--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:20:27 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2478/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -535.67 -538.64
2 -535.72 -539.24
--------------------------------------
TOTAL -535.69 -538.98
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896053 0.090552 0.360335 1.494300 0.868409 1314.29 1351.17 1.000
r(A<->C){all} 0.171040 0.019947 0.000065 0.447475 0.135613 233.67 239.26 1.003
r(A<->G){all} 0.151108 0.018243 0.000028 0.423418 0.111958 226.43 241.93 1.000
r(A<->T){all} 0.164610 0.021035 0.000061 0.465483 0.122809 83.05 113.25 1.000
r(C<->G){all} 0.158471 0.018340 0.000028 0.429427 0.122048 210.92 223.81 1.000
r(C<->T){all} 0.175166 0.021789 0.000053 0.475493 0.136174 121.03 178.51 1.002
r(G<->T){all} 0.179605 0.021261 0.000134 0.463568 0.143437 258.87 264.92 1.000
pi(A){all} 0.215210 0.000427 0.176581 0.257239 0.214547 1328.56 1389.42 1.000
pi(C){all} 0.245441 0.000450 0.205448 0.287506 0.245150 1178.53 1248.03 1.000
pi(G){all} 0.294122 0.000508 0.250492 0.337087 0.294359 1291.12 1347.33 1.000
pi(T){all} 0.245228 0.000457 0.204650 0.288040 0.244372 1343.10 1422.05 1.000
alpha{1,2} 0.406881 0.230279 0.000144 1.347226 0.237153 1382.28 1385.80 1.000
alpha{3} 0.457618 0.243732 0.000427 1.447678 0.297757 1320.51 1362.93 1.000
pinvar{all} 0.996003 0.000021 0.987317 0.999997 0.997468 1349.99 1425.49 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -521.373234
Model 2: PositiveSelection -521.373234
Model 0: one-ratio -521.373335
Model 7: beta -521.373234
Model 8: beta&w>1 -521.373234
Model 0 vs 1 2.0199999994474638E-4
Model 2 vs 1 0.0
Model 8 vs 7 0.0
>C1
LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
>C2
LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
>C3
LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
>C4
LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
>C5
LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
>C6
LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=129
C1 LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
C2 LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
C3 LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
C4 LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
C5 LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
C6 LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
**************************************************
C1 ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
C2 ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
C3 ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
C4 ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
C5 ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
C6 ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
**************************************************
C1 VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
C2 VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
C3 VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
C4 VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
C5 VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
C6 VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
*****************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 129 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 129 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3870]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3870]--->[3870]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.461 Mb, Max= 30.659 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
C2 LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
C3 LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
C4 LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
C5 LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
C6 LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
**************************************************
C1 ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
C2 ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
C3 ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
C4 ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
C5 ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
C6 ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
**************************************************
C1 VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
C2 VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
C3 VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
C4 VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
C5 VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
C6 VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
*****************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG
C2 TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG
C3 TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG
C4 TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG
C5 TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG
C6 TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG
**************************************************
C1 CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC
C2 CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC
C3 CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC
C4 CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC
C5 CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC
C6 CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC
**************************************************
C1 GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA
C2 GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA
C3 GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA
C4 GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA
C5 GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA
C6 GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA
**************************************************
C1 GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA
C2 GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA
C3 GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA
C4 GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA
C5 GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA
C6 GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA
**************************************************
C1 GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA
C2 GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA
C3 GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA
C4 GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA
C5 GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA
C6 GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA
**************************************************
C1 CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA
C2 CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA
C3 CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA
C4 CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA
C5 CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA
C6 CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA
**************************************************
C1 GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT
C2 GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT
C3 GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT
C4 GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT
C5 GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT
C6 GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT
**************************************************
C1 AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT
C2 AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT
C3 AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT
C4 AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT
C5 AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT
C6 AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT
*************************************
>C1
TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG
CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC
GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA
GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA
GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA
CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA
GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT
AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT
>C2
TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG
CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC
GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA
GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA
GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA
CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA
GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT
AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT
>C3
TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG
CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC
GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA
GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA
GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA
CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA
GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT
AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT
>C4
TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG
CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC
GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA
GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA
GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA
CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA
GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT
AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT
>C5
TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG
CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC
GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA
GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA
GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA
CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA
GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT
AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT
>C6
TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG
CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC
GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA
GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA
GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA
CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA
GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT
AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT
>C1
LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
>C2
LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
>C3
LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
>C4
LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
>C5
LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
>C6
LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 387 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579857550
Setting output file names to "/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 2128768710
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5707461345
Seed = 1934302262
Swapseed = 1579857550
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -866.124551 -- -24.965149
Chain 2 -- -866.124551 -- -24.965149
Chain 3 -- -866.124551 -- -24.965149
Chain 4 -- -866.124551 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -866.124551 -- -24.965149
Chain 2 -- -866.124501 -- -24.965149
Chain 3 -- -866.124551 -- -24.965149
Chain 4 -- -866.124551 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-866.125] (-866.125) (-866.125) (-866.125) * [-866.125] (-866.125) (-866.125) (-866.125)
500 -- [-549.883] (-549.316) (-544.809) (-540.723) * (-556.408) [-552.530] (-549.462) (-543.797) -- 0:00:00
1000 -- (-549.982) (-544.813) (-545.840) [-538.140] * (-542.941) [-545.199] (-548.272) (-552.879) -- 0:00:00
