089.074) (-1086.653) [-1087.368] * (-1087.601) (-1087.225) [-1086.773] (-1092.925) -- 0:00:35
      432000 -- (-1089.788) [-1087.911] (-1092.735) (-1089.382) * (-1086.552) (-1086.232) [-1087.412] (-1094.527) -- 0:00:35
      432500 -- (-1088.067) (-1086.857) [-1090.619] (-1088.945) * (-1090.376) (-1092.844) (-1086.392) [-1086.515] -- 0:00:35
      433000 -- (-1087.411) [-1090.692] (-1090.128) (-1087.658) * (-1089.064) (-1087.134) (-1087.961) [-1088.894] -- 0:00:36
      433500 -- [-1087.448] (-1088.576) (-1088.353) (-1087.541) * (-1090.118) (-1087.910) (-1091.962) [-1088.190] -- 0:00:36
      434000 -- [-1087.083] (-1087.992) (-1088.048) (-1090.389) * (-1091.179) (-1089.271) (-1092.401) [-1086.664] -- 0:00:36
      434500 -- (-1089.463) (-1090.201) [-1087.968] (-1089.522) * (-1086.865) [-1089.040] (-1087.998) (-1086.895) -- 0:00:36
      435000 -- (-1090.340) [-1086.686] (-1087.854) (-1089.848) * [-1086.820] (-1087.984) (-1085.990) (-1087.218) -- 0:00:36

      Average standard deviation of split frequencies: 0.014258

      435500 -- (-1088.825) (-1088.336) [-1087.415] (-1088.237) * [-1086.616] (-1091.347) (-1085.933) (-1086.612) -- 0:00:36
      436000 -- (-1090.086) (-1087.726) (-1087.019) [-1090.630] * (-1092.529) (-1089.661) (-1089.936) [-1086.420] -- 0:00:36
      436500 -- [-1086.836] (-1086.829) (-1092.603) (-1086.587) * (-1086.166) (-1091.816) [-1086.313] (-1088.576) -- 0:00:36
      437000 -- (-1085.783) (-1093.465) [-1087.589] (-1087.476) * (-1085.950) (-1093.837) (-1090.649) [-1086.746] -- 0:00:36
      437500 -- (-1086.580) [-1091.141] (-1092.471) (-1087.347) * (-1085.696) (-1090.002) (-1086.175) [-1088.855] -- 0:00:36
      438000 -- (-1086.808) [-1087.654] (-1087.688) (-1089.451) * (-1086.734) (-1089.224) (-1086.063) [-1085.658] -- 0:00:35
      438500 -- (-1087.163) (-1087.209) [-1086.185] (-1086.883) * (-1086.396) (-1092.054) [-1087.670] (-1089.266) -- 0:00:35
      439000 -- (-1089.728) [-1087.250] (-1085.701) (-1086.941) * [-1087.261] (-1086.684) (-1088.652) (-1089.735) -- 0:00:35
      439500 -- (-1088.613) [-1086.585] (-1086.139) (-1087.910) * (-1088.548) (-1092.851) [-1087.578] (-1088.270) -- 0:00:35
      440000 -- [-1088.055] (-1089.518) (-1087.423) (-1087.730) * [-1089.519] (-1094.532) (-1089.607) (-1088.451) -- 0:00:35

      Average standard deviation of split frequencies: 0.014406

      440500 -- (-1088.736) (-1087.531) [-1087.112] (-1091.008) * (-1087.295) (-1092.098) (-1089.834) [-1093.001] -- 0:00:35
      441000 -- (-1092.559) [-1085.972] (-1086.542) (-1088.351) * (-1086.269) (-1090.621) (-1089.646) [-1088.195] -- 0:00:35
      441500 -- (-1088.119) (-1087.256) (-1089.742) [-1087.938] * (-1086.677) (-1088.603) (-1088.228) [-1089.669] -- 0:00:35
      442000 -- (-1087.319) [-1086.775] (-1088.937) (-1090.430) * [-1085.966] (-1090.776) (-1086.653) (-1089.880) -- 0:00:35
      442500 -- (-1088.210) (-1086.261) [-1089.596] (-1087.305) * (-1088.774) [-1088.233] (-1090.384) (-1087.671) -- 0:00:35
      443000 -- (-1087.699) [-1085.851] (-1088.396) (-1087.813) * (-1089.521) [-1088.882] (-1090.422) (-1087.888) -- 0:00:35
      443500 -- (-1086.685) [-1086.937] (-1089.019) (-1087.835) * (-1090.551) [-1087.578] (-1090.236) (-1086.538) -- 0:00:35
      444000 -- (-1086.539) (-1087.869) [-1087.288] (-1086.394) * (-1087.977) [-1087.988] (-1087.896) (-1088.220) -- 0:00:35
      444500 -- (-1086.653) (-1089.969) [-1085.967] (-1091.616) * (-1087.793) (-1087.391) [-1086.321] (-1088.907) -- 0:00:34
      445000 -- [-1086.549] (-1091.271) (-1086.642) (-1092.316) * (-1089.474) (-1088.711) [-1085.578] (-1087.334) -- 0:00:34