1500 -- (-547.057) (-544.162) (-543.832) [-546.086] * (-546.278) (-545.995) [-539.405] (-545.019) -- 0:00:00
2000 -- (-543.590) (-551.191) (-543.476) [-536.959] * (-548.258) [-543.829] (-548.217) (-555.642) -- 0:00:00
2500 -- (-550.739) (-542.992) [-544.340] (-548.440) * [-551.527] (-545.706) (-546.565) (-542.834) -- 0:00:00
3000 -- (-543.022) [-544.841] (-547.887) (-553.164) * (-545.674) (-552.535) [-541.679] (-545.308) -- 0:00:00
3500 -- (-547.830) (-549.140) (-546.990) [-544.310] * (-542.671) [-551.443] (-546.665) (-552.190) -- 0:00:00
4000 -- (-546.459) [-542.005] (-545.573) (-550.575) * (-547.626) [-548.644] (-541.857) (-542.333) -- 0:00:00
4500 -- [-542.749] (-544.385) (-545.164) (-551.525) * (-552.241) (-544.809) (-546.367) [-543.845] -- 0:00:00
5000 -- (-546.556) (-550.365) [-547.027] (-553.641) * (-539.705) [-539.453] (-547.559) (-546.732) -- 0:00:00
Average standard deviation of split frequencies: 0.065473
5500 -- (-542.368) [-546.414] (-547.104) (-546.077) * [-544.768] (-544.579) (-546.041) (-549.833) -- 0:03:00
6000 -- (-543.966) (-547.987) [-547.451] (-544.893) * (-551.960) [-548.418] (-542.630) (-547.010) -- 0:02:45
6500 -- (-547.007) (-546.786) [-543.518] (-554.920) * [-541.659] (-543.914) (-545.146) (-550.471) -- 0:02:32
7000 -- (-551.728) (-547.353) (-548.105) [-544.363] * (-544.919) (-550.203) [-544.974] (-545.000) -- 0:02:21
7500 -- (-551.952) (-543.803) (-543.868) [-542.834] * (-543.994) [-542.978] (-543.057) (-553.510) -- 0:02:12
8000 -- (-546.699) [-545.227] (-541.911) (-550.066) * (-551.991) (-551.175) [-541.999] (-549.134) -- 0:02:04
8500 -- (-537.750) (-558.311) (-543.165) [-550.329] * (-550.897) (-547.924) (-544.853) [-544.615] -- 0:01:56
9000 -- (-539.730) (-541.664) (-536.135) [-547.340] * (-543.361) [-552.238] (-547.231) (-539.960) -- 0:01:50
9500 -- (-535.753) (-551.779) [-536.383] (-545.839) * [-556.755] (-544.543) (-549.087) (-542.841) -- 0:01:44
10000 -- (-535.874) (-546.481) [-538.462] (-550.454) * [-550.144] (-541.745) (-546.868) (-542.615) -- 0:01:39
Average standard deviation of split frequencies: 0.094702
10500 -- (-543.934) (-537.270) [-536.572] (-558.160) * (-552.784) (-544.293) [-544.124] (-546.890) -- 0:01:34
11000 -- [-538.119] (-536.660) (-536.869) (-543.201) * [-541.234] (-545.267) (-541.265) (-555.819) -- 0:01:29
11500 -- (-537.099) [-539.081] (-538.121) (-545.858) * (-545.379) [-544.112] (-544.314) (-556.598) -- 0:01:25
12000 -- (-536.603) (-534.522) [-537.847] (-549.710) * (-544.159) [-544.023] (-545.934) (-549.258) -- 0:01:22
12500 -- (-536.211) (-534.828) (-535.662) [-541.062] * [-549.304] (-556.522) (-550.147) (-547.132) -- 0:01:19
13000 -- (-535.953) (-535.168) (-536.121) [-538.345] * (-545.389) [-539.840] (-544.491) (-550.640) -- 0:01:15
13500 -- (-537.383) (-538.909) (-539.686) [-546.377] * (-547.208) (-545.181) (-540.624) [-550.575] -- 0:01:13
14000 -- (-534.338) (-540.022) [-534.955] (-549.271) * (-548.382) (-546.485) (-549.438) [-549.150] -- 0:01:10
14500 -- (-540.230) (-535.964) [-535.293] (-548.595) * [-542.640] (-548.260) (-539.989) (-544.058) -- 0:01:07
15000 -- (-534.642) [-536.790] (-534.694) (-553.551) * (-546.144) (-545.261) (-540.235) [-546.411] -- 0:01:05
Average standard deviation of split frequencies: 0.072882
15500 -- (-535.978) (-535.872) [-537.509] (-548.300) * (-544.350) (-545.787) [-536.260] (-545.820) -- 0:01:03
16000 -- (-538.891) [-535.909] (-535.461) (-542.673) * (-546.599) (-541.507) (-535.697) [-540.480] -- 0:01:01
16500 -- (-541.394) (-534.843) (-536.672) [-549.756] * (-544.451) (-544.706) [-539.785] (-540.313) -- 0:00:59
17000 -- (-542.769) (-536.626) (-538.682) [-549.553] * (-547.940) (-543.950) (-546.078) [-542.037] -- 0:00:57
17500 -- [-535.391] (-536.445) (-540.118) (-542.000) * (-549.154) (-553.011) (-537.212) [-540.723] -- 0:00:56
18000 -- (-534.788) (-535.644) (-543.756) [-548.212] * (-545.215) (-548.581) (-534.768) [-542.626] -- 0:00:54
18500 -- [-535.205] (-534.802) (-535.598) (-551.826) * (-556.362) (-547.966) (-536.091) [-541.011] -- 0:00:53
19000 -- (-537.200) (-535.260) [-536.701] (-544.804) * (-541.753) (-550.121) [-537.173] (-548.961) -- 0:00:51
19500 -- [-536.367] (-534.235) (-534.160) (-545.615) * (-547.746) (-552.848) [-535.763] (-542.695) -- 0:00:50
20000 -- (-535.988) (-535.174) [-536.345] (-541.532) * (-548.858) [-542.258] (-535.735) (-541.231) -- 0:00:49
Average standard deviation of split frequencies: 0.051956
20500 -- (-536.352) [-536.016] (-537.990) (-544.388) * (-544.374) [-542.927] (-536.322) (-544.061) -- 0:00:47
21000 -- (-534.749) (-536.662) (-536.367) [-543.513] * (-545.003) [-547.054] (-535.014) (-552.204) -- 0:00:46
21500 -- [-537.588] (-535.505) (-536.730) (-542.146) * (-549.116) [-541.937] (-537.213) (-543.799) -- 0:00:45
22000 -- (-535.682) (-539.261) [-535.312] (-542.685) * (-561.298) [-541.644] (-535.687) (-547.570) -- 0:01:28
22500 -- (-537.520) [-536.091] (-536.221) (-543.534) * (-543.469) (-545.252) [-537.564] (-548.034) -- 0:01:26
23000 -- (-541.112) (-535.336) [-538.662] (-549.979) * (-541.534) [-545.068] (-536.358) (-549.742) -- 0:01:24
23500 -- (-537.887) (-536.848) [-535.646] (-546.596) * (-546.119) (-551.118) (-536.795) [-544.053] -- 0:01:23
24000 -- [-537.134] (-541.014) (-536.804) (-539.755) * (-539.816) [-545.858] (-538.411) (-547.278) -- 0:01:21
24500 -- (-537.753) (-535.444) [-535.720] (-548.432) * (-548.777) [-543.602] (-538.711) (-556.771) -- 0:01:19
25000 -- (-537.197) (-535.769) (-535.414) [-542.184] * (-547.237) [-540.840] (-538.893) (-545.168) -- 0:01:18
Average standard deviation of split frequencies: 0.037125
25500 -- [-537.412] (-535.494) (-537.105) (-541.118) * (-545.146) [-542.221] (-534.745) (-542.090) -- 0:01:16
26000 -- [-535.955] (-544.498) (-537.998) (-548.870) * (-551.678) [-554.780] (-534.840) (-547.781) -- 0:01:14
26500 -- [-536.201] (-535.047) (-536.020) (-548.160) * [-545.554] (-541.682) (-535.051) (-546.646) -- 0:01:13
27000 -- (-536.338) [-534.523] (-536.198) (-541.250) * (-542.275) [-548.464] (-534.846) (-547.479) -- 0:01:12
27500 -- (-537.585) (-537.308) [-534.848] (-554.039) * (-555.700) [-547.380] (-535.246) (-544.147) -- 0:01:10
28000 -- (-541.387) (-535.854) [-535.932] (-550.425) * (-549.406) (-546.550) [-537.521] (-545.984) -- 0:01:09
28500 -- (-535.056) (-538.570) (-536.621) [-544.216] * (-552.544) [-544.153] (-535.487) (-547.337) -- 0:01:08
29000 -- [-537.675] (-539.738) (-535.944) (-541.624) * (-550.062) (-541.368) [-534.548] (-548.680) -- 0:01:06
29500 -- [-535.074] (-538.700) (-536.992) (-552.422) * (-537.925) (-542.167) (-537.795) [-543.402] -- 0:01:05
30000 -- (-535.407) (-536.353) [-534.196] (-546.155) * (-536.174) [-546.884] (-534.836) (-547.236) -- 0:01:04
Average standard deviation of split frequencies: 0.033306
30500 -- [-539.147] (-536.280) (-535.212) (-542.980) * (-537.212) [-542.337] (-536.150) (-547.111) -- 0:01:03
31000 -- (-539.112) (-537.562) (-538.900) [-542.759] * (-535.527) [-549.816] (-534.985) (-545.826) -- 0:01:02
31500 -- (-536.389) [-536.938] (-540.220) (-543.557) * [-534.826] (-548.717) (-534.706) (-542.690) -- 0:01:01
32000 -- [-534.726] (-535.530) (-535.599) (-549.491) * [-537.026] (-543.598) (-536.742) (-548.893) -- 0:01:00
32500 -- (-542.279) (-536.063) (-535.883) [-546.357] * (-535.051) (-543.530) (-535.420) [-550.020] -- 0:00:59
33000 -- (-535.137) (-535.385) [-534.743] (-554.239) * (-535.869) (-547.279) [-535.397] (-557.176) -- 0:00:58
33500 -- (-536.216) [-538.373] (-537.200) (-556.731) * (-536.547) (-543.020) [-535.372] (-545.701) -- 0:00:57
34000 -- (-536.729) (-535.879) [-536.370] (-537.447) * (-539.039) (-542.805) (-538.942) [-544.873] -- 0:00:56
34500 -- [-534.375] (-536.805) (-538.866) (-539.590) * (-536.085) [-541.379] (-536.208) (-551.797) -- 0:00:55
35000 -- (-536.902) [-536.871] (-540.530) (-536.129) * (-535.390) (-547.783) (-538.952) [-551.308] -- 0:00:55
Average standard deviation of split frequencies: 0.035149
35500 -- (-534.404) (-537.080) [-534.905] (-538.620) * (-539.150) (-546.345) (-538.328) [-543.744] -- 0:00:54
36000 -- (-536.767) (-535.566) [-537.718] (-535.351) * (-536.289) (-543.054) (-538.849) [-548.077] -- 0:00:53
36500 -- (-535.467) (-537.750) (-534.831) [-535.857] * (-536.072) (-547.999) [-535.325] (-550.392) -- 0:00:52
37000 -- (-536.032) (-539.138) [-536.965] (-542.106) * (-536.235) (-546.560) (-539.686) [-546.976] -- 0:00:52
37500 -- [-535.127] (-539.124) (-536.496) (-538.491) * (-534.961) (-546.234) (-535.566) [-548.375] -- 0:00:51
38000 -- [-535.040] (-537.415) (-538.143) (-535.362) * (-539.052) [-548.145] (-539.793) (-550.177) -- 0:00:50
38500 -- [-537.079] (-537.898) (-535.207) (-535.733) * (-536.618) (-541.909) [-538.039] (-548.327) -- 0:00:49
39000 -- (-537.092) (-538.579) [-536.048] (-536.023) * (-536.567) (-553.546) [-534.695] (-552.590) -- 0:00:49
39500 -- (-536.554) [-535.913] (-539.267) (-536.340) * (-536.557) [-538.754] (-536.835) (-543.935) -- 0:01:12
40000 -- [-536.445] (-536.491) (-535.434) (-537.319) * (-537.915) (-543.556) (-534.996) [-544.356] -- 0:01:12
Average standard deviation of split frequencies: 0.037826
40500 -- (-534.554) [-538.920] (-534.690) (-536.670) * [-537.854] (-548.852) (-535.338) (-543.791) -- 0:01:11
41000 -- (-538.366) (-538.854) (-535.860) [-538.790] * [-538.066] (-547.524) (-536.444) (-549.035) -- 0:01:10
41500 -- (-537.059) [-535.712] (-540.873) (-536.191) * (-535.109) [-543.435] (-538.876) (-545.667) -- 0:01:09
42000 -- (-538.024) [-537.454] (-538.359) (-536.761) * [-534.972] (-544.891) (-536.588) (-564.639) -- 0:01:08
42500 -- [-536.112] (-537.049) (-540.137) (-535.642) * (-535.967) (-541.100) (-536.815) [-545.359] -- 0:01:07
43000 -- [-541.050] (-537.462) (-537.739) (-538.239) * [-538.565] (-542.805) (-535.898) (-548.984) -- 0:01:06
43500 -- [-535.457] (-536.563) (-536.736) (-540.402) * (-543.626) [-541.157] (-536.969) (-544.009) -- 0:01:05
44000 -- [-536.641] (-535.120) (-536.916) (-534.810) * (-537.391) (-552.824) (-536.436) [-541.171] -- 0:01:05
44500 -- (-536.560) [-535.361] (-537.705) (-536.661) * (-539.025) (-547.534) (-536.393) [-544.285] -- 0:01:04
45000 -- (-535.014) (-540.131) (-535.591) [-535.677] * (-540.350) (-542.214) (-539.143) [-543.743] -- 0:01:03
Average standard deviation of split frequencies: 0.035355
45500 -- [-537.805] (-537.954) (-536.881) (-538.484) * [-535.983] (-553.134) (-535.078) (-543.298) -- 0:01:02
46000 -- (-537.617) [-540.600] (-536.927) (-539.437) * [-537.494] (-546.449) (-535.699) (-552.307) -- 0:01:02
46500 -- (-536.979) (-540.128) (-537.561) [-535.424] * [-541.192] (-544.098) (-534.963) (-557.136) -- 0:01:01
47000 -- [-535.384] (-536.803) (-537.284) (-534.860) * (-536.459) (-543.257) [-537.050] (-545.471) -- 0:01:00
47500 -- (-537.541) (-535.362) (-537.869) [-534.685] * (-540.391) (-543.245) [-537.902] (-543.842) -- 0:01:00
48000 -- (-538.342) (-535.177) [-534.424] (-538.671) * (-536.280) (-547.726) (-536.945) [-547.189] -- 0:00:59
48500 -- (-540.313) (-534.625) (-535.766) [-534.759] * (-537.483) (-552.716) [-536.180] (-551.161) -- 0:00:58
49000 -- (-535.971) [-536.831] (-536.097) (-536.359) * (-537.773) (-550.371) [-534.734] (-540.750) -- 0:00:58
49500 -- [-534.878] (-535.584) (-535.821) (-536.728) * (-537.809) [-540.840] (-534.531) (-543.522) -- 0:00:57
50000 -- (-536.987) (-537.100) [-536.915] (-535.049) * (-536.129) (-539.086) [-537.366] (-546.861) -- 0:00:57
Average standard deviation of split frequencies: 0.036751
50500 -- (-535.873) (-535.153) (-541.868) [-537.227] * [-535.661] (-541.721) (-539.000) (-545.110) -- 0:00:56
51000 -- [-534.952] (-539.406) (-535.937) (-535.919) * [-535.346] (-546.030) (-535.096) (-540.990) -- 0:00:55
51500 -- (-537.970) (-535.841) [-537.476] (-538.557) * (-536.281) (-548.050) (-537.558) [-544.734] -- 0:00:55
52000 -- (-537.521) [-535.786] (-540.391) (-538.469) * (-538.013) (-545.451) [-535.680] (-544.554) -- 0:00:54
52500 -- [-534.104] (-534.822) (-536.265) (-534.963) * (-535.322) (-540.237) (-537.556) [-544.821] -- 0:00:54
53000 -- (-535.651) (-535.933) (-535.459) [-536.164] * (-536.563) [-539.902] (-537.679) (-543.737) -- 0:00:53
53500 -- (-536.687) [-537.036] (-542.386) (-534.573) * (-535.728) (-545.794) (-537.388) [-554.620] -- 0:00:53
54000 -- [-539.980] (-535.652) (-541.249) (-538.446) * (-537.996) (-546.314) (-536.656) [-547.660] -- 0:00:52
54500 -- [-537.097] (-536.666) (-538.025) (-535.462) * [-536.298] (-546.300) (-537.171) (-543.541) -- 0:00:52
55000 -- (-536.203) [-538.500] (-539.330) (-535.423) * [-536.025] (-562.021) (-534.419) (-544.319) -- 0:00:51
Average standard deviation of split frequencies: 0.035355
55500 -- [-535.487] (-537.088) (-535.300) (-535.756) * (-538.437) (-551.197) [-534.747] (-539.320) -- 0:00:51
56000 -- [-536.074] (-537.121) (-541.916) (-536.701) * [-538.217] (-539.629) (-541.747) (-540.930) -- 0:00:50
56500 -- (-536.710) (-538.483) (-535.679) [-536.164] * [-534.824] (-537.075) (-538.994) (-541.962) -- 0:01:06
57000 -- (-538.192) (-540.257) (-535.408) [-535.736] * [-534.801] (-540.757) (-538.076) (-546.953) -- 0:01:06
57500 -- (-536.056) (-542.373) (-536.524) [-536.789] * (-535.843) (-537.401) (-535.512) [-544.162] -- 0:01:05
58000 -- (-538.072) [-534.766] (-539.601) (-540.976) * (-536.348) (-536.646) [-535.414] (-542.838) -- 0:01:04
58500 -- (-535.166) (-535.027) (-536.744) [-539.324] * (-534.868) (-537.660) (-537.097) [-541.218] -- 0:01:04
59000 -- (-534.826) (-534.507) (-538.275) [-536.030] * (-536.703) (-537.063) [-535.684] (-548.297) -- 0:01:03
59500 -- [-535.796] (-536.446) (-536.169) (-535.249) * (-537.003) (-535.512) [-536.062] (-542.072) -- 0:01:03
60000 -- [-535.494] (-536.846) (-534.614) (-536.961) * (-538.670) [-535.303] (-536.885) (-540.126) -- 0:01:02
Average standard deviation of split frequencies: 0.033413
60500 -- [-535.532] (-535.735) (-537.101) (-536.404) * (-535.793) (-536.715) (-537.779) [-544.364] -- 0:01:02
61000 -- (-536.494) (-536.065) (-535.598) [-535.230] * (-537.208) (-535.661) (-535.355) [-542.006] -- 0:01:01
61500 -- (-534.489) (-535.010) (-536.944) [-535.258] * (-537.942) (-535.373) (-535.553) [-546.500] -- 0:01:01
62000 -- (-535.789) (-536.043) [-536.339] (-537.160) * (-536.401) [-535.095] (-537.031) (-547.239) -- 0:01:00
62500 -- (-535.307) (-539.678) (-535.803) [-536.923] * [-537.401] (-534.911) (-537.557) (-543.535) -- 0:01:00
63000 -- [-535.950] (-540.237) (-537.568) (-535.884) * [-535.145] (-535.291) (-535.373) (-544.103) -- 0:00:59
63500 -- [-535.686] (-536.665) (-538.486) (-536.595) * (-536.978) (-535.673) (-535.931) [-543.754] -- 0:00:58
64000 -- (-535.150) (-535.206) (-540.288) [-537.338] * [-535.926] (-534.699) (-535.836) (-540.474) -- 0:00:58
64500 -- (-534.543) (-538.068) (-534.817) [-535.942] * (-539.650) (-537.688) (-536.531) [-545.886] -- 0:00:58
65000 -- [-536.272] (-536.077) (-537.439) (-535.829) * (-543.176) (-535.575) [-536.262] (-548.781) -- 0:00:57
Average standard deviation of split frequencies: 0.024999
65500 -- (-537.301) (-537.013) [-536.240] (-534.827) * (-540.988) [-538.643] (-536.664) (-548.745) -- 0:00:57
66000 -- (-539.098) (-537.370) [-537.295] (-535.687) * (-539.532) (-535.556) [-536.809] (-546.619) -- 0:00:56
66500 -- (-539.247) [-537.422] (-539.855) (-535.450) * (-536.001) (-537.412) (-539.260) [-545.645] -- 0:00:56
67000 -- [-535.183] (-536.630) (-535.636) (-535.416) * (-539.490) [-538.251] (-537.089) (-547.862) -- 0:00:55
67500 -- (-535.198) (-538.354) (-534.841) [-535.740] * (-537.654) [-539.758] (-538.331) (-543.049) -- 0:00:55
68000 -- (-535.663) [-535.652] (-535.921) (-534.681) * [-534.425] (-538.654) (-536.221) (-549.143) -- 0:00:54
68500 -- (-535.397) (-536.538) [-535.322] (-536.614) * [-536.047] (-535.447) (-540.430) (-557.963) -- 0:00:54
69000 -- (-538.812) (-536.189) [-536.269] (-537.734) * (-536.793) [-536.369] (-537.666) (-541.898) -- 0:00:53
69500 -- [-537.469] (-535.987) (-535.860) (-535.913) * (-534.756) [-536.960] (-538.145) (-546.431) -- 0:00:53
70000 -- (-534.735) (-542.069) [-534.721] (-538.662) * [-536.767] (-535.441) (-538.002) (-541.125) -- 0:00:53
Average standard deviation of split frequencies: 0.028685
70500 -- (-536.440) (-536.235) [-535.585] (-535.020) * (-538.789) (-535.124) (-537.620) [-542.533] -- 0:00:52
71000 -- [-540.115] (-534.960) (-535.628) (-536.557) * (-538.512) (-537.248) (-537.441) [-544.761] -- 0:00:52
71500 -- (-536.705) [-534.927] (-538.725) (-536.110) * (-537.541) (-536.529) [-536.915] (-548.270) -- 0:00:51
72000 -- [-539.621] (-535.178) (-537.993) (-534.825) * (-536.134) (-537.433) [-536.755] (-549.705) -- 0:00:51
72500 -- (-535.615) [-535.461] (-535.152) (-534.894) * [-537.732] (-537.283) (-535.665) (-544.864) -- 0:00:51
73000 -- (-538.363) (-537.074) (-536.085) [-536.955] * (-535.302) (-537.682) [-535.648] (-538.477) -- 0:01:03
73500 -- (-536.663) (-537.592) [-538.532] (-537.200) * (-536.493) (-536.921) [-535.560] (-549.455) -- 0:01:03
74000 -- (-540.966) (-537.517) (-541.111) [-538.956] * [-534.712] (-544.351) (-535.727) (-547.666) -- 0:01:02
74500 -- [-536.374] (-535.484) (-535.389) (-536.266) * (-537.462) (-537.945) [-534.757] (-543.844) -- 0:01:02
75000 -- [-534.751] (-539.586) (-535.051) (-535.378) * (-537.676) [-537.359] (-536.488) (-544.878) -- 0:01:01
Average standard deviation of split frequencies: 0.028946
75500 -- (-538.999) (-537.789) [-534.324] (-536.672) * (-537.017) [-538.962] (-536.726) (-549.221) -- 0:01:01
76000 -- (-538.283) (-536.225) [-534.942] (-538.632) * [-536.480] (-539.247) (-534.828) (-547.807) -- 0:01:00
76500 -- (-536.075) [-536.009] (-542.189) (-535.784) * [-535.077] (-538.135) (-534.813) (-551.975) -- 0:01:00
77000 -- (-534.899) (-535.390) (-536.775) [-534.073] * (-535.964) [-535.670] (-536.958) (-559.122) -- 0:00:59
77500 -- (-539.365) (-537.622) [-536.699] (-534.397) * (-539.318) (-537.650) [-536.558] (-543.083) -- 0:00:59
78000 -- (-534.959) [-536.891] (-534.526) (-535.434) * (-537.360) [-536.817] (-536.142) (-545.204) -- 0:00:59
78500 -- (-534.601) [-537.683] (-535.885) (-535.266) * (-538.348) (-537.586) (-541.135) [-540.659] -- 0:00:58
79000 -- [-535.524] (-535.054) (-535.168) (-535.653) * (-538.658) (-539.258) (-537.990) [-546.500] -- 0:00:58
79500 -- (-536.579) (-539.386) (-538.381) [-535.360] * (-536.647) (-535.473) [-537.920] (-546.217) -- 0:00:57
80000 -- [-536.057] (-538.074) (-534.943) (-539.423) * (-536.107) [-535.206] (-536.658) (-545.334) -- 0:00:57
Average standard deviation of split frequencies: 0.028106
80500 -- [-535.083] (-538.241) (-535.321) (-542.701) * [-535.096] (-538.089) (-536.532) (-541.146) -- 0:00:57
81000 -- (-538.795) [-536.619] (-536.458) (-536.054) * [-534.289] (-537.454) (-538.261) (-544.374) -- 0:00:56
81500 -- [-536.262] (-536.537) (-536.879) (-537.392) * (-538.262) [-541.086] (-535.120) (-545.707) -- 0:00:56
82000 -- (-535.840) [-536.563] (-536.201) (-536.396) * (-539.213) (-538.430) [-538.281] (-550.203) -- 0:00:55
82500 -- [-536.858] (-538.225) (-534.474) (-535.275) * (-539.747) [-535.958] (-537.780) (-554.024) -- 0:00:55
83000 -- (-538.661) [-535.397] (-534.485) (-539.810) * (-536.164) [-536.903] (-537.176) (-546.296) -- 0:00:55
83500 -- (-538.471) [-535.042] (-539.190) (-534.302) * (-537.220) (-535.692) [-536.045] (-546.628) -- 0:00:54
84000 -- (-538.996) (-538.338) [-536.185] (-539.600) * (-535.678) [-537.346] (-534.812) (-544.959) -- 0:00:54
84500 -- (-538.765) [-538.094] (-536.091) (-535.620) * (-536.052) (-535.478) [-538.075] (-542.682) -- 0:00:54
85000 -- [-537.136] (-536.444) (-538.408) (-536.648) * (-536.469) (-535.449) [-536.821] (-541.988) -- 0:00:53
Average standard deviation of split frequencies: 0.026660
85500 -- (-539.356) [-535.603] (-535.483) (-536.135) * (-536.204) [-538.735] (-535.539) (-545.372) -- 0:00:53
86000 -- [-535.805] (-535.275) (-540.128) (-535.975) * (-535.401) [-537.445] (-540.397) (-549.525) -- 0:00:53
86500 -- (-534.806) [-534.885] (-535.979) (-535.189) * [-536.206] (-536.768) (-536.237) (-542.985) -- 0:00:52
87000 -- (-536.462) (-535.448) [-535.780] (-536.541) * [-535.152] (-534.433) (-536.254) (-541.839) -- 0:00:52
87500 -- [-534.896] (-536.012) (-535.927) (-537.223) * (-535.444) (-534.709) [-540.730] (-546.887) -- 0:00:52
88000 -- (-538.538) (-536.538) [-535.326] (-536.095) * (-536.447) (-536.848) (-539.971) [-542.708] -- 0:00:51
88500 -- (-536.234) [-534.239] (-536.438) (-537.942) * (-537.897) (-535.561) [-535.279] (-546.345) -- 0:00:51
89000 -- (-540.892) (-535.978) (-536.844) [-534.154] * [-536.666] (-537.990) (-538.840) (-545.303) -- 0:00:51
89500 -- [-536.898] (-540.036) (-535.811) (-536.210) * (-536.644) (-540.219) (-535.471) [-544.291] -- 0:00:50
90000 -- (-536.818) (-535.662) [-540.154] (-538.832) * (-536.620) (-538.210) [-536.706] (-543.925) -- 0:01:00
Average standard deviation of split frequencies: 0.025217
90500 -- [-535.449] (-536.072) (-537.664) (-537.138) * (-539.062) [-536.288] (-536.637) (-547.955) -- 0:01:00
91000 -- (-536.427) [-535.962] (-538.777) (-538.220) * [-535.828] (-535.226) (-539.762) (-546.014) -- 0:00:59
91500 -- (-535.581) (-535.035) (-537.542) [-541.135] * [-534.479] (-534.385) (-539.762) (-547.814) -- 0:00:59
92000 -- (-535.034) (-536.229) [-535.865] (-541.938) * (-536.263) [-534.540] (-534.367) (-545.959) -- 0:00:59
92500 -- (-537.614) (-536.435) [-537.077] (-538.264) * (-535.127) (-534.981) (-535.184) [-542.524] -- 0:00:58
93000 -- (-537.144) [-534.534] (-538.346) (-537.003) * (-537.017) (-534.837) [-536.430] (-545.465) -- 0:00:58
93500 -- [-535.938] (-534.610) (-536.332) (-534.768) * (-540.246) [-536.332] (-536.170) (-552.078) -- 0:00:58
94000 -- (-535.639) (-537.969) (-534.369) [-535.332] * (-540.083) [-536.537] (-537.300) (-549.897) -- 0:00:57
94500 -- (-540.212) (-539.220) [-536.652] (-535.678) * [-537.398] (-537.328) (-537.499) (-558.415) -- 0:00:57
95000 -- (-536.899) (-547.009) [-535.098] (-535.816) * (-539.584) [-536.464] (-536.518) (-547.474) -- 0:00:57
Average standard deviation of split frequencies: 0.027124
95500 -- (-538.958) [-538.112] (-537.585) (-535.638) * (-537.553) (-535.050) (-536.508) [-537.434] -- 0:00:56
96000 -- (-535.926) (-536.831) [-538.462] (-536.642) * (-536.453) (-542.420) (-534.803) [-536.960] -- 0:00:56
96500 -- (-535.924) [-535.928] (-537.006) (-535.534) * [-535.980] (-538.343) (-536.197) (-537.903) -- 0:00:56
97000 -- (-535.738) (-534.498) [-535.063] (-534.590) * [-536.217] (-537.789) (-539.045) (-537.510) -- 0:00:55
97500 -- (-535.899) [-536.323] (-535.081) (-537.317) * [-538.451] (-537.607) (-535.618) (-537.685) -- 0:00:55
98000 -- (-536.271) (-537.588) [-536.516] (-535.884) * (-539.446) (-540.700) (-536.684) [-535.713] -- 0:00:55
98500 -- (-537.602) (-535.907) (-536.144) [-536.054] * [-539.947] (-540.447) (-539.906) (-535.417) -- 0:00:54
99000 -- (-534.618) (-538.879) (-534.523) [-538.109] * [-534.832] (-538.614) (-539.190) (-536.385) -- 0:00:54
99500 -- (-534.289) (-539.195) [-536.266] (-538.435) * (-538.459) (-535.916) (-537.306) [-536.046] -- 0:00:54
100000 -- [-536.203] (-539.533) (-536.284) (-537.332) * (-537.552) (-537.044) (-540.744) [-537.048] -- 0:00:54
Average standard deviation of split frequencies: 0.028097
100500 -- (-538.036) (-542.338) (-537.319) [-535.236] * [-536.256] (-539.115) (-535.825) (-536.611) -- 0:00:53
101000 -- (-542.365) (-537.727) [-538.458] (-539.096) * (-534.673) [-536.321] (-535.789) (-534.777) -- 0:00:53
101500 -- (-538.879) [-534.841] (-535.836) (-537.402) * (-535.074) (-535.527) (-535.861) [-538.463] -- 0:00:53
102000 -- (-536.603) [-534.829] (-538.365) (-537.055) * (-535.385) [-536.011] (-536.703) (-541.402) -- 0:00:52
102500 -- [-536.579] (-535.708) (-536.259) (-537.437) * (-535.688) (-535.433) [-535.515] (-541.178) -- 0:00:52
103000 -- (-535.434) (-534.825) (-537.158) [-536.055] * (-541.003) [-534.549] (-535.630) (-538.786) -- 0:00:52
103500 -- [-534.768] (-535.038) (-541.034) (-536.050) * [-537.337] (-536.091) (-536.037) (-541.210) -- 0:00:51
104000 -- [-534.044] (-534.743) (-539.785) (-538.460) * (-535.361) [-535.398] (-536.513) (-537.550) -- 0:00:51