      Average standard deviation of split frequencies: 0.013529

      445500 -- (-1089.808) [-1088.942] (-1087.786) (-1087.105) * (-1088.072) (-1086.904) [-1086.539] (-1087.264) -- 0:00:34
      446000 -- (-1088.759) (-1087.729) (-1093.843) [-1087.713] * (-1086.036) (-1090.671) (-1087.215) [-1087.889] -- 0:00:34
      446500 -- [-1092.523] (-1090.449) (-1088.689) (-1089.859) * [-1086.130] (-1086.267) (-1087.199) (-1090.539) -- 0:00:35
      447000 -- [-1086.057] (-1086.648) (-1089.155) (-1087.694) * [-1086.652] (-1085.735) (-1087.088) (-1087.747) -- 0:00:35
      447500 -- (-1085.890) (-1087.385) (-1091.819) [-1087.681] * [-1091.378] (-1086.073) (-1087.172) (-1089.302) -- 0:00:35
      448000 -- [-1087.186] (-1087.775) (-1092.138) (-1088.240) * (-1087.069) (-1088.677) (-1087.254) [-1087.608] -- 0:00:35
      448500 -- (-1086.591) (-1087.806) (-1095.566) [-1088.657] * [-1087.032] (-1086.288) (-1087.917) (-1089.913) -- 0:00:35
      449000 -- (-1088.699) (-1090.658) [-1088.561] (-1088.663) * (-1086.539) [-1086.277] (-1086.913) (-1093.726) -- 0:00:35
      449500 -- (-1087.908) [-1089.762] (-1086.959) (-1086.599) * (-1086.366) (-1086.936) (-1087.010) [-1089.158] -- 0:00:35
      450000 -- [-1086.754] (-1093.249) (-1085.528) (-1087.965) * (-1087.159) [-1086.187] (-1089.054) (-1087.803) -- 0:00:35

      Average standard deviation of split frequencies: 0.013141

      450500 -- (-1087.936) (-1088.123) (-1087.297) [-1086.203] * [-1086.603] (-1090.329) (-1089.015) (-1088.205) -- 0:00:35
      451000 -- (-1085.831) [-1086.081] (-1087.274) (-1085.481) * (-1086.532) [-1087.154] (-1087.562) (-1087.185) -- 0:00:35
      451500 -- (-1085.475) (-1088.592) [-1088.497] (-1086.594) * [-1086.628] (-1090.912) (-1088.581) (-1087.167) -- 0:00:35
      452000 -- (-1085.755) (-1088.468) (-1087.207) [-1087.423] * (-1086.924) (-1086.453) [-1088.221] (-1087.373) -- 0:00:35
      452500 -- [-1087.734] (-1089.396) (-1087.420) (-1087.510) * (-1087.096) (-1087.477) [-1088.161] (-1088.457) -- 0:00:35
      453000 -- (-1086.944) [-1086.615] (-1086.754) (-1090.100) * (-1090.346) (-1086.855) [-1087.913] (-1087.351) -- 0:00:35
      453500 -- (-1090.275) (-1086.547) (-1086.894) [-1095.229] * (-1085.582) [-1088.603] (-1087.223) (-1086.373) -- 0:00:34
      454000 -- (-1089.091) (-1087.382) [-1089.032] (-1090.072) * (-1086.790) [-1087.442] (-1085.920) (-1086.294) -- 0:00:34
      454500 -- (-1087.725) [-1087.033] (-1087.616) (-1091.752) * (-1085.803) [-1088.425] (-1088.062) (-1086.671) -- 0:00:34
      455000 -- (-1089.572) [-1087.334] (-1088.116) (-1092.561) * (-1091.554) (-1089.016) (-1086.021) [-1088.719] -- 0:00:34

      Average standard deviation of split frequencies: 0.013375

      455500 -- (-1089.951) (-1087.710) [-1088.119] (-1089.134) * (-1087.576) (-1089.690) [-1086.944] (-1088.284) -- 0:00:34
      456000 -- [-1087.603] (-1089.935) (-1088.919) (-1087.062) * [-1087.316] (-1086.732) (-1088.628) (-1088.446) -- 0:00:34
      456500 -- (-1088.008) (-1087.996) (-1090.107) [-1087.711] * [-1087.393] (-1087.300) (-1086.549) (-1086.985) -- 0:00:34
      457000 -- [-1086.277] (-1086.827) (-1087.286) (-1090.069) * (-1086.119) (-1088.998) [-1089.400] (-1087.807) -- 0:00:34
      457500 -- [-1086.407] (-1086.776) (-1087.102) (-1092.243) * [-1087.174] (-1087.574) (-1088.590) (-1086.268) -- 0:00:34
      458000 -- (-1090.716) (-1087.689) [-1086.892] (-1087.942) * (-1087.356) [-1087.466] (-1089.789) (-1086.232) -- 0:00:34
      458500 -- (-1088.307) (-1089.458) (-1089.250) [-1088.428] * (-1088.229) (-1086.823) (-1090.584) [-1086.739] -- 0:00:34
      459000 -- (-1088.295) [-1086.304] (-1089.783) (-1088.184) * (-1089.246) (-1086.439) (-1087.124) [-1088.062] -- 0:00:34
      459500 -- (-1087.972) (-1086.810) (-1086.157) [-1087.359] * (-1087.666) (-1086.505) (-1086.786) [-1087.778] -- 0:00:34
      460000 -- [-1088.860] (-1087.321) (-1086.957) (-1087.175) * (-1086.043) [-1085.644] (-1086.401) (-1089.296) -- 0:00:34

      Average standard deviation of split frequencies: 0.013879

      460500 -- (-1088.216) [-1087.888] (-1087.456) (-1086.354) * [-1087.474] (-1086.584) (-1086.821) (-1091.369) -- 0:00:33
      461000 -- [-1086.925] (-1091.149) (-1088.834) (-1086.929) * (-1086.328) (-1086.450) [-1087.635] (-1085.388) -- 0:00:33
      461500 -- (-1091.193) [-1089.477] (-1089.338) (-1087.229) * (-1087.706) (-1087.498) (-1086.272) [-1086.189] -- 0:00:33
      462000 -- (-1087.169) (-1090.866) (-1087.215) [-1089.161] * [-1088.092] (-1085.705) (-1085.428) (-1086.788) -- 0:00:33
      462500 -- (-1091.707) (-1091.001) (-1088.952) [-1088.269] * [-1088.482] (-1086.148) (-1088.757) (-1086.731) -- 0:00:34
      463000 -- (-1088.361) (-1091.013) [-1088.774] (-1087.862) * [-1087.415] (-1087.635) (-1087.893) (-1087.557) -- 0:00:34
      463500 -- (-1089.495) (-1091.533) (-1088.340) [-1092.329] * [-1090.207] (-1089.222) (-1087.778) (-1086.158) -- 0:00:34
      464000 -- (-1088.538) (-1092.142) (-1089.137) [-1090.019] * [-1089.466] (-1089.488) (-1087.300) (-1088.485) -- 0:00:34
      464500 -- (-1088.691) (-1087.952) (-1086.028) [-1090.992] * (-1094.683) (-1089.079) (-1086.448) [-1089.644] -- 0:00:34
      465000 -- (-1086.752) (-1089.209) [-1088.243] (-1089.689) * (-1096.269) [-1088.514] (-1086.674) (-1087.489) -- 0:00:34

      Average standard deviation of split frequencies: 0.014731

      465500 -- (-1089.335) (-1086.754) (-1087.766) [-1086.243] * [-1086.622] (-1089.791) (-1087.572) (-1087.188) -- 0:00:34
      466000 -- (-1087.863) (-1088.978) [-1089.860] (-1087.835) * (-1091.330) (-1090.320) [-1086.452] (-1087.193) -- 0:00:34
      466500 -- (-1091.765) (-1088.078) (-1089.366) [-1088.150] * (-1089.880) (-1088.845) [-1086.917] (-1088.517) -- 0:00:34
      467000 -- [-1090.967] (-1087.687) (-1089.119) (-1088.895) * (-1088.088) [-1087.883] (-1086.663) (-1088.135) -- 0:00:34
      467500 -- (-1087.076) (-1087.575) [-1088.556] (-1088.883) * (-1085.700) [-1090.298] (-1087.019) (-1085.449) -- 0:00:34
      468000 -- (-1088.681) [-1086.638] (-1092.122) (-1086.445) * (-1091.104) (-1087.286) [-1086.535] (-1086.097) -- 0:00:34
      468500 -- (-1091.464) [-1086.773] (-1093.212) (-1088.578) * (-1095.276) [-1090.073] (-1090.157) (-1086.152) -- 0:00:34
      469000 -- (-1092.712) (-1087.734) (-1089.690) [-1090.087] * [-1090.289] (-1087.604) (-1088.766) (-1085.621) -- 0:00:33
      469500 -- (-1092.454) (-1086.631) [-1088.207] (-1088.611) * (-1087.605) [-1087.635] (-1092.022) (-1088.035) -- 0:00:33
      470000 -- (-1088.432) (-1087.341) [-1085.744] (-1089.350) * [-1092.150] (-1086.688) (-1090.989) (-1088.287) -- 0:00:33

      Average standard deviation of split frequencies: 0.014147

      470500 -- [-1088.654] (-1086.166) (-1088.232) (-1090.910) * [-1089.933] (-1088.373) (-1087.024) (-1087.846) -- 0:00:33
      471000 -- (-1088.921) (-1085.923) (-1087.984) [-1089.977] * (-1091.840) (-1087.819) (-1087.377) [-1088.117] -- 0:00:33
      471500 -- [-1085.965] (-1086.635) (-1086.655) (-1086.749) * (-1086.868) (-1090.148) [-1088.096] (-1088.220) -- 0:00:33
      472000 -- (-1087.464) (-1086.758) (-1087.128) [-1088.718] * [-1086.898] (-1088.231) (-1086.827) (-1089.843) -- 0:00:33
      472500 -- (-1086.284) (-1087.067) [-1087.128] (-1088.465) * [-1086.969] (-1088.287) (-1085.690) (-1086.364) -- 0:00:33
      473000 -- [-1085.945] (-1088.053) (-1088.890) (-1087.738) * (-1088.594) (-1090.734) [-1086.760] (-1087.587) -- 0:00:33
      473500 -- (-1086.006) [-1086.703] (-1088.453) (-1087.581) * (-1088.276) [-1089.246] (-1086.684) (-1089.954) -- 0:00:33
      474000 -- (-1087.408) [-1088.000] (-1087.543) (-1088.380) * [-1086.954] (-1088.381) (-1087.155) (-1089.204) -- 0:00:33
      474500 -- (-1087.841) (-1089.102) (-1088.031) [-1087.885] * (-1087.897) [-1088.377] (-1085.988) (-1087.302) -- 0:00:33
      475000 -- (-1087.880) (-1087.254) (-1089.084) [-1092.734] * (-1087.050) (-1089.007) [-1087.134] (-1088.451) -- 0:00:33