104500 -- (-535.458) [-535.656] (-539.309) (-539.585) * [-536.267] (-535.404) (-539.064) (-536.586) -- 0:00:51
105000 -- (-542.212) (-534.931) [-538.710] (-538.029) * [-534.849] (-537.118) (-534.961) (-537.957) -- 0:00:51
Average standard deviation of split frequencies: 0.025268
105500 -- (-537.146) (-537.025) (-538.556) [-536.518] * (-535.277) (-538.596) (-534.749) [-536.033] -- 0:00:50
106000 -- [-535.027] (-538.490) (-537.077) (-536.842) * [-535.382] (-534.745) (-536.560) (-535.020) -- 0:00:50
106500 -- (-536.485) (-536.736) (-542.427) [-535.676] * (-534.885) (-535.671) [-537.653] (-535.455) -- 0:00:50
107000 -- (-537.702) [-538.449] (-539.148) (-537.301) * (-536.173) [-534.456] (-535.880) (-536.262) -- 0:00:58
107500 -- [-539.268] (-540.024) (-537.572) (-538.108) * (-538.697) (-536.516) [-535.625] (-536.390) -- 0:00:58
108000 -- [-536.379] (-535.020) (-535.757) (-537.129) * [-538.436] (-539.683) (-536.306) (-537.037) -- 0:00:57
108500 -- (-535.906) [-534.299] (-545.227) (-537.769) * (-537.801) (-535.853) (-537.903) [-535.680] -- 0:00:57
109000 -- (-536.584) (-541.108) (-541.405) [-535.896] * (-536.936) (-539.162) (-540.297) [-534.879] -- 0:00:57
109500 -- (-535.993) [-534.850] (-536.897) (-539.420) * (-536.284) (-537.264) [-536.103] (-536.875) -- 0:00:56
110000 -- (-540.371) (-534.693) (-538.196) [-536.063] * (-535.145) (-542.161) (-536.114) [-536.649] -- 0:00:56
Average standard deviation of split frequencies: 0.024977
110500 -- [-534.165] (-535.614) (-541.445) (-535.218) * [-535.587] (-536.285) (-536.550) (-535.401) -- 0:00:56
111000 -- [-535.675] (-534.799) (-537.836) (-537.902) * [-535.158] (-538.413) (-537.605) (-534.357) -- 0:00:56
111500 -- (-537.438) (-537.569) [-538.746] (-536.472) * [-535.943] (-537.495) (-538.927) (-534.350) -- 0:00:55
112000 -- [-537.246] (-535.986) (-542.255) (-535.056) * [-535.690] (-535.929) (-535.539) (-536.815) -- 0:00:55
112500 -- [-538.926] (-535.093) (-538.122) (-538.789) * [-536.692] (-535.199) (-535.472) (-539.057) -- 0:00:55
113000 -- (-542.021) (-537.807) (-536.082) [-537.018] * (-539.459) (-536.040) [-536.187] (-536.554) -- 0:00:54
113500 -- (-537.631) [-536.886] (-535.031) (-539.204) * (-536.591) (-535.732) (-536.159) [-534.632] -- 0:00:54
114000 -- (-537.337) (-535.780) (-535.528) [-536.061] * (-538.211) (-537.714) [-535.769] (-535.688) -- 0:00:54
114500 -- [-536.837] (-539.557) (-537.028) (-534.873) * (-538.979) [-537.978] (-535.668) (-536.093) -- 0:00:54
115000 -- (-535.064) (-536.615) [-536.787] (-536.589) * (-536.421) (-536.434) (-535.442) [-537.015] -- 0:00:53
Average standard deviation of split frequencies: 0.026125
115500 -- (-538.811) (-535.789) [-538.743] (-535.697) * (-536.439) [-536.647] (-537.769) (-537.224) -- 0:00:53
116000 -- (-535.010) [-540.734] (-537.087) (-535.759) * [-535.505] (-535.038) (-536.251) (-536.132) -- 0:00:53
116500 -- (-535.798) [-540.763] (-536.591) (-535.424) * (-539.916) (-534.623) (-537.140) [-537.325] -- 0:00:53
117000 -- (-534.637) (-538.998) (-534.960) [-534.725] * (-534.702) (-534.401) (-535.607) [-536.400] -- 0:00:52
117500 -- [-535.544] (-538.412) (-535.904) (-534.573) * (-534.881) (-536.060) (-538.275) [-534.805] -- 0:00:52
118000 -- (-534.576) (-538.127) [-537.174] (-535.786) * (-535.894) (-537.264) (-536.008) [-539.405] -- 0:00:52
118500 -- (-540.833) (-537.333) [-538.271] (-541.158) * (-536.492) (-535.990) [-537.013] (-540.780) -- 0:00:52
119000 -- (-535.751) (-537.488) (-536.332) [-535.832] * [-538.436] (-535.188) (-535.439) (-536.820) -- 0:00:51
119500 -- (-535.588) [-535.327] (-537.472) (-539.157) * [-537.648] (-534.371) (-535.484) (-534.528) -- 0:00:51
120000 -- (-536.622) [-535.668] (-535.919) (-536.471) * (-535.662) [-534.414] (-535.125) (-535.052) -- 0:00:51
Average standard deviation of split frequencies: 0.026975
120500 -- [-535.788] (-536.269) (-538.713) (-535.949) * (-535.257) (-537.298) (-535.782) [-537.492] -- 0:00:51
121000 -- (-536.145) (-537.108) [-535.652] (-538.010) * (-537.372) (-534.396) [-534.502] (-536.331) -- 0:00:50
121500 -- (-535.987) (-534.899) [-537.970] (-541.095) * (-538.038) (-538.989) (-534.887) [-535.441] -- 0:00:50
122000 -- (-538.571) (-536.493) (-538.125) [-535.560] * (-535.659) [-536.607] (-534.292) (-537.755) -- 0:00:50
122500 -- (-540.288) (-536.754) [-539.999] (-535.291) * (-542.171) (-540.559) (-535.900) [-536.665] -- 0:00:50
123000 -- (-538.605) [-536.588] (-535.423) (-536.645) * (-539.294) (-541.528) [-535.009] (-536.116) -- 0:00:49
123500 -- (-535.542) [-536.513] (-539.397) (-535.584) * (-541.955) (-537.499) (-536.710) [-538.269] -- 0:00:49
124000 -- [-535.796] (-536.513) (-538.744) (-536.254) * (-537.234) (-537.239) (-535.927) [-537.130] -- 0:00:49
124500 -- (-535.959) (-537.853) [-535.302] (-537.178) * (-538.192) [-538.513] (-536.181) (-537.846) -- 0:00:56
125000 -- (-535.467) (-535.386) (-537.060) [-539.503] * (-537.507) (-536.552) (-535.174) [-536.795] -- 0:00:56
Average standard deviation of split frequencies: 0.026189
125500 -- [-534.261] (-537.825) (-537.814) (-535.370) * [-538.971] (-536.089) (-538.482) (-541.495) -- 0:00:55
126000 -- (-535.037) (-537.135) [-536.923] (-535.116) * (-534.957) (-536.626) (-537.103) [-537.942] -- 0:00:55
126500 -- (-535.185) (-535.964) (-536.585) [-535.021] * (-534.824) (-537.024) (-535.166) [-539.317] -- 0:00:55
127000 -- [-535.119] (-535.259) (-541.495) (-537.990) * (-534.569) [-535.223] (-536.765) (-542.328) -- 0:00:54
127500 -- (-534.452) (-536.705) [-543.359] (-538.659) * (-536.780) [-534.444] (-537.482) (-541.479) -- 0:00:54
128000 -- [-536.714] (-539.474) (-535.619) (-536.726) * (-537.951) [-534.740] (-536.779) (-536.905) -- 0:00:54
128500 -- (-536.849) [-537.511] (-534.730) (-537.935) * [-537.080] (-536.218) (-536.631) (-535.033) -- 0:00:54
129000 -- (-541.821) (-539.236) [-535.421] (-535.361) * (-536.038) (-539.848) (-537.338) [-538.655] -- 0:00:54
129500 -- (-537.413) (-541.583) (-538.776) [-535.039] * [-535.343] (-535.701) (-536.070) (-538.120) -- 0:00:53
130000 -- (-535.968) (-541.019) (-537.702) [-538.018] * (-535.285) (-539.654) (-536.114) [-537.382] -- 0:00:53
Average standard deviation of split frequencies: 0.027058
130500 -- (-538.505) (-535.510) [-540.403] (-535.076) * (-535.192) (-535.981) [-536.943] (-534.540) -- 0:00:53
131000 -- (-535.936) [-534.991] (-536.013) (-534.608) * (-535.461) [-536.924] (-537.847) (-534.327) -- 0:00:53
131500 -- [-535.798] (-536.584) (-535.056) (-536.847) * (-534.937) [-537.775] (-536.441) (-536.541) -- 0:00:52
132000 -- (-535.268) (-536.134) [-537.134] (-537.070) * (-536.243) [-537.270] (-536.762) (-537.005) -- 0:00:52
132500 -- [-538.017] (-538.500) (-535.708) (-537.235) * (-538.746) [-536.521] (-535.768) (-541.656) -- 0:00:52
133000 -- [-538.095] (-536.417) (-536.873) (-535.501) * (-538.056) (-536.507) (-538.287) [-535.022] -- 0:00:52
133500 -- (-537.072) [-536.453] (-534.239) (-536.052) * (-538.188) (-538.511) [-535.627] (-537.149) -- 0:00:51
134000 -- (-535.070) (-538.777) [-537.157] (-535.883) * [-540.232] (-536.973) (-535.182) (-536.187) -- 0:00:51
134500 -- [-534.926] (-535.641) (-539.973) (-535.333) * (-543.048) (-535.593) (-537.386) [-536.180] -- 0:00:51
135000 -- (-537.185) (-539.885) [-539.610] (-534.496) * (-545.044) (-535.358) (-536.235) [-536.754] -- 0:00:51
Average standard deviation of split frequencies: 0.026784
135500 -- (-537.886) (-536.921) (-536.059) [-535.138] * (-538.627) (-536.549) [-536.903] (-535.292) -- 0:00:51
136000 -- (-535.673) (-535.414) [-536.052] (-538.977) * (-535.130) (-536.381) (-536.080) [-536.376] -- 0:00:50
136500 -- (-535.119) (-538.916) [-534.182] (-541.566) * (-535.104) (-537.132) (-536.791) [-535.030] -- 0:00:50
137000 -- (-534.766) (-536.638) [-535.331] (-537.831) * (-536.415) (-536.365) (-538.771) [-534.544] -- 0:00:50
137500 -- (-537.580) [-534.652] (-534.464) (-536.665) * (-534.206) (-536.759) [-535.967] (-537.025) -- 0:00:50
138000 -- (-537.291) (-537.851) (-536.994) [-536.334] * (-537.853) (-536.895) (-537.094) [-535.988] -- 0:00:49
138500 -- (-539.352) (-535.242) [-535.358] (-535.283) * [-536.355] (-536.123) (-534.570) (-538.334) -- 0:00:49
139000 -- [-536.509] (-536.783) (-535.399) (-535.852) * (-534.662) [-536.204] (-535.447) (-536.820) -- 0:00:49
139500 -- (-535.961) [-535.487] (-535.160) (-535.490) * (-540.697) [-534.107] (-535.339) (-537.812) -- 0:00:49
140000 -- (-538.818) (-537.635) [-536.395] (-538.000) * (-538.346) (-535.838) [-536.128] (-536.733) -- 0:00:49
Average standard deviation of split frequencies: 0.025134
140500 -- (-537.232) (-536.079) [-538.958] (-537.184) * (-536.639) (-535.152) [-536.613] (-536.251) -- 0:00:48
141000 -- (-536.823) (-538.163) (-536.307) [-537.273] * [-537.874] (-537.167) (-538.712) (-535.822) -- 0:00:54
141500 -- [-537.329] (-536.810) (-539.502) (-537.324) * (-536.428) (-541.224) [-537.793] (-537.278) -- 0:00:54
142000 -- (-536.759) [-535.959] (-537.272) (-537.176) * (-538.994) (-538.280) [-537.664] (-536.341) -- 0:00:54
142500 -- (-540.424) (-537.781) [-535.476] (-535.868) * (-543.919) (-537.845) [-537.419] (-535.985) -- 0:00:54
143000 -- [-534.599] (-536.235) (-535.934) (-536.676) * (-535.422) [-534.838] (-538.044) (-535.714) -- 0:00:53
143500 -- (-536.154) (-537.376) [-538.644] (-536.472) * (-536.610) (-534.633) [-535.379] (-534.892) -- 0:00:53
144000 -- (-537.837) (-536.094) [-536.028] (-535.038) * (-537.510) (-535.535) (-537.404) [-534.943] -- 0:00:53
144500 -- [-535.060] (-534.997) (-535.540) (-534.831) * (-538.668) [-535.924] (-541.698) (-535.614) -- 0:00:53
145000 -- (-536.440) [-535.358] (-536.865) (-536.586) * (-541.136) (-534.820) [-535.350] (-535.677) -- 0:00:53
Average standard deviation of split frequencies: 0.023482
145500 -- [-537.096] (-536.042) (-535.590) (-536.226) * [-537.449] (-535.755) (-534.745) (-535.459) -- 0:00:52
146000 -- [-537.245] (-539.365) (-535.809) (-536.576) * (-535.508) [-536.267] (-534.579) (-538.397) -- 0:00:52
146500 -- (-536.762) [-536.465] (-535.634) (-535.666) * (-535.798) (-537.520) [-535.685] (-536.155) -- 0:00:52
147000 -- (-537.355) [-536.815] (-536.695) (-535.917) * [-536.056] (-535.411) (-536.184) (-537.693) -- 0:00:52
147500 -- (-535.616) (-535.502) (-535.071) [-538.155] * (-537.444) (-536.757) (-535.671) [-536.216] -- 0:00:52
148000 -- (-536.154) [-534.454] (-535.845) (-538.824) * (-535.367) (-535.286) [-539.627] (-538.400) -- 0:00:51
148500 -- (-535.275) [-535.721] (-535.425) (-535.398) * [-537.416] (-535.953) (-538.802) (-540.158) -- 0:00:51
149000 -- [-534.456] (-540.628) (-535.867) (-536.924) * [-537.620] (-535.370) (-534.712) (-536.457) -- 0:00:51
149500 -- (-537.358) [-535.822] (-536.336) (-535.535) * (-535.980) [-535.280] (-536.037) (-538.784) -- 0:00:51
150000 -- (-536.057) (-536.018) (-536.873) [-535.883] * [-537.059] (-535.968) (-536.760) (-537.045) -- 0:00:51
Average standard deviation of split frequencies: 0.023466
150500 -- (-537.188) (-535.868) [-536.679] (-535.784) * (-537.449) (-542.663) (-536.659) [-537.100] -- 0:00:50
151000 -- [-536.811] (-535.139) (-535.600) (-537.885) * (-537.078) (-536.577) (-538.647) [-537.975] -- 0:00:50
151500 -- (-536.474) (-536.084) [-537.302] (-538.258) * (-537.173) (-538.135) (-537.766) [-538.795] -- 0:00:50
152000 -- [-537.991] (-536.463) (-534.723) (-535.643) * (-541.126) [-534.964] (-536.258) (-537.729) -- 0:00:50
152500 -- [-536.737] (-537.171) (-541.102) (-535.022) * (-536.636) (-535.789) (-535.014) [-538.663] -- 0:00:50
153000 -- (-536.844) (-535.940) (-534.660) [-535.023] * (-535.303) [-535.929] (-535.803) (-534.458) -- 0:00:49
153500 -- (-535.932) (-536.945) (-535.770) [-535.962] * (-535.810) [-535.463] (-535.721) (-534.284) -- 0:00:49
154000 -- (-535.633) (-535.992) (-538.136) [-535.393] * (-534.658) (-535.260) [-535.359] (-534.740) -- 0:00:49
154500 -- (-539.713) (-536.939) (-535.164) [-535.826] * [-534.630] (-538.259) (-536.212) (-534.922) -- 0:00:49
155000 -- [-536.033] (-536.705) (-534.696) (-534.568) * (-538.152) (-540.039) [-536.928] (-536.536) -- 0:00:49