      Average standard deviation of split frequencies: 0.014236

      475500 -- [-1087.136] (-1087.870) (-1085.424) (-1087.899) * (-1087.070) (-1091.669) [-1085.558] (-1092.492) -- 0:00:33
      476000 -- (-1087.136) [-1086.951] (-1091.211) (-1087.681) * (-1087.213) (-1089.820) (-1085.851) [-1086.661] -- 0:00:33
      476500 -- [-1087.742] (-1089.449) (-1091.585) (-1086.357) * [-1085.753] (-1091.094) (-1088.205) (-1088.241) -- 0:00:32
      477000 -- (-1090.104) (-1087.980) (-1089.798) [-1085.793] * (-1085.864) (-1089.190) (-1088.040) [-1087.796] -- 0:00:32
      477500 -- (-1086.771) (-1087.314) [-1095.634] (-1087.395) * (-1089.358) (-1086.189) [-1086.217] (-1087.749) -- 0:00:32
      478000 -- (-1086.198) (-1086.227) (-1088.957) [-1088.302] * (-1090.497) (-1088.795) [-1086.226] (-1088.279) -- 0:00:33
      478500 -- [-1086.699] (-1086.577) (-1090.440) (-1092.398) * [-1088.391] (-1087.870) (-1089.388) (-1086.189) -- 0:00:33
      479000 -- (-1094.021) (-1086.996) [-1088.734] (-1091.054) * [-1087.464] (-1088.367) (-1086.265) (-1088.375) -- 0:00:33
      479500 -- (-1086.555) [-1086.987] (-1088.604) (-1088.056) * (-1088.581) [-1087.418] (-1085.706) (-1086.772) -- 0:00:33
      480000 -- (-1087.100) (-1087.493) (-1088.011) [-1088.117] * (-1086.689) (-1086.425) [-1090.517] (-1086.372) -- 0:00:33

      Average standard deviation of split frequencies: 0.014527

      480500 -- (-1087.125) (-1087.077) [-1092.912] (-1087.853) * (-1089.530) (-1094.642) [-1087.226] (-1086.436) -- 0:00:33
      481000 -- (-1086.387) (-1087.613) (-1088.605) [-1086.842] * (-1088.520) (-1088.977) (-1088.784) [-1086.558] -- 0:00:33
      481500 -- (-1086.784) (-1090.942) [-1092.952] (-1085.940) * (-1088.544) [-1087.834] (-1087.454) (-1089.462) -- 0:00:33
      482000 -- [-1088.635] (-1086.691) (-1086.912) (-1087.553) * (-1086.356) [-1087.122] (-1088.565) (-1087.062) -- 0:00:33
      482500 -- (-1085.694) (-1090.772) (-1087.507) [-1093.099] * (-1087.393) (-1088.987) (-1088.116) [-1087.754] -- 0:00:33
      483000 -- (-1085.694) [-1089.008] (-1086.479) (-1091.734) * (-1085.822) (-1087.393) (-1089.620) [-1087.079] -- 0:00:33
      483500 -- (-1086.702) (-1086.928) [-1088.052] (-1087.136) * (-1092.679) [-1086.562] (-1086.442) (-1085.553) -- 0:00:33
      484000 -- (-1090.993) (-1086.036) [-1086.450] (-1087.723) * (-1092.665) [-1086.892] (-1087.644) (-1087.827) -- 0:00:33
      484500 -- (-1089.951) [-1087.019] (-1085.846) (-1088.522) * (-1089.497) (-1086.865) (-1086.197) [-1089.346] -- 0:00:32
      485000 -- (-1088.164) (-1086.778) [-1085.496] (-1087.876) * (-1087.382) (-1088.182) [-1090.048] (-1092.240) -- 0:00:32

      Average standard deviation of split frequencies: 0.015006

      485500 -- (-1087.404) (-1087.235) [-1088.533] (-1086.939) * [-1087.210] (-1087.226) (-1091.350) (-1089.142) -- 0:00:32
      486000 -- (-1087.499) (-1087.256) (-1087.789) [-1087.321] * (-1087.530) (-1086.658) (-1087.542) [-1089.697] -- 0:00:32
      486500 -- [-1086.977] (-1086.068) (-1086.778) (-1087.714) * [-1088.783] (-1086.887) (-1085.702) (-1089.637) -- 0:00:32
      487000 -- [-1087.102] (-1086.690) (-1093.230) (-1088.126) * (-1090.660) (-1089.780) [-1086.320] (-1088.907) -- 0:00:32
      487500 -- (-1087.729) [-1088.499] (-1088.785) (-1087.557) * (-1088.131) (-1090.466) [-1086.708] (-1087.050) -- 0:00:32
      488000 -- [-1088.136] (-1091.477) (-1087.581) (-1089.429) * (-1091.283) (-1087.439) (-1086.102) [-1086.180] -- 0:00:32
      488500 -- (-1088.585) (-1089.160) (-1086.086) [-1087.267] * [-1089.600] (-1087.061) (-1086.755) (-1086.195) -- 0:00:32
      489000 -- [-1088.248] (-1089.472) (-1088.409) (-1087.412) * (-1087.106) (-1086.394) (-1090.273) [-1086.841] -- 0:00:32
      489500 -- (-1088.559) [-1088.883] (-1090.612) (-1087.276) * (-1087.443) (-1086.584) (-1092.914) [-1086.551] -- 0:00:32
      490000 -- (-1087.556) [-1087.011] (-1091.300) (-1086.936) * [-1086.078] (-1086.261) (-1092.862) (-1087.001) -- 0:00:32