Average standard deviation of split frequencies: 0.021702
155500 -- (-538.971) (-535.478) [-535.678] (-537.790) * (-537.115) (-536.117) [-536.631] (-536.998) -- 0:00:48
156000 -- (-535.298) [-534.917] (-535.148) (-537.612) * (-535.033) (-536.914) (-538.675) [-535.693] -- 0:00:48
156500 -- [-535.188] (-534.986) (-538.789) (-535.599) * (-535.729) (-536.781) (-536.011) [-534.653] -- 0:00:48
157000 -- (-534.234) [-534.518] (-536.319) (-535.517) * (-536.607) [-536.094] (-538.223) (-534.689) -- 0:00:48
157500 -- [-535.642] (-536.074) (-537.502) (-534.572) * (-535.225) (-536.759) (-538.429) [-535.251] -- 0:00:53
158000 -- (-535.160) (-539.234) (-535.456) [-538.586] * [-534.321] (-535.704) (-538.180) (-536.368) -- 0:00:53
158500 -- (-537.166) (-537.322) (-537.870) [-534.229] * (-539.604) (-535.001) [-537.028] (-538.139) -- 0:00:53
159000 -- [-535.979] (-539.920) (-535.472) (-537.831) * (-534.859) (-538.818) [-535.462] (-534.893) -- 0:00:52
159500 -- [-536.976] (-540.642) (-539.294) (-537.160) * (-535.320) (-536.038) (-535.205) [-535.819] -- 0:00:52
160000 -- (-541.769) [-538.582] (-537.576) (-536.112) * [-536.918] (-538.123) (-535.759) (-536.044) -- 0:00:52
Average standard deviation of split frequencies: 0.021377
160500 -- (-535.755) (-539.578) [-535.916] (-536.048) * (-534.490) (-536.206) [-536.686] (-534.372) -- 0:00:52
161000 -- (-536.418) (-537.101) [-535.842] (-535.254) * (-535.092) (-539.310) (-537.950) [-534.541] -- 0:00:52
161500 -- (-536.900) (-535.728) [-534.930] (-536.825) * (-535.797) [-534.480] (-538.770) (-535.584) -- 0:00:51
162000 -- [-538.551] (-538.172) (-535.449) (-535.741) * [-535.840] (-534.886) (-535.384) (-536.981) -- 0:00:51
162500 -- (-536.486) [-535.888] (-542.086) (-537.110) * [-536.205] (-535.065) (-544.684) (-537.244) -- 0:00:51
163000 -- (-534.785) [-537.077] (-536.526) (-536.276) * (-537.270) [-535.051] (-538.649) (-536.174) -- 0:00:51
163500 -- (-535.449) (-535.048) (-535.973) [-534.752] * (-541.088) (-535.094) (-541.087) [-536.474] -- 0:00:51
164000 -- (-534.615) [-536.940] (-537.453) (-535.665) * [-539.405] (-536.303) (-541.996) (-536.309) -- 0:00:50
164500 -- (-535.486) (-535.666) (-534.532) [-535.726] * [-537.148] (-538.417) (-536.525) (-537.693) -- 0:00:50
165000 -- (-535.352) [-537.555] (-538.908) (-536.169) * (-537.239) (-535.998) (-536.115) [-536.570] -- 0:00:50
Average standard deviation of split frequencies: 0.021686
165500 -- (-537.112) [-535.076] (-538.667) (-540.204) * [-536.231] (-537.099) (-535.334) (-536.645) -- 0:00:50
166000 -- (-536.896) (-536.236) (-534.623) [-535.404] * (-537.057) [-535.965] (-537.043) (-537.588) -- 0:00:50
166500 -- [-538.103] (-541.766) (-543.838) (-536.457) * (-536.377) [-538.617] (-539.464) (-534.188) -- 0:00:50
167000 -- [-536.608] (-541.363) (-538.571) (-537.446) * [-538.359] (-538.493) (-538.447) (-534.738) -- 0:00:49
167500 -- (-536.075) (-537.261) [-535.202] (-535.400) * (-538.823) (-537.527) (-539.960) [-534.644] -- 0:00:49
168000 -- (-535.637) [-538.206] (-535.523) (-540.369) * (-535.426) (-535.326) [-536.360] (-534.201) -- 0:00:49
168500 -- (-536.379) (-537.003) (-536.148) [-537.523] * (-539.552) (-535.918) (-535.712) [-535.811] -- 0:00:49
169000 -- (-535.279) (-534.452) [-537.618] (-535.864) * [-536.091] (-535.293) (-538.093) (-536.733) -- 0:00:49
169500 -- [-536.058] (-535.506) (-535.647) (-538.259) * (-542.355) (-537.452) (-539.046) [-539.186] -- 0:00:48
170000 -- [-534.927] (-535.872) (-534.990) (-535.459) * (-535.415) (-536.155) [-539.797] (-538.355) -- 0:00:48
Average standard deviation of split frequencies: 0.022348
170500 -- (-536.700) (-540.011) (-534.806) [-537.213] * [-535.906] (-537.023) (-536.278) (-538.274) -- 0:00:48
171000 -- (-538.815) (-536.546) (-535.501) [-537.643] * (-534.541) (-536.916) (-536.817) [-538.545] -- 0:00:48
171500 -- (-535.195) (-535.427) (-536.752) [-536.440] * (-535.102) (-538.777) (-537.434) [-535.036] -- 0:00:48
172000 -- (-534.571) [-536.540] (-537.740) (-534.783) * [-536.909] (-537.660) (-537.708) (-534.938) -- 0:00:48
172500 -- [-536.004] (-537.022) (-535.163) (-535.482) * (-538.108) [-536.625] (-537.494) (-535.100) -- 0:00:47
173000 -- [-536.849] (-537.226) (-535.693) (-534.404) * (-535.633) (-538.597) (-537.088) [-534.239] -- 0:00:47
173500 -- (-538.970) [-534.517] (-536.331) (-536.860) * [-535.536] (-537.193) (-535.711) (-536.885) -- 0:00:47
174000 -- (-541.256) [-538.931] (-538.642) (-536.051) * (-543.118) [-536.829] (-536.616) (-539.138) -- 0:00:52
174500 -- (-537.685) (-534.877) [-536.541] (-535.574) * [-535.966] (-539.587) (-538.189) (-537.646) -- 0:00:52
175000 -- (-538.487) (-537.111) (-535.332) [-535.709] * (-538.902) (-541.142) [-534.702] (-537.367) -- 0:00:51
Average standard deviation of split frequencies: 0.021427
175500 -- (-535.640) (-536.383) (-535.933) [-535.120] * (-535.746) (-534.340) (-535.928) [-537.217] -- 0:00:51
176000 -- (-538.995) (-537.629) (-536.885) [-537.457] * (-537.023) (-534.694) (-535.372) [-536.082] -- 0:00:51
176500 -- (-535.965) [-538.071] (-536.696) (-534.841) * (-537.162) (-536.020) [-536.378] (-534.436) -- 0:00:51
177000 -- [-534.891] (-536.003) (-534.280) (-536.527) * [-537.135] (-536.478) (-538.327) (-536.984) -- 0:00:51
177500 -- (-538.802) [-540.243] (-536.460) (-538.032) * [-534.968] (-535.415) (-538.054) (-536.294) -- 0:00:50
178000 -- (-537.075) [-538.853] (-535.109) (-537.975) * [-534.583] (-535.840) (-538.121) (-535.597) -- 0:00:50
178500 -- (-538.008) [-535.294] (-536.054) (-536.191) * (-535.746) (-535.477) (-538.861) [-539.736] -- 0:00:50
179000 -- (-535.818) [-534.398] (-535.444) (-537.885) * [-534.461] (-535.666) (-534.475) (-535.919) -- 0:00:50
179500 -- (-535.418) [-535.845] (-538.446) (-536.644) * (-537.785) [-539.503] (-535.518) (-539.155) -- 0:00:50
180000 -- (-534.458) (-537.670) [-537.629] (-536.229) * [-534.843] (-536.355) (-535.036) (-536.305) -- 0:00:50
Average standard deviation of split frequencies: 0.019178
180500 -- (-535.176) [-535.422] (-538.047) (-534.664) * (-536.986) [-536.472] (-534.540) (-536.612) -- 0:00:49
181000 -- (-537.859) (-534.836) (-538.100) [-534.900] * (-537.112) [-535.114] (-537.978) (-535.750) -- 0:00:49
181500 -- (-537.599) [-534.906] (-534.610) (-536.694) * (-537.618) (-536.543) (-537.324) [-536.913] -- 0:00:49
182000 -- (-536.173) (-537.638) (-537.872) [-536.095] * (-535.548) (-536.197) [-536.079] (-535.127) -- 0:00:49
182500 -- (-534.972) (-538.151) (-538.547) [-535.201] * [-538.280] (-535.020) (-537.324) (-537.752) -- 0:00:49
183000 -- (-535.032) (-534.743) (-537.693) [-535.915] * (-535.038) (-535.204) [-535.220] (-536.486) -- 0:00:49
183500 -- (-535.433) [-534.846] (-536.944) (-537.884) * [-535.587] (-535.989) (-536.332) (-535.418) -- 0:00:48
184000 -- [-535.312] (-536.104) (-536.684) (-538.930) * (-539.089) (-535.588) (-537.612) [-537.985] -- 0:00:48
184500 -- (-540.416) (-535.712) (-538.397) [-535.224] * (-536.632) (-536.856) (-536.452) [-539.011] -- 0:00:48
185000 -- (-538.704) (-536.398) [-535.583] (-535.765) * (-535.559) (-535.093) [-535.959] (-538.248) -- 0:00:48
Average standard deviation of split frequencies: 0.018224
185500 -- [-536.722] (-536.224) (-542.292) (-538.594) * (-535.544) (-535.914) [-536.117] (-538.812) -- 0:00:48
186000 -- (-535.840) (-541.712) (-542.524) [-536.637] * (-536.784) [-538.461] (-535.499) (-535.313) -- 0:00:48
186500 -- (-538.080) [-537.838] (-540.391) (-539.032) * (-534.563) (-537.089) [-536.078] (-537.356) -- 0:00:47
187000 -- [-537.539] (-537.144) (-536.386) (-536.881) * (-537.761) [-535.235] (-534.815) (-537.203) -- 0:00:47
187500 -- [-535.941] (-536.468) (-534.992) (-536.486) * (-536.092) (-534.787) (-535.579) [-535.825] -- 0:00:47
188000 -- (-538.593) (-535.624) (-535.761) [-535.249] * (-535.550) (-535.307) [-538.812] (-536.771) -- 0:00:47
188500 -- [-539.592] (-540.837) (-536.880) (-536.040) * [-536.101] (-535.010) (-536.408) (-538.087) -- 0:00:47
189000 -- [-538.045] (-537.159) (-536.174) (-538.457) * (-534.947) (-536.061) [-536.247] (-536.697) -- 0:00:47
189500 -- (-536.273) (-537.021) (-536.911) [-539.010] * [-536.026] (-535.329) (-537.290) (-538.278) -- 0:00:47
190000 -- [-536.269] (-540.256) (-538.082) (-538.270) * (-538.552) (-537.203) [-536.295] (-536.476) -- 0:00:46
Average standard deviation of split frequencies: 0.016247
190500 -- (-537.355) [-537.438] (-543.383) (-539.291) * [-536.127] (-537.176) (-534.934) (-536.403) -- 0:00:50
191000 -- (-534.356) [-538.025] (-536.785) (-538.957) * (-536.745) (-541.525) [-536.173] (-537.338) -- 0:00:50
191500 -- (-535.204) (-538.745) [-535.538] (-535.742) * (-535.447) [-539.249] (-540.182) (-536.703) -- 0:00:50
192000 -- (-534.365) (-535.160) [-535.541] (-536.917) * [-536.306] (-537.892) (-537.854) (-535.968) -- 0:00:50
192500 -- (-535.983) (-537.439) (-536.772) [-536.151] * (-534.769) [-536.603] (-536.064) (-536.419) -- 0:00:50
193000 -- [-537.084] (-534.567) (-536.987) (-537.765) * (-536.609) (-537.072) [-538.357] (-537.567) -- 0:00:50
193500 -- (-537.742) (-536.272) (-540.196) [-538.022] * (-537.983) [-537.118] (-535.599) (-535.362) -- 0:00:50
194000 -- (-535.709) [-537.272] (-538.245) (-537.491) * (-538.193) (-536.955) (-536.096) [-536.660] -- 0:00:49
194500 -- (-538.822) (-536.745) [-535.768] (-536.808) * [-537.404] (-536.866) (-537.070) (-534.318) -- 0:00:49
195000 -- (-536.355) (-534.997) (-539.099) [-535.643] * (-534.706) (-535.713) [-536.984] (-536.463) -- 0:00:49
Average standard deviation of split frequencies: 0.015347
195500 -- (-540.629) (-537.411) [-535.590] (-537.594) * [-536.594] (-534.615) (-538.820) (-537.040) -- 0:00:49
196000 -- [-534.874] (-538.828) (-537.407) (-537.287) * (-537.748) [-534.084] (-535.464) (-537.302) -- 0:00:49
196500 -- [-535.869] (-538.988) (-538.098) (-538.223) * (-537.293) [-534.733] (-537.235) (-534.976) -- 0:00:49
197000 -- (-535.332) (-536.526) (-535.472) [-538.278] * (-538.276) [-535.503] (-541.068) (-537.458) -- 0:00:48
197500 -- (-537.947) (-536.569) [-539.194] (-543.684) * [-538.647] (-537.120) (-536.012) (-536.915) -- 0:00:48
198000 -- [-534.564] (-537.038) (-535.354) (-545.438) * [-536.102] (-535.000) (-535.356) (-537.111) -- 0:00:48
198500 -- [-534.132] (-536.066) (-538.508) (-538.725) * (-534.985) (-535.014) [-540.969] (-538.227) -- 0:00:48
199000 -- (-536.751) (-537.472) [-536.003] (-536.325) * [-538.908] (-535.462) (-536.870) (-536.770) -- 0:00:48
199500 -- (-536.738) (-535.812) (-537.148) [-535.377] * [-538.497] (-536.884) (-539.354) (-538.633) -- 0:00:48
200000 -- (-535.973) [-538.271] (-536.208) (-534.430) * [-536.053] (-536.634) (-535.088) (-542.391) -- 0:00:48
Average standard deviation of split frequencies: 0.014917
200500 -- [-536.762] (-536.928) (-536.311) (-534.879) * (-537.177) (-539.810) (-534.157) [-535.703] -- 0:00:47
201000 -- (-535.261) [-536.363] (-538.241) (-535.732) * [-537.089] (-543.396) (-540.306) (-537.907) -- 0:00:47
201500 -- (-536.308) (-536.235) (-537.404) [-535.547] * [-537.528] (-542.989) (-537.059) (-537.984) -- 0:00:47
202000 -- [-534.364] (-536.708) (-536.439) (-536.433) * [-537.563] (-536.439) (-534.772) (-539.179) -- 0:00:47
202500 -- (-535.187) [-536.167] (-537.997) (-538.008) * (-535.838) (-537.389) (-535.595) [-535.824] -- 0:00:47
203000 -- (-539.737) (-537.552) [-538.112] (-541.630) * (-538.300) (-536.193) (-539.573) [-535.063] -- 0:00:47
203500 -- [-538.240] (-537.195) (-535.164) (-539.316) * (-535.574) (-536.127) (-540.182) [-535.619] -- 0:00:46
204000 -- [-535.131] (-537.892) (-536.264) (-535.659) * (-538.170) (-534.929) (-536.975) [-534.966] -- 0:00:46
204500 -- (-537.262) (-537.126) [-537.355] (-543.464) * [-536.281] (-534.989) (-535.647) (-537.862) -- 0:00:46
205000 -- (-534.847) (-540.398) [-536.401] (-539.095) * (-539.519) (-535.051) (-537.115) [-535.960] -- 0:00:46
Average standard deviation of split frequencies: 0.013730
205500 -- (-537.875) (-536.860) [-535.217] (-535.242) * [-537.679] (-534.875) (-536.382) (-537.439) -- 0:00:46
206000 -- (-535.694) [-537.922] (-537.394) (-537.458) * (-542.428) (-536.419) [-536.270] (-536.597) -- 0:00:50