      Average standard deviation of split frequencies: 0.015202

      490500 -- (-1089.088) (-1085.553) [-1087.305] (-1088.060) * [-1087.709] (-1087.367) (-1089.486) (-1087.533) -- 0:00:32
      491000 -- [-1087.847] (-1086.997) (-1087.204) (-1087.941) * (-1087.107) [-1087.984] (-1087.399) (-1089.142) -- 0:00:32
      491500 -- (-1087.396) [-1088.681] (-1087.522) (-1087.941) * (-1087.638) [-1087.418] (-1086.925) (-1086.015) -- 0:00:32
      492000 -- (-1090.900) (-1088.094) (-1086.553) [-1086.366] * (-1088.688) (-1087.241) (-1086.931) [-1087.342] -- 0:00:32
      492500 -- (-1086.636) [-1088.270] (-1087.779) (-1086.087) * (-1089.382) (-1088.608) (-1090.304) [-1086.772] -- 0:00:31
      493000 -- (-1085.853) [-1088.157] (-1088.445) (-1087.872) * [-1086.925] (-1087.132) (-1087.496) (-1086.380) -- 0:00:31
      493500 -- (-1085.378) [-1088.619] (-1087.769) (-1086.472) * [-1089.147] (-1087.764) (-1087.135) (-1088.106) -- 0:00:31
      494000 -- (-1085.965) (-1087.382) [-1085.665] (-1086.709) * [-1087.290] (-1086.850) (-1087.219) (-1086.133) -- 0:00:32
      494500 -- [-1088.589] (-1086.090) (-1086.814) (-1088.569) * (-1089.701) (-1086.635) (-1088.007) [-1087.964] -- 0:00:32
      495000 -- (-1090.959) (-1085.791) [-1089.157] (-1086.751) * [-1090.368] (-1089.591) (-1092.382) (-1089.788) -- 0:00:32

      Average standard deviation of split frequencies: 0.014759

      495500 -- (-1089.703) [-1085.791] (-1086.284) (-1086.784) * (-1090.133) [-1089.449] (-1087.191) (-1089.884) -- 0:00:32
      496000 -- (-1093.112) (-1085.686) [-1087.054] (-1087.681) * (-1092.380) (-1086.551) [-1086.666] (-1089.823) -- 0:00:32
      496500 -- [-1086.192] (-1087.460) (-1090.288) (-1088.474) * (-1093.379) (-1089.931) [-1087.116] (-1087.489) -- 0:00:32
      497000 -- (-1087.154) (-1088.272) [-1087.314] (-1088.891) * (-1088.046) (-1091.019) (-1086.968) [-1086.329] -- 0:00:32
      497500 -- (-1086.824) (-1086.804) [-1088.280] (-1087.690) * (-1087.862) (-1088.928) (-1089.210) [-1086.364] -- 0:00:32
      498000 -- [-1086.824] (-1087.940) (-1086.659) (-1086.614) * (-1089.691) (-1087.979) [-1089.809] (-1086.029) -- 0:00:32
      498500 -- (-1086.215) [-1086.981] (-1087.696) (-1088.881) * (-1089.727) (-1090.646) [-1088.901] (-1086.525) -- 0:00:32
      499000 -- [-1085.505] (-1087.562) (-1086.976) (-1086.737) * (-1089.348) (-1091.895) [-1088.151] (-1087.878) -- 0:00:32
      499500 -- [-1086.707] (-1087.232) (-1090.895) (-1088.149) * (-1089.206) (-1086.910) [-1085.775] (-1089.898) -- 0:00:32
      500000 -- (-1086.606) [-1085.860] (-1087.693) (-1089.154) * (-1089.263) (-1087.313) [-1085.572] (-1091.666) -- 0:00:32