206500 -- (-537.357) [-538.157] (-534.526) (-544.244) * (-538.892) (-537.430) (-534.588) [-535.660] -- 0:00:49
207000 -- (-537.437) [-536.356] (-539.970) (-537.631) * (-537.515) (-536.816) (-535.713) [-535.254] -- 0:00:49
207500 -- [-539.577] (-535.862) (-536.431) (-538.881) * (-534.511) (-535.988) (-542.504) [-534.965] -- 0:00:49
208000 -- [-535.424] (-534.252) (-537.727) (-538.030) * (-536.555) (-538.959) (-538.900) [-535.188] -- 0:00:49
208500 -- [-536.779] (-537.712) (-535.453) (-536.702) * (-535.918) [-535.552] (-538.233) (-542.486) -- 0:00:49
209000 -- (-538.041) [-539.300] (-536.820) (-537.178) * (-536.327) [-535.130] (-537.029) (-536.327) -- 0:00:49
209500 -- (-538.224) (-540.250) (-537.531) [-537.932] * (-535.675) (-539.948) [-536.855] (-538.613) -- 0:00:49
210000 -- (-534.888) [-539.612] (-537.672) (-539.659) * [-542.669] (-540.118) (-537.005) (-538.267) -- 0:00:48
Average standard deviation of split frequencies: 0.014321
210500 -- (-536.591) (-537.414) [-537.487] (-538.197) * (-540.945) (-537.160) [-537.886] (-535.438) -- 0:00:48
211000 -- (-545.627) (-536.976) (-538.550) [-537.770] * (-538.506) (-535.993) (-537.734) [-537.334] -- 0:00:48
211500 -- (-537.301) [-534.618] (-536.169) (-539.969) * (-537.938) (-535.464) (-534.874) [-536.193] -- 0:00:48
212000 -- (-536.500) [-535.084] (-534.850) (-538.687) * (-539.940) [-535.248] (-535.482) (-537.281) -- 0:00:48
212500 -- (-534.708) (-535.789) (-534.433) [-536.026] * (-544.317) [-534.449] (-535.926) (-539.132) -- 0:00:48
213000 -- (-541.442) [-535.568] (-539.217) (-538.978) * [-540.177] (-537.487) (-537.985) (-545.355) -- 0:00:48
213500 -- (-542.309) (-535.617) [-538.591] (-535.940) * (-538.378) (-537.257) [-534.716] (-539.343) -- 0:00:47
214000 -- (-538.346) (-536.738) (-536.872) [-535.696] * (-544.816) (-540.549) (-534.805) [-541.186] -- 0:00:47
214500 -- (-535.512) [-535.294] (-536.734) (-536.517) * (-541.188) [-537.620] (-536.084) (-537.077) -- 0:00:47
215000 -- (-542.991) (-536.896) (-536.495) [-537.444] * (-534.391) (-537.541) (-537.049) [-536.578] -- 0:00:47
Average standard deviation of split frequencies: 0.015059
215500 -- [-537.098] (-539.666) (-538.358) (-534.725) * (-538.885) [-537.051] (-537.117) (-538.905) -- 0:00:47
216000 -- (-536.240) (-535.827) (-539.313) [-537.104] * [-538.029] (-537.968) (-541.122) (-535.145) -- 0:00:47
216500 -- (-538.275) (-535.557) (-536.402) [-536.861] * (-535.810) (-535.985) (-540.571) [-535.144] -- 0:00:47
217000 -- (-535.452) [-537.377] (-537.034) (-536.742) * (-535.779) (-537.069) [-534.555] (-535.568) -- 0:00:46
217500 -- (-534.734) (-539.162) [-539.728] (-534.750) * (-535.079) (-537.892) [-534.181] (-537.788) -- 0:00:46
218000 -- (-534.527) (-536.228) [-536.059] (-535.891) * (-535.000) (-538.242) [-535.493] (-538.410) -- 0:00:46
218500 -- [-536.580] (-535.482) (-537.692) (-539.945) * [-534.802] (-536.070) (-536.056) (-538.200) -- 0:00:46
219000 -- [-534.837] (-536.150) (-540.887) (-542.255) * (-535.119) [-536.333] (-536.336) (-541.773) -- 0:00:46
219500 -- [-536.151] (-536.292) (-536.178) (-539.661) * (-537.273) (-535.451) [-538.554] (-538.600) -- 0:00:46
220000 -- [-537.902] (-540.571) (-535.690) (-537.793) * (-537.068) (-535.608) [-536.365] (-535.122) -- 0:00:46
Average standard deviation of split frequencies: 0.014167
220500 -- (-536.734) [-536.132] (-537.492) (-539.076) * (-536.493) [-534.630] (-536.531) (-535.220) -- 0:00:45
221000 -- [-536.743] (-539.118) (-535.372) (-536.897) * (-537.129) (-534.901) [-537.871] (-535.790) -- 0:00:45
221500 -- (-536.714) [-536.246] (-536.739) (-537.551) * (-535.997) (-535.580) [-539.152] (-535.727) -- 0:00:45
222000 -- (-534.927) (-536.592) [-537.386] (-535.692) * (-536.138) (-536.825) (-540.431) [-535.428] -- 0:00:45
222500 -- (-535.474) (-536.563) (-534.972) [-537.294] * (-535.200) [-536.719] (-536.871) (-535.748) -- 0:00:45
223000 -- [-538.143] (-536.451) (-542.613) (-539.794) * (-535.575) [-535.221] (-537.630) (-535.239) -- 0:00:48
223500 -- (-535.474) (-536.362) (-538.785) [-535.368] * (-537.028) (-539.772) [-538.865] (-536.925) -- 0:00:48
224000 -- (-535.364) [-536.413] (-538.191) (-535.446) * (-535.106) (-538.166) [-539.239] (-535.014) -- 0:00:48
224500 -- (-534.654) [-536.265] (-536.104) (-534.934) * (-536.914) [-535.638] (-536.978) (-537.947) -- 0:00:48
225000 -- (-537.052) (-536.635) (-535.067) [-536.351] * (-534.860) (-535.366) [-537.082] (-536.318) -- 0:00:48
Average standard deviation of split frequencies: 0.014705
225500 -- [-536.648] (-536.603) (-535.789) (-539.175) * (-536.480) (-538.946) [-535.214] (-535.103) -- 0:00:48
226000 -- [-538.222] (-539.442) (-536.628) (-536.230) * (-535.817) (-542.363) (-537.743) [-535.145] -- 0:00:47
226500 -- (-536.740) (-535.668) (-537.819) [-537.862] * [-534.632] (-542.591) (-538.370) (-535.333) -- 0:00:47
227000 -- [-535.903] (-535.947) (-535.069) (-534.926) * [-536.050] (-536.121) (-536.808) (-535.694) -- 0:00:47
227500 -- (-540.155) (-535.603) [-535.761] (-536.255) * (-538.856) (-539.351) [-537.221] (-536.714) -- 0:00:47
228000 -- (-534.992) (-536.075) (-536.530) [-535.431] * (-535.914) [-535.775] (-539.059) (-537.359) -- 0:00:47
228500 -- (-534.115) (-535.155) (-537.675) [-534.653] * [-537.254] (-536.077) (-537.267) (-537.012) -- 0:00:47
229000 -- (-537.834) (-537.122) (-541.423) [-534.431] * (-539.621) (-539.594) [-537.423] (-540.724) -- 0:00:47
229500 -- (-542.167) (-535.822) (-536.802) [-537.473] * (-537.670) [-538.623] (-535.966) (-540.869) -- 0:00:47
230000 -- (-537.242) [-535.465] (-536.778) (-536.941) * (-539.134) (-536.290) (-537.810) [-534.686] -- 0:00:46
Average standard deviation of split frequencies: 0.014521
230500 -- [-535.874] (-534.910) (-534.876) (-537.431) * [-539.864] (-536.430) (-537.558) (-536.127) -- 0:00:46
231000 -- (-538.653) (-535.615) (-537.132) [-534.577] * (-540.606) [-536.317] (-536.792) (-539.081) -- 0:00:46
231500 -- [-536.169] (-535.717) (-538.367) (-534.853) * (-535.239) (-537.918) (-538.648) [-536.119] -- 0:00:46
232000 -- (-536.970) (-536.354) [-535.098] (-537.445) * (-535.686) (-537.684) (-535.198) [-535.105] -- 0:00:46
232500 -- (-536.404) [-534.980] (-539.251) (-534.748) * (-535.672) [-535.459] (-535.908) (-534.923) -- 0:00:46
233000 -- (-538.701) (-536.381) (-536.674) [-534.899] * (-535.368) [-540.073] (-537.590) (-539.795) -- 0:00:46
233500 -- (-540.224) (-538.051) [-536.756] (-535.695) * (-536.114) (-536.579) (-536.225) [-535.400] -- 0:00:45
234000 -- [-539.099] (-535.194) (-535.235) (-539.061) * (-542.287) (-538.057) (-538.075) [-537.084] -- 0:00:45
234500 -- (-536.711) (-540.492) [-536.098] (-537.363) * (-535.972) [-534.557] (-536.835) (-539.116) -- 0:00:45
235000 -- (-539.277) [-535.439] (-537.445) (-538.248) * (-536.182) [-538.104] (-539.105) (-543.176) -- 0:00:45
Average standard deviation of split frequencies: 0.015244
235500 -- [-535.499] (-537.472) (-536.754) (-537.968) * [-539.072] (-536.273) (-539.493) (-538.119) -- 0:00:45
236000 -- (-535.810) (-537.006) (-537.585) [-534.926] * [-537.353] (-537.195) (-537.554) (-536.409) -- 0:00:45
236500 -- (-534.438) [-536.759] (-536.942) (-535.840) * (-535.712) (-537.551) [-536.432] (-539.290) -- 0:00:45
237000 -- (-541.422) (-539.285) (-537.663) [-538.468] * (-537.774) (-538.029) [-540.149] (-538.008) -- 0:00:45
237500 -- (-537.912) [-535.878] (-536.025) (-538.208) * (-536.215) [-537.033] (-542.748) (-535.723) -- 0:00:44
238000 -- (-536.927) [-537.778] (-536.190) (-534.795) * (-536.086) (-537.688) (-536.093) [-540.475] -- 0:00:44
238500 -- (-540.798) (-536.007) (-535.775) [-534.595] * (-537.779) [-537.661] (-538.884) (-537.484) -- 0:00:44
239000 -- [-536.715] (-539.180) (-536.370) (-537.666) * (-536.225) [-535.840] (-534.919) (-536.142) -- 0:00:44
239500 -- (-534.804) (-537.135) (-538.441) [-535.738] * (-537.212) [-536.243] (-535.707) (-535.182) -- 0:00:44
240000 -- (-536.262) (-535.165) [-535.880] (-538.910) * (-534.440) [-535.050] (-536.883) (-537.651) -- 0:00:47
Average standard deviation of split frequencies: 0.015876
240500 -- (-536.450) (-535.585) [-535.913] (-536.420) * (-537.088) [-536.243] (-535.583) (-540.431) -- 0:00:47
241000 -- (-535.965) [-534.766] (-534.983) (-537.409) * (-536.182) (-536.766) (-534.967) [-536.718] -- 0:00:47
241500 -- (-538.184) (-537.936) [-537.375] (-536.615) * (-538.729) (-534.805) (-538.350) [-542.985] -- 0:00:47
242000 -- [-537.226] (-537.307) (-534.854) (-537.835) * [-539.846] (-536.844) (-537.931) (-536.726) -- 0:00:46
242500 -- (-543.798) (-537.537) [-534.895] (-535.211) * (-536.515) (-539.294) (-534.919) [-535.059] -- 0:00:46
243000 -- (-538.586) (-535.942) (-538.680) [-538.523] * (-536.894) (-540.007) [-534.584] (-535.880) -- 0:00:46
243500 -- [-537.801] (-536.803) (-536.323) (-538.000) * [-536.143] (-536.130) (-536.623) (-535.694) -- 0:00:46
244000 -- (-536.566) (-535.858) [-535.809] (-538.451) * [-535.111] (-534.622) (-539.138) (-536.667) -- 0:00:46
244500 -- [-536.129] (-543.791) (-537.018) (-541.185) * (-536.107) (-536.402) (-535.909) [-534.720] -- 0:00:46
245000 -- [-534.284] (-537.570) (-540.418) (-540.451) * (-541.217) (-536.041) [-534.829] (-536.303) -- 0:00:46
Average standard deviation of split frequencies: 0.016863
245500 -- (-536.163) [-536.031] (-535.665) (-536.384) * [-535.013] (-535.000) (-539.043) (-537.586) -- 0:00:46
246000 -- (-534.657) [-536.171] (-534.488) (-537.877) * (-535.845) (-535.412) [-537.419] (-536.464) -- 0:00:45
246500 -- (-536.334) [-535.271] (-535.466) (-537.167) * [-537.087] (-535.792) (-537.176) (-536.917) -- 0:00:45
247000 -- [-535.800] (-535.729) (-535.340) (-535.140) * (-539.094) [-535.063] (-536.818) (-538.464) -- 0:00:45
247500 -- (-537.442) (-537.140) (-538.795) [-535.898] * (-535.156) [-536.713] (-535.149) (-534.928) -- 0:00:45
248000 -- [-535.199] (-534.332) (-536.957) (-535.183) * (-535.701) [-538.137] (-535.875) (-535.637) -- 0:00:45
248500 -- (-535.814) (-537.522) (-536.279) [-534.791] * (-536.312) (-537.047) (-534.985) [-535.442] -- 0:00:45
249000 -- (-536.742) (-536.087) [-543.188] (-536.825) * (-538.371) [-536.159] (-535.022) (-535.638) -- 0:00:45
249500 -- (-537.199) [-538.597] (-537.227) (-535.815) * [-535.554] (-537.566) (-536.541) (-536.595) -- 0:00:45
250000 -- (-536.528) (-535.533) (-536.820) [-535.511] * [-534.519] (-538.584) (-538.762) (-535.555) -- 0:00:45
Average standard deviation of split frequencies: 0.017019
250500 -- [-536.188] (-535.579) (-540.595) (-536.250) * (-534.662) [-537.096] (-536.064) (-536.782) -- 0:00:44
251000 -- (-538.255) (-536.158) [-537.848] (-538.062) * (-534.591) (-536.620) [-534.923] (-534.853) -- 0:00:44
251500 -- (-535.882) [-534.981] (-537.065) (-539.596) * [-535.555] (-538.384) (-538.780) (-537.640) -- 0:00:44
252000 -- (-536.484) (-534.768) [-537.034] (-535.412) * (-536.148) [-534.979] (-536.802) (-537.149) -- 0:00:44
252500 -- (-536.055) (-541.068) [-538.024] (-535.893) * (-536.121) [-538.634] (-535.913) (-537.206) -- 0:00:44
253000 -- (-537.603) (-535.723) [-534.997] (-538.814) * [-535.336] (-535.900) (-534.729) (-534.282) -- 0:00:44
253500 -- [-537.130] (-534.622) (-537.080) (-537.687) * [-535.523] (-535.368) (-535.815) (-536.891) -- 0:00:44
254000 -- [-535.504] (-538.811) (-539.312) (-538.094) * (-537.118) (-535.540) [-535.520] (-539.317) -- 0:00:44
254500 -- (-538.081) [-536.015] (-535.088) (-535.427) * (-541.325) [-535.903] (-534.216) (-536.241) -- 0:00:43
255000 -- (-538.599) (-536.718) (-534.261) [-534.814] * (-536.142) [-535.393] (-542.246) (-536.116) -- 0:00:46
Average standard deviation of split frequencies: 0.015652
255500 -- (-534.575) (-535.848) [-537.375] (-537.600) * (-535.696) (-535.890) [-541.244] (-536.831) -- 0:00:46
256000 -- (-538.453) [-538.307] (-538.615) (-539.772) * (-536.400) (-538.218) [-536.668] (-536.739) -- 0:00:46
256500 -- (-538.893) (-536.133) [-535.428] (-535.287) * (-535.694) (-536.642) (-541.767) [-535.894] -- 0:00:46
257000 -- (-535.361) (-537.314) [-535.744] (-535.469) * (-538.760) [-534.301] (-537.126) (-537.916) -- 0:00:46