      Average standard deviation of split frequencies: 0.015342

      500500 -- (-1086.552) (-1085.859) (-1087.374) [-1088.806] * (-1087.152) (-1091.504) (-1087.213) [-1088.018] -- 0:00:31
      501000 -- (-1086.758) (-1088.296) (-1088.587) [-1086.182] * [-1087.909] (-1087.044) (-1087.933) (-1090.580) -- 0:00:31
      501500 -- (-1087.831) [-1087.171] (-1090.605) (-1087.895) * (-1089.922) (-1088.558) (-1086.591) [-1087.225] -- 0:00:31
      502000 -- (-1088.915) [-1088.494] (-1089.112) (-1089.476) * (-1086.602) (-1087.641) (-1087.137) [-1086.939] -- 0:00:31
      502500 -- (-1089.082) (-1087.633) [-1087.727] (-1090.691) * (-1085.605) (-1086.149) (-1086.230) [-1087.501] -- 0:00:31
      503000 -- (-1087.361) (-1088.786) (-1090.110) [-1088.451] * [-1085.874] (-1086.949) (-1087.562) (-1087.179) -- 0:00:31
      503500 -- (-1091.466) (-1087.141) (-1088.478) [-1089.518] * [-1086.680] (-1086.433) (-1087.181) (-1093.424) -- 0:00:31
      504000 -- (-1087.885) (-1090.621) (-1086.081) [-1088.848] * [-1086.364] (-1087.403) (-1088.112) (-1094.756) -- 0:00:31
      504500 -- [-1087.923] (-1088.755) (-1087.283) (-1087.082) * (-1089.190) (-1088.323) [-1085.776] (-1089.736) -- 0:00:31
      505000 -- [-1086.742] (-1088.247) (-1087.881) (-1086.672) * (-1087.593) (-1088.331) (-1086.538) [-1088.038] -- 0:00:31

      Average standard deviation of split frequencies: 0.014742

      505500 -- (-1086.991) (-1088.765) (-1095.040) [-1086.576] * (-1085.944) (-1088.518) (-1088.077) [-1090.891] -- 0:00:31
      506000 -- (-1087.083) [-1086.870] (-1090.403) (-1088.130) * (-1091.710) (-1090.967) [-1087.254] (-1091.055) -- 0:00:31
      506500 -- (-1087.482) (-1087.995) [-1087.649] (-1089.446) * (-1090.141) [-1089.289] (-1087.909) (-1088.570) -- 0:00:31
      507000 -- (-1087.603) (-1087.265) (-1090.026) [-1093.707] * (-1088.083) [-1093.647] (-1088.378) (-1092.163) -- 0:00:31
      507500 -- (-1086.424) [-1087.397] (-1087.799) (-1088.454) * (-1088.475) (-1089.941) [-1088.694] (-1088.487) -- 0:00:31
      508000 -- (-1086.956) [-1087.687] (-1089.891) (-1088.895) * [-1088.988] (-1090.543) (-1089.562) (-1088.016) -- 0:00:30
      508500 -- (-1086.105) (-1087.267) [-1087.723] (-1089.278) * [-1089.626] (-1089.119) (-1086.513) (-1088.215) -- 0:00:30
      509000 -- (-1086.460) (-1088.506) [-1087.086] (-1088.296) * (-1089.363) (-1088.474) [-1087.015] (-1092.709) -- 0:00:31
      509500 -- [-1085.702] (-1087.042) (-1086.401) (-1088.679) * (-1088.756) (-1087.172) (-1087.226) [-1087.926] -- 0:00:31
      510000 -- (-1086.467) (-1090.100) [-1088.008] (-1094.709) * (-1086.141) (-1090.315) [-1088.772] (-1089.635) -- 0:00:31

      Average standard deviation of split frequencies: 0.014553

      510500 -- (-1087.511) (-1088.836) (-1087.506) [-1088.240] * (-1085.604) [-1089.286] (-1091.943) (-1087.428) -- 0:00:31
      511000 -- [-1086.483] (-1088.779) (-1088.417) (-1085.952) * [-1087.894] (-1090.046) (-1093.852) (-1086.703) -- 0:00:31
      511500 -- (-1091.357) (-1088.926) [-1088.994] (-1087.345) * (-1086.008) (-1094.596) (-1088.442) [-1087.316] -- 0:00:31
      512000 -- (-1087.968) (-1086.068) [-1088.808] (-1088.127) * [-1085.706] (-1092.146) (-1092.145) (-1085.728) -- 0:00:31
      512500 -- (-1089.311) (-1091.500) (-1090.080) [-1085.655] * (-1087.000) [-1088.968] (-1088.073) (-1086.461) -- 0:00:31
      513000 -- (-1090.052) [-1086.712] (-1089.734) (-1086.735) * [-1087.228] (-1087.165) (-1089.692) (-1088.099) -- 0:00:31
      513500 -- [-1087.217] (-1087.756) (-1086.838) (-1086.905) * [-1087.274] (-1087.367) (-1087.981) (-1087.309) -- 0:00:31
      514000 -- (-1087.200) [-1086.409] (-1087.989) (-1087.533) * (-1089.006) (-1087.905) (-1088.116) [-1087.031] -- 0:00:31
      514500 -- (-1087.450) (-1087.962) [-1087.917] (-1089.300) * (-1088.917) (-1087.170) (-1090.313) [-1088.824] -- 0:00:31
      515000 -- (-1086.896) [-1087.784] (-1086.653) (-1087.692) * (-1087.888) (-1087.901) [-1088.780] (-1089.794) -- 0:00:31