257500 -- [-534.888] (-541.284) (-535.519) (-536.365) * (-540.498) (-538.788) [-536.408] (-539.611) -- 0:00:46
258000 -- (-539.179) [-537.865] (-536.193) (-537.836) * (-536.046) (-535.449) (-536.656) [-538.715] -- 0:00:46
258500 -- (-536.209) (-538.101) [-535.312] (-535.183) * (-536.801) (-534.282) [-537.378] (-540.057) -- 0:00:45
259000 -- (-535.972) (-537.744) [-538.368] (-536.757) * (-536.039) [-534.641] (-536.752) (-538.195) -- 0:00:45
259500 -- (-536.007) (-536.346) (-537.196) [-537.298] * (-542.634) (-535.754) [-539.903] (-537.054) -- 0:00:45
260000 -- (-535.982) (-536.431) [-536.637] (-542.467) * (-537.687) (-536.605) [-538.167] (-537.413) -- 0:00:45
Average standard deviation of split frequencies: 0.014563
260500 -- (-541.655) (-535.456) [-536.443] (-539.852) * (-538.256) (-536.772) (-543.347) [-537.094] -- 0:00:45
261000 -- [-539.462] (-535.932) (-535.507) (-536.904) * (-538.084) (-535.668) [-536.388] (-538.638) -- 0:00:45
261500 -- (-534.796) (-538.127) (-535.615) [-538.333] * (-535.128) [-537.245] (-536.820) (-535.700) -- 0:00:45
262000 -- (-535.142) [-537.764] (-534.375) (-538.026) * (-537.256) (-537.169) [-539.643] (-536.580) -- 0:00:45
262500 -- (-537.992) [-539.108] (-537.141) (-537.631) * [-537.197] (-535.086) (-534.688) (-536.151) -- 0:00:44
263000 -- (-539.727) (-536.688) (-539.007) [-538.194] * (-538.925) (-534.358) (-534.788) [-542.032] -- 0:00:44
263500 -- (-535.971) (-534.842) [-536.845] (-536.004) * (-541.607) [-537.798] (-534.572) (-535.140) -- 0:00:44
264000 -- (-535.416) (-536.852) (-536.648) [-535.832] * (-538.242) (-535.996) (-535.646) [-540.087] -- 0:00:44
264500 -- (-536.946) (-536.648) [-536.058] (-538.448) * [-535.667] (-535.649) (-534.377) (-539.166) -- 0:00:44
265000 -- (-535.972) (-536.816) [-535.726] (-536.965) * (-535.689) (-535.649) [-535.367] (-536.590) -- 0:00:44
Average standard deviation of split frequencies: 0.014644
265500 -- (-541.595) (-536.605) [-535.987] (-536.940) * (-535.752) (-543.360) [-536.001] (-539.643) -- 0:00:44
266000 -- (-544.097) (-538.874) [-535.505] (-538.050) * [-535.420] (-536.162) (-538.116) (-537.239) -- 0:00:44
266500 -- (-535.697) (-535.879) (-537.312) [-535.508] * (-536.062) [-537.336] (-540.724) (-537.091) -- 0:00:44
267000 -- [-536.701] (-535.248) (-538.548) (-537.936) * (-537.424) (-537.598) (-537.050) [-534.394] -- 0:00:43
267500 -- (-537.050) [-536.142] (-534.787) (-537.500) * (-537.330) [-536.026] (-535.130) (-535.947) -- 0:00:43
268000 -- (-537.012) (-538.335) (-535.985) [-535.509] * [-535.432] (-534.369) (-536.522) (-535.924) -- 0:00:43
268500 -- [-535.664] (-543.010) (-535.347) (-538.688) * [-534.436] (-534.537) (-537.267) (-536.066) -- 0:00:43
269000 -- (-536.312) (-537.449) (-540.537) [-535.006] * (-537.845) (-535.426) (-535.717) [-538.367] -- 0:00:43
269500 -- (-537.385) (-538.623) (-537.767) [-535.702] * (-536.593) (-535.415) (-537.147) [-534.454] -- 0:00:43
270000 -- [-536.641] (-535.578) (-539.814) (-536.344) * (-542.673) (-535.268) [-534.979] (-534.209) -- 0:00:43
Average standard deviation of split frequencies: 0.015125
270500 -- [-535.689] (-535.383) (-534.651) (-536.485) * [-538.344] (-536.101) (-534.555) (-542.703) -- 0:00:43
271000 -- (-535.255) [-537.577] (-535.332) (-536.010) * (-542.553) (-536.272) (-537.782) [-536.125] -- 0:00:43
271500 -- (-536.944) (-536.382) [-534.674] (-534.936) * (-540.350) (-536.182) [-536.893] (-534.809) -- 0:00:42
272000 -- (-535.485) (-536.602) [-536.632] (-535.318) * (-538.511) (-534.377) (-537.398) [-534.942] -- 0:00:45
272500 -- (-535.781) [-536.135] (-537.256) (-536.966) * [-537.389] (-535.640) (-534.960) (-534.917) -- 0:00:45
273000 -- [-536.702] (-539.654) (-536.711) (-534.558) * [-534.787] (-535.711) (-537.948) (-535.657) -- 0:00:45
273500 -- [-536.370] (-535.599) (-537.945) (-536.625) * (-535.703) (-535.507) (-540.536) [-536.348] -- 0:00:45
274000 -- [-537.211] (-537.366) (-537.696) (-534.647) * [-536.691] (-535.064) (-534.978) (-536.890) -- 0:00:45
274500 -- (-537.405) (-535.448) [-540.103] (-538.894) * [-536.318] (-538.893) (-536.296) (-537.222) -- 0:00:44
275000 -- [-537.498] (-535.460) (-536.985) (-535.330) * (-537.228) (-540.093) [-535.541] (-536.448) -- 0:00:44
Average standard deviation of split frequencies: 0.014518
275500 -- (-536.905) (-535.553) (-536.484) [-538.623] * (-534.340) (-536.017) [-539.283] (-538.090) -- 0:00:44
276000 -- (-535.077) (-534.411) [-537.077] (-536.254) * (-538.118) [-539.913] (-537.467) (-540.061) -- 0:00:44
276500 -- (-535.037) (-536.576) (-535.081) [-536.623] * [-538.602] (-536.171) (-539.428) (-538.286) -- 0:00:44
277000 -- [-535.029] (-541.645) (-536.619) (-536.000) * (-535.987) [-535.926] (-535.838) (-538.095) -- 0:00:44
277500 -- [-536.016] (-535.191) (-536.439) (-536.677) * [-535.078] (-535.227) (-537.355) (-536.523) -- 0:00:44
278000 -- (-535.737) [-534.838] (-536.556) (-541.313) * (-536.325) (-534.686) [-535.965] (-537.587) -- 0:00:44
278500 -- (-534.898) [-534.844] (-539.160) (-536.212) * (-537.366) [-534.643] (-539.161) (-534.990) -- 0:00:44
279000 -- (-536.482) [-536.837] (-535.824) (-536.338) * (-538.558) [-535.016] (-539.092) (-536.499) -- 0:00:43
279500 -- (-537.068) [-536.818] (-537.593) (-539.292) * (-535.900) [-537.408] (-538.104) (-535.348) -- 0:00:43
280000 -- (-534.257) (-536.125) [-534.833] (-536.316) * (-534.723) [-534.939] (-535.739) (-536.308) -- 0:00:43
Average standard deviation of split frequencies: 0.015558
280500 -- (-536.101) [-535.592] (-535.036) (-536.498) * (-534.949) (-534.762) (-538.239) [-538.874] -- 0:00:43
281000 -- (-534.651) [-536.883] (-534.452) (-536.873) * (-535.398) (-539.227) (-541.290) [-536.556] -- 0:00:43
281500 -- (-538.167) (-537.984) [-534.388] (-535.762) * (-535.404) (-535.204) (-537.400) [-535.102] -- 0:00:43
282000 -- (-536.040) [-536.531] (-534.927) (-537.958) * [-537.116] (-534.718) (-535.411) (-537.360) -- 0:00:43
282500 -- (-540.068) (-534.832) (-538.323) [-534.883] * (-535.194) (-535.629) [-536.755] (-534.914) -- 0:00:43
283000 -- (-535.522) (-536.200) (-535.436) [-540.857] * (-536.214) (-536.641) [-537.087] (-538.710) -- 0:00:43
283500 -- [-534.531] (-537.150) (-539.843) (-536.131) * [-535.901] (-536.925) (-537.317) (-538.539) -- 0:00:42
284000 -- (-538.617) (-535.176) (-535.421) [-536.089] * [-536.747] (-534.754) (-535.880) (-535.784) -- 0:00:42
284500 -- (-535.452) [-535.852] (-536.278) (-538.126) * [-534.901] (-540.970) (-535.972) (-539.621) -- 0:00:42
285000 -- (-537.654) (-536.495) (-536.834) [-537.157] * (-535.975) [-536.649] (-534.863) (-542.437) -- 0:00:42
Average standard deviation of split frequencies: 0.015329
285500 -- (-535.820) [-535.767] (-536.062) (-535.680) * (-539.790) [-539.831] (-536.298) (-536.602) -- 0:00:42
286000 -- [-537.813] (-536.180) (-538.799) (-536.652) * (-535.504) [-535.116] (-538.566) (-542.649) -- 0:00:42
286500 -- (-536.266) (-534.907) [-534.756] (-535.149) * (-538.229) [-536.348] (-539.181) (-535.876) -- 0:00:42
287000 -- (-536.888) [-537.605] (-538.733) (-539.274) * (-537.310) [-537.244] (-537.545) (-541.135) -- 0:00:42
287500 -- (-539.215) (-534.358) [-538.695] (-537.705) * (-535.788) [-535.143] (-535.774) (-538.070) -- 0:00:42
288000 -- (-538.124) [-535.798] (-536.748) (-544.743) * (-535.115) (-536.076) (-536.029) [-536.199] -- 0:00:44
288500 -- (-539.610) [-537.326] (-536.106) (-535.417) * (-536.093) (-536.399) (-535.127) [-536.429] -- 0:00:44
289000 -- (-536.977) (-537.093) [-534.699] (-536.487) * (-538.570) (-538.685) (-536.372) [-537.606] -- 0:00:44
289500 -- (-536.379) [-535.869] (-537.046) (-535.883) * (-536.490) (-537.609) [-538.062] (-535.657) -- 0:00:44
290000 -- (-535.344) [-535.419] (-535.313) (-535.307) * (-534.811) (-534.634) [-540.743] (-534.629) -- 0:00:44
Average standard deviation of split frequencies: 0.015621
290500 -- (-535.399) (-535.719) (-536.444) [-537.015] * (-534.421) (-538.948) (-538.170) [-534.458] -- 0:00:43
291000 -- [-534.761] (-535.622) (-535.417) (-537.214) * (-535.916) (-535.869) (-536.649) [-535.532] -- 0:00:43
291500 -- [-535.963] (-534.878) (-545.756) (-535.467) * (-535.470) [-535.743] (-538.213) (-534.832) -- 0:00:43
292000 -- [-537.025] (-536.631) (-535.282) (-535.709) * (-536.865) [-536.016] (-536.591) (-538.472) -- 0:00:43
292500 -- (-537.151) [-534.420] (-536.491) (-537.442) * (-541.496) (-536.222) (-536.319) [-537.220] -- 0:00:43
293000 -- (-537.442) (-535.709) (-535.114) [-538.294] * (-539.224) (-535.830) (-536.006) [-535.408] -- 0:00:43
293500 -- (-539.634) [-535.219] (-536.391) (-535.924) * [-536.960] (-534.624) (-536.951) (-534.555) -- 0:00:43
294000 -- (-537.372) [-536.125] (-538.034) (-535.271) * (-539.313) (-539.985) (-534.957) [-534.534] -- 0:00:43
294500 -- (-534.482) (-536.046) (-540.996) [-535.057] * (-535.868) (-540.255) [-537.264] (-535.087) -- 0:00:43
295000 -- (-535.288) (-535.319) [-538.418] (-534.551) * (-538.154) (-537.465) (-537.596) [-535.201] -- 0:00:43
Average standard deviation of split frequencies: 0.015687
295500 -- [-535.730] (-537.155) (-537.460) (-534.799) * [-539.807] (-536.963) (-540.793) (-534.943) -- 0:00:42
296000 -- (-535.407) (-536.800) (-537.675) [-537.677] * (-535.688) [-536.138] (-536.961) (-535.405) -- 0:00:42
296500 -- [-534.445] (-536.834) (-539.083) (-535.607) * (-539.366) [-536.553] (-538.858) (-538.592) -- 0:00:42
297000 -- [-537.035] (-539.856) (-536.195) (-538.049) * (-539.949) [-538.232] (-534.570) (-538.085) -- 0:00:42
297500 -- [-536.742] (-535.815) (-536.138) (-534.554) * (-535.662) [-536.706] (-537.743) (-534.949) -- 0:00:42
298000 -- [-534.447] (-539.017) (-535.649) (-534.926) * [-539.381] (-535.364) (-536.851) (-537.197) -- 0:00:42
298500 -- (-534.427) (-535.510) [-535.055] (-535.343) * (-534.917) (-536.459) (-535.912) [-537.432] -- 0:00:42
299000 -- (-536.540) [-537.926] (-536.103) (-535.412) * (-537.125) [-534.460] (-536.582) (-537.363) -- 0:00:42
299500 -- (-536.305) (-536.900) [-536.066] (-535.456) * (-537.180) (-535.086) (-538.329) [-536.134] -- 0:00:42
300000 -- (-538.106) [-537.176] (-537.710) (-534.499) * (-537.433) (-539.205) [-535.358] (-536.848) -- 0:00:42
Average standard deviation of split frequencies: 0.015914
300500 -- (-538.454) (-537.077) [-536.597] (-538.037) * (-536.168) (-540.589) (-535.294) [-534.867] -- 0:00:41
301000 -- (-537.470) [-538.110] (-535.238) (-539.877) * (-536.312) (-538.479) [-536.661] (-534.429) -- 0:00:41
301500 -- (-536.329) (-535.499) [-534.685] (-543.651) * [-535.771] (-537.647) (-536.657) (-535.653) -- 0:00:41
302000 -- (-538.888) (-536.001) (-536.198) [-536.829] * (-537.569) [-538.232] (-536.542) (-536.683) -- 0:00:41
302500 -- (-541.576) (-536.508) (-537.227) [-535.744] * (-536.121) (-535.865) (-537.692) [-535.216] -- 0:00:41
303000 -- (-540.173) (-543.371) (-538.462) [-538.710] * (-536.547) (-537.812) (-536.126) [-536.107] -- 0:00:41
303500 -- [-535.684] (-540.568) (-536.953) (-536.662) * [-536.111] (-537.437) (-537.749) (-536.315) -- 0:00:41
304000 -- [-537.520] (-535.455) (-535.980) (-536.696) * (-535.277) (-539.714) [-536.765] (-535.747) -- 0:00:41
304500 -- [-535.667] (-534.584) (-535.411) (-539.318) * (-536.554) (-538.198) (-535.593) [-535.794] -- 0:00:43
305000 -- (-535.296) (-537.063) [-535.433] (-536.923) * [-537.397] (-537.267) (-537.009) (-537.180) -- 0:00:43
Average standard deviation of split frequencies: 0.015636
305500 -- [-539.047] (-538.309) (-537.096) (-541.990) * (-536.400) [-537.291] (-535.261) (-539.212) -- 0:00:43
306000 -- (-537.056) (-536.580) [-537.943] (-538.756) * (-540.183) (-535.205) [-536.296] (-538.534) -- 0:00:43
306500 -- [-535.636] (-535.539) (-539.949) (-536.439) * [-535.577] (-535.557) (-535.079) (-537.970) -- 0:00:42
307000 -- (-538.577) [-537.112] (-537.602) (-538.868) * (-538.783) [-535.224] (-535.699) (-534.994) -- 0:00:42
307500 -- (-538.694) [-535.996] (-537.136) (-535.949) * [-534.623] (-536.847) (-534.965) (-538.479) -- 0:00:42
308000 -- (-535.775) (-536.519) (-534.933) [-534.502] * (-539.778) (-535.293) (-536.908) [-535.601] -- 0:00:42