      Average standard deviation of split frequencies: 0.014671

      515500 -- (-1085.646) [-1086.619] (-1087.086) (-1091.567) * [-1086.473] (-1092.061) (-1086.804) (-1088.325) -- 0:00:31
      516000 -- (-1088.520) (-1088.736) (-1088.597) [-1090.751] * (-1087.889) (-1086.966) (-1085.576) [-1087.779] -- 0:00:30
      516500 -- (-1087.682) (-1090.266) (-1087.149) [-1087.768] * (-1089.158) [-1090.146] (-1088.079) (-1087.754) -- 0:00:30
      517000 -- (-1089.792) (-1086.086) (-1086.726) [-1087.637] * (-1087.382) (-1088.268) (-1086.291) [-1090.779] -- 0:00:30
      517500 -- (-1087.928) [-1086.106] (-1089.139) (-1088.241) * [-1089.840] (-1090.713) (-1086.205) (-1089.077) -- 0:00:30
      518000 -- [-1087.739] (-1091.436) (-1090.445) (-1091.278) * (-1089.829) (-1087.284) (-1088.769) [-1086.871] -- 0:00:30
      518500 -- (-1087.458) (-1086.185) (-1089.988) [-1086.760] * [-1089.956] (-1088.493) (-1090.060) (-1090.681) -- 0:00:30
      519000 -- [-1087.227] (-1087.718) (-1089.322) (-1088.180) * (-1086.731) (-1090.537) (-1088.157) [-1090.724] -- 0:00:30
      519500 -- (-1085.818) (-1086.095) [-1089.218] (-1087.181) * (-1087.126) (-1092.546) [-1085.661] (-1087.790) -- 0:00:30
      520000 -- (-1086.201) (-1086.156) (-1087.760) [-1088.601] * [-1091.221] (-1086.264) (-1087.051) (-1085.861) -- 0:00:30

      Average standard deviation of split frequencies: 0.015818

      520500 -- [-1086.461] (-1085.851) (-1089.873) (-1093.020) * (-1086.307) [-1087.099] (-1086.568) (-1085.964) -- 0:00:30
      521000 -- (-1086.293) [-1085.504] (-1094.176) (-1085.880) * [-1087.013] (-1086.423) (-1088.638) (-1085.587) -- 0:00:30
      521500 -- (-1087.197) (-1086.632) (-1089.002) [-1085.732] * (-1091.371) [-1088.564] (-1088.076) (-1090.855) -- 0:00:30
      522000 -- [-1086.263] (-1087.090) (-1088.911) (-1086.199) * (-1087.429) (-1088.682) (-1088.012) [-1091.179] -- 0:00:30
      522500 -- [-1086.442] (-1090.971) (-1087.368) (-1086.808) * (-1087.924) (-1089.075) [-1089.004] (-1087.644) -- 0:00:30
      523000 -- (-1090.416) [-1088.326] (-1092.109) (-1087.339) * (-1088.172) (-1088.229) [-1091.346] (-1087.530) -- 0:00:30
      523500 -- (-1088.593) [-1088.220] (-1089.305) (-1087.908) * (-1088.542) [-1090.117] (-1086.318) (-1086.503) -- 0:00:30
      524000 -- (-1090.710) (-1086.727) (-1087.439) [-1089.092] * (-1089.015) [-1089.355] (-1086.755) (-1089.088) -- 0:00:30
      524500 -- (-1087.227) (-1086.519) [-1088.161] (-1087.294) * (-1087.110) (-1086.955) (-1086.668) [-1089.148] -- 0:00:30
      525000 -- [-1087.792] (-1087.641) (-1091.107) (-1086.772) * (-1088.145) (-1087.839) (-1087.268) [-1087.593] -- 0:00:30

      Average standard deviation of split frequencies: 0.015605

      525500 -- (-1090.046) [-1087.931] (-1090.913) (-1087.738) * (-1088.891) [-1087.235] (-1086.964) (-1086.803) -- 0:00:30
      526000 -- [-1085.952] (-1086.121) (-1088.534) (-1089.985) * (-1087.228) [-1086.293] (-1089.356) (-1088.687) -- 0:00:30
      526500 -- (-1086.892) [-1088.709] (-1087.299) (-1088.400) * [-1087.801] (-1086.743) (-1087.259) (-1088.864) -- 0:00:30
      527000 -- [-1088.778] (-1089.008) (-1087.042) (-1087.977) * [-1086.751] (-1088.234) (-1086.402) (-1086.869) -- 0:00:30
      527500 -- (-1089.620) [-1089.145] (-1086.857) (-1089.508) * [-1087.856] (-1086.986) (-1087.737) (-1090.000) -- 0:00:30
      528000 -- (-1086.754) (-1087.523) [-1087.104] (-1091.275) * (-1089.442) (-1086.930) [-1086.208] (-1089.599) -- 0:00:30
      528500 -- (-1087.408) [-1093.277] (-1095.483) (-1093.875) * (-1090.415) (-1086.668) [-1086.273] (-1086.653) -- 0:00:30
      529000 -- (-1091.293) (-1087.788) [-1089.213] (-1087.615) * (-1091.472) [-1087.829] (-1087.123) (-1086.639) -- 0:00:30
      529500 -- (-1089.553) (-1088.981) (-1087.488) [-1087.666] * [-1089.195] (-1089.556) (-1091.053) (-1087.789) -- 0:00:30
      530000 -- (-1090.120) [-1089.346] (-1088.152) (-1087.324) * (-1085.910) [-1090.429] (-1085.513) (-1089.543) -- 0:00:30

      Average standard deviation of split frequencies: 0.015154

      530500 -- (-1088.498) (-1087.430) [-1087.292] (-1091.459) * (-1087.091) [-1090.239] (-1086.850) (-1086.954) -- 0:00:30
      531000 -- (-1086.715) (-1089.686) [-1087.547] (-1086.386) * (-1086.629) (-1085.899) [-1085.888] (-1086.320) -- 0:00:30
      531500 -- (-1088.064) (-1089.560) (-1087.174) [-1086.728] * (-1086.836) [-1087.519] (-1087.673) (-1088.313) -- 0:00:29
      532000 -- (-1086.358) (-1090.156) [-1087.164] (-1087.135) * (-1086.259) [-1087.894] (-1085.992) (-1090.153) -- 0:00:29
      532500 -- (-1086.390) [-1087.787] (-1087.094) (-1087.385) * (-1088.396) (-1086.426) [-1088.164] (-1089.218) -- 0:00:29
      533000 -- (-1086.303) (-1089.996) [-1090.344] (-1087.318) * (-1086.468) (-1086.417) (-1089.689) [-1088.166] -- 0:00:29
      533500 -- (-1088.764) (-1091.643) (-1092.308) [-1088.646] * (-1087.924) [-1087.357] (-1087.505) (-1086.677) -- 0:00:29
      534000 -- (-1087.709) (-1090.991) [-1093.410] (-1089.353) * [-1091.066] (-1086.763) (-1086.012) (-1086.446) -- 0:00:29
      534500 -- [-1091.204] (-1087.216) (-1090.745) (-1087.640) * [-1087.977] (-1088.857) (-1086.149) (-1086.516) -- 0:00:29
      535000 -- [-1088.343] (-1085.667) (-1093.241) (-1092.143) * (-1086.374) (-1088.200) (-1085.570) [-1086.022] -- 0:00:29

      Average standard deviation of split frequencies: 0.015572

      535500 -- (-1091.414) [-1088.301] (-1087.579) (-1085.680) * (-1087.659) (-1087.305) (-1090.297) [-1085.751] -- 0:00:29
      536000 -- (-1087.932) (-1090.184) [-1086.491] (-1086.027) * [-1087.436] (-1086.751) (-1095.291) (-1086.131) -- 0:00:29
      536500 -- [-1089.103] (-1086.963) (-1088.576) (-1086.774) * (-1086.410) [-1088.010] (-1086.986) (-1091.120) -- 0:00:29
      537000 -- (-1087.066) [-1092.050] (-1089.057) (-1088.288) * [-1087.004] (-1089.788) (-1091.196) (-1087.130) -- 0:00:29
      537500 -- (-1086.535) [-1086.925] (-1094.024) (-1087.626) * (-1086.773) [-1085.669] (-1088.680) (-1091.351) -- 0:00:29
      538000 -- (-1091.483) [-1089.468] (-1087.411) (-1086.475) * (-1086.568) (-1088.298) (-1092.444) [-1088.013] -- 0:00:29
      538500 -- [-1091.475] (-1089.303) (-1087.249) (-1086.660) * (-1088.405) (-1086.227) [-1086.440] (-1091.199) -- 0:00:29
      539000 -- (-1086.197) (-1090.189) [-1085.508] (-1087.289) * (-1091.967) (-1092.265) (-1086.806) [-1089.791] -- 0:00:29
      539500 -- (-1087.457) (-1087.289) (-1086.391) [-1086.307] * (-1092.316) [-1086.988] (-1087.373) (-1093.344) -- 0:00:29
      540000 -- (-1087.701) (-1087.524) (-1092.355) [-1087.443] * (-1087.456) [-1089.494] (-1086.916) (-1090.002) -- 0:00:29

      Average standard deviation of split frequencies: 0.014822

      540500 -- [-1087.701] (-1086.627) (-1086.330) (-1088.274) * (-1086.761) (-1089.198) (-1085.944) [-1089.794] -- 0:00:29
      541000 -- (-1088.386) (-1089.662) (-1086.081) [-1088.266] * (-1087.780) (-1087.675) [-1088.154] (-1086.943) -- 0:00:29
      541500 -- (-1092.646) [-1091.132] (-1086.447) (-1088.729) * (-1087.476) (-1087.708) [-1086.394] (-1087.349) -- 0:00:29
      542000 -- [-1087.307] (-1088.188) (-1088.520) (-1085.971) * (-1086.522) (-1086.978) [-1089.721] (-1088.399) -- 0:00:29
      542500 -- (-1091.711) [-1086.031] (-1091.911) (-1089.494) * (-1086.264) (-1088.818) (-1087.394) [-1086.637] -- 0:00:29
      543000 -- (-1086.369) (-1089.387) [-1086.167] (-1089.873) * [-1087.524] (-1087.535) (-1086.431) (-1089.137) -- 0:00:29
      543500 -- [-1089.127] (-1092.298) (-1086.171) (-1087.153) * (-1085.927) (-1088.399) (-1086.656) [-1087.564] -- 0:00:29
      544000 -- [-1090.119] (-1087.056) (-1089.223) (-1090.329) * (-1087.058) (-1088.819) (-1088.077) [-1088.973] -- 0:00:29
      544500 -- (-1088.083) [-1086.710] (-1086.811) (-1090.055) * (-1086.276) (-1089.736) [-1086.009] (-1090.712) -- 0:00:29
      545000 -- (-1093.730) [-1086.832] (-1086.909) (-1087.789) * (-1088.632) (-1091.398) (-1087.350) [-1092.688] -- 0:00:29

      Average standard deviation of split f