308500 -- [-536.254] (-535.284) (-537.493) (-538.082) * [-537.640] (-535.765) (-536.989) (-537.816) -- 0:00:42
309000 -- (-536.839) (-534.996) (-538.476) [-538.153] * (-534.684) (-535.111) (-539.435) [-536.645] -- 0:00:42
309500 -- (-541.066) (-536.166) [-537.213] (-538.415) * (-535.635) (-535.641) [-536.510] (-536.525) -- 0:00:42
310000 -- [-538.544] (-536.302) (-537.096) (-538.043) * (-538.058) [-536.680] (-536.337) (-536.057) -- 0:00:42
Average standard deviation of split frequencies: 0.015334
310500 -- (-536.388) (-535.475) [-535.108] (-535.664) * (-534.944) (-535.607) [-536.707] (-537.579) -- 0:00:42
311000 -- (-535.343) (-536.813) [-534.129] (-537.541) * (-534.584) [-534.492] (-536.861) (-534.894) -- 0:00:42
311500 -- (-538.261) (-536.530) [-538.165] (-537.436) * (-536.561) (-534.546) (-536.202) [-534.972] -- 0:00:41
312000 -- [-536.893] (-537.732) (-537.691) (-537.906) * (-534.438) (-534.480) [-537.718] (-534.860) -- 0:00:41
312500 -- (-535.246) (-537.548) [-536.152] (-536.116) * (-536.361) [-536.610] (-534.929) (-537.103) -- 0:00:41
313000 -- [-536.332] (-534.895) (-540.405) (-535.519) * (-536.616) (-535.561) (-535.207) [-536.913] -- 0:00:41
313500 -- (-535.677) (-537.719) (-535.956) [-535.665] * [-537.654] (-536.725) (-535.753) (-539.301) -- 0:00:41
314000 -- (-540.928) (-536.408) [-537.158] (-538.018) * [-535.542] (-535.389) (-535.070) (-536.683) -- 0:00:41
314500 -- (-537.452) (-535.948) [-538.189] (-538.644) * (-534.125) (-537.614) [-536.554] (-535.840) -- 0:00:41
315000 -- (-538.992) (-540.291) [-535.097] (-537.312) * (-537.423) (-535.194) [-536.428] (-534.715) -- 0:00:41
Average standard deviation of split frequencies: 0.015153
315500 -- [-541.103] (-541.952) (-539.558) (-535.070) * (-535.905) [-535.446] (-536.870) (-538.100) -- 0:00:41
316000 -- (-537.032) (-537.642) (-536.414) [-535.230] * (-536.984) (-534.648) [-536.041] (-535.631) -- 0:00:41
316500 -- [-536.552] (-535.265) (-537.259) (-535.989) * (-536.368) [-535.521] (-536.554) (-535.218) -- 0:00:41
317000 -- (-536.883) [-536.029] (-537.841) (-536.942) * (-535.299) [-536.215] (-535.958) (-536.595) -- 0:00:40
317500 -- (-539.630) (-539.504) [-538.263] (-536.416) * (-536.891) [-535.812] (-535.901) (-537.061) -- 0:00:40
318000 -- [-536.337] (-537.130) (-535.064) (-540.483) * (-537.140) [-535.700] (-536.446) (-538.845) -- 0:00:40
318500 -- [-538.848] (-536.100) (-537.075) (-540.136) * [-536.357] (-536.343) (-537.623) (-536.360) -- 0:00:40
319000 -- [-536.514] (-534.731) (-534.592) (-537.265) * (-535.587) [-535.556] (-538.173) (-536.862) -- 0:00:40
319500 -- (-537.783) [-536.033] (-534.470) (-537.164) * [-538.764] (-534.648) (-540.588) (-538.052) -- 0:00:40
320000 -- (-535.398) [-539.392] (-535.254) (-538.213) * (-535.032) [-534.431] (-539.303) (-537.188) -- 0:00:40
Average standard deviation of split frequencies: 0.014933
320500 -- (-537.538) [-537.011] (-536.475) (-537.881) * [-535.424] (-534.922) (-535.205) (-536.240) -- 0:00:40
321000 -- (-536.059) (-535.986) (-537.456) [-535.129] * (-536.663) [-534.614] (-541.371) (-538.199) -- 0:00:42
321500 -- (-534.856) (-538.038) (-537.416) [-536.762] * (-539.982) (-539.434) (-547.645) [-537.334] -- 0:00:42
322000 -- (-536.078) (-536.180) [-534.326] (-536.409) * [-537.713] (-536.926) (-535.320) (-536.347) -- 0:00:42
322500 -- (-540.565) (-537.408) (-535.540) [-536.075] * (-537.640) (-538.672) (-535.655) [-536.053] -- 0:00:42
323000 -- [-535.337] (-538.448) (-535.522) (-534.485) * [-535.363] (-536.873) (-535.272) (-536.304) -- 0:00:41
323500 -- [-538.204] (-539.039) (-539.734) (-534.447) * (-534.434) (-535.073) [-534.957] (-538.319) -- 0:00:41
324000 -- [-540.866] (-537.480) (-539.930) (-536.401) * (-536.706) (-535.453) (-537.086) [-535.632] -- 0:00:41
324500 -- [-534.749] (-538.941) (-536.099) (-538.725) * [-536.861] (-536.753) (-534.769) (-535.562) -- 0:00:41
325000 -- (-534.864) (-534.771) (-535.506) [-536.408] * [-535.267] (-538.570) (-536.331) (-534.805) -- 0:00:41
Average standard deviation of split frequencies: 0.015450
325500 -- [-535.125] (-537.152) (-536.969) (-536.270) * (-538.260) (-539.740) [-535.144] (-535.647) -- 0:00:41
326000 -- (-536.662) [-535.694] (-535.726) (-536.498) * (-535.299) (-539.018) [-537.043] (-537.548) -- 0:00:41
326500 -- (-536.113) [-536.331] (-534.537) (-534.379) * (-536.433) (-539.687) (-535.568) [-536.168] -- 0:00:41
327000 -- (-534.929) (-538.272) [-534.889] (-536.179) * (-535.233) [-537.686] (-535.903) (-538.937) -- 0:00:41
327500 -- [-535.734] (-535.524) (-535.863) (-534.401) * (-535.844) (-534.643) (-535.501) [-536.273] -- 0:00:41
328000 -- [-539.512] (-535.377) (-535.516) (-534.547) * (-539.676) [-536.523] (-535.058) (-539.364) -- 0:00:40
328500 -- (-536.093) [-534.998] (-536.202) (-534.452) * (-535.968) (-535.594) (-539.924) [-536.829] -- 0:00:40
329000 -- (-536.497) (-536.810) (-536.159) [-540.150] * [-535.793] (-536.072) (-540.398) (-537.286) -- 0:00:40
329500 -- (-540.637) (-544.014) [-538.515] (-535.567) * [-535.657] (-535.915) (-534.877) (-536.121) -- 0:00:40
330000 -- [-538.896] (-536.337) (-536.785) (-534.994) * (-536.015) [-536.035] (-536.366) (-535.129) -- 0:00:40
Average standard deviation of split frequencies: 0.014811
330500 -- [-543.242] (-534.763) (-535.856) (-536.138) * [-535.285] (-535.003) (-538.288) (-536.181) -- 0:00:40
331000 -- (-535.241) (-536.598) (-536.294) [-535.577] * [-536.076] (-537.641) (-537.541) (-537.521) -- 0:00:40
331500 -- (-535.176) (-534.595) (-536.032) [-536.737] * [-536.417] (-537.375) (-535.881) (-536.364) -- 0:00:40
332000 -- [-534.911] (-535.623) (-536.575) (-537.699) * [-536.008] (-535.214) (-540.280) (-536.678) -- 0:00:40
332500 -- (-534.470) [-535.073] (-538.972) (-537.617) * (-534.746) (-538.133) [-534.430] (-537.225) -- 0:00:40
333000 -- (-536.069) (-535.249) [-534.704] (-539.241) * (-534.959) (-535.613) [-534.560] (-536.629) -- 0:00:40
333500 -- (-536.476) (-536.682) [-536.430] (-538.419) * [-539.142] (-535.912) (-535.161) (-536.335) -- 0:00:39
334000 -- [-534.380] (-536.342) (-537.161) (-534.633) * (-539.227) (-535.918) (-536.492) [-536.781] -- 0:00:39
334500 -- (-537.896) [-536.446] (-535.520) (-539.297) * [-536.060] (-536.039) (-536.165) (-535.475) -- 0:00:39
335000 -- (-534.888) (-537.141) (-536.596) [-538.973] * [-539.425] (-534.210) (-540.633) (-536.274) -- 0:00:39
Average standard deviation of split frequencies: 0.014547
335500 -- (-537.807) (-536.604) [-534.856] (-537.666) * [-535.159] (-537.536) (-537.084) (-535.378) -- 0:00:39
336000 -- (-538.055) (-535.467) [-536.037] (-534.941) * (-536.659) (-540.881) (-535.457) [-537.116] -- 0:00:39
336500 -- [-536.034] (-536.736) (-535.264) (-537.556) * (-538.700) (-536.660) (-534.781) [-537.227] -- 0:00:39
337000 -- [-534.533] (-539.774) (-535.726) (-535.124) * (-538.580) (-541.001) [-538.784] (-535.116) -- 0:00:39
337500 -- [-535.071] (-537.314) (-543.481) (-535.235) * [-536.796] (-535.513) (-537.538) (-537.289) -- 0:00:39
338000 -- [-536.997] (-539.266) (-542.452) (-540.395) * (-536.496) (-537.542) [-538.023] (-535.283) -- 0:00:41
338500 -- (-535.959) (-536.484) [-535.572] (-535.347) * (-540.710) (-538.514) [-534.491] (-536.338) -- 0:00:41
339000 -- [-536.525] (-537.856) (-534.824) (-535.396) * (-536.446) (-536.256) [-537.480] (-535.613) -- 0:00:40
339500 -- (-536.195) (-536.555) (-534.343) [-535.612] * [-535.042] (-536.260) (-537.799) (-538.454) -- 0:00:40
340000 -- [-535.499] (-537.123) (-535.149) (-535.621) * (-536.151) (-537.399) (-537.796) [-539.066] -- 0:00:40
Average standard deviation of split frequencies: 0.013300
340500 -- (-540.872) [-536.623] (-534.310) (-535.505) * (-536.789) (-538.798) [-536.658] (-537.200) -- 0:00:40
341000 -- [-539.211] (-535.361) (-535.123) (-536.896) * [-535.620] (-535.081) (-536.550) (-537.553) -- 0:00:40
341500 -- (-536.236) (-534.751) (-534.746) [-536.014] * (-535.107) (-536.640) (-535.365) [-537.215] -- 0:00:40
342000 -- [-538.937] (-538.242) (-539.629) (-536.441) * (-537.664) [-536.112] (-536.869) (-538.772) -- 0:00:40
342500 -- (-538.687) [-535.082] (-539.130) (-536.471) * (-536.820) (-535.715) (-536.432) [-537.451] -- 0:00:40
343000 -- (-535.440) [-536.962] (-538.031) (-536.035) * (-537.923) (-534.562) (-535.988) [-536.523] -- 0:00:40
343500 -- (-535.820) [-537.163] (-535.339) (-536.945) * (-540.314) (-536.685) [-534.645] (-535.621) -- 0:00:40
344000 -- (-534.469) (-537.432) [-539.124] (-538.443) * (-538.532) (-536.128) [-535.472] (-535.102) -- 0:00:40
344500 -- (-536.392) (-535.762) [-536.214] (-536.477) * [-536.811] (-538.627) (-535.124) (-534.452) -- 0:00:39
345000 -- [-538.691] (-538.235) (-535.162) (-535.852) * (-534.986) [-536.300] (-535.200) (-537.292) -- 0:00:39
Average standard deviation of split frequencies: 0.012565
345500 -- (-538.700) (-538.937) [-536.207] (-536.449) * [-535.956] (-535.873) (-536.397) (-538.263) -- 0:00:39
346000 -- (-543.381) [-535.411] (-536.992) (-535.542) * (-536.786) (-540.639) [-536.456] (-535.846) -- 0:00:39
346500 -- (-540.875) (-539.462) (-535.836) [-535.610] * (-537.354) (-536.573) (-534.317) [-536.079] -- 0:00:39
347000 -- (-535.779) (-540.147) [-536.104] (-535.420) * (-535.597) (-536.610) [-536.319] (-536.534) -- 0:00:39
347500 -- (-535.104) (-536.320) (-535.914) [-535.236] * (-536.921) (-537.655) [-536.387] (-536.132) -- 0:00:39
348000 -- [-535.977] (-537.164) (-537.150) (-535.280) * (-536.016) (-535.888) (-535.417) [-537.076] -- 0:00:39
348500 -- (-536.990) (-536.049) [-536.623] (-535.049) * (-539.571) [-537.409] (-535.253) (-538.138) -- 0:00:39
349000 -- [-537.993] (-535.868) (-536.703) (-536.306) * (-538.952) (-538.722) [-536.944] (-541.727) -- 0:00:39
349500 -- (-538.352) [-534.688] (-535.093) (-535.452) * [-536.041] (-541.705) (-536.155) (-537.964) -- 0:00:39
350000 -- (-537.593) [-538.672] (-537.428) (-539.783) * [-536.389] (-538.489) (-537.371) (-539.556) -- 0:00:39
Average standard deviation of split frequencies: 0.011964
350500 -- (-535.256) (-536.235) (-535.508) [-536.838] * (-536.620) (-535.032) (-535.861) [-535.353] -- 0:00:38
351000 -- [-535.432] (-534.526) (-538.058) (-539.289) * (-537.715) [-536.715] (-537.138) (-539.254) -- 0:00:38
351500 -- [-535.937] (-534.753) (-534.714) (-537.454) * (-538.192) (-537.075) (-539.096) [-536.153] -- 0:00:38
352000 -- (-535.673) (-536.414) [-535.105] (-539.457) * [-535.595] (-537.260) (-537.703) (-536.208) -- 0:00:38
352500 -- (-535.530) (-538.735) (-536.421) [-537.362] * (-534.460) [-539.678] (-535.308) (-538.426) -- 0:00:38
353000 -- (-534.940) (-535.777) (-536.119) [-536.503] * (-535.439) (-536.223) [-534.437] (-536.393) -- 0:00:40
353500 -- [-537.997] (-535.139) (-535.465) (-537.724) * (-536.670) [-538.016] (-537.439) (-536.235) -- 0:00:40
354000 -- [-535.827] (-534.511) (-535.164) (-539.999) * (-536.981) (-538.699) [-535.247] (-540.854) -- 0:00:40
354500 -- (-535.485) [-536.129] (-534.865) (-538.558) * [-536.282] (-538.190) (-537.832) (-538.495) -- 0:00:40
355000 -- (-535.609) (-535.255) (-537.145) [-535.045] * [-536.115] (-536.415) (-537.719) (-537.473) -- 0:00:39
Average standard deviation of split frequencies: 0.012580
355500 -- (-536.620) [-534.946] (-537.202) (-537.020) * (-535.782) (-536.173) (-534.554) [-538.142] -- 0:00:39
356000 -- (-536.409) (-535.879) (-539.076) [-534.699] * (-539.806) [-536.180] (-534.592) (-540.292) -- 0:00:39
356500 -- [-534.820] (-538.981) (-534.907) (-536.126) * [-537.046] (-536.081) (-534.392) (-535.872) -- 0:00:39
357000 -- (-536.840) (-537.737) (-535.805) [-534.118] * (-537.119) (-535.517) (-536.488) [-538.599] -- 0:00:39
357500 -- [-535.790] (-536.120) (-536.438) (-534.696) * [-538.054] (-535.394) (-536.454) (-534.398) -- 0:00:39
358000 -- (-537.640) [-535.815] (-536.352) (-541.625) * [-535.340] (-536.837) (-536.411) (-535.607) -- 0:00:39
358500 -- (-536.134) (-534.686) (-541.559) [-538.449] * (-538.030) (-536.278) (-538.065) [-535.868] -- 0:00:39
359000 -- (-536.180) [-536.768] (-535.677) (-534.634) * [-536.148] (-535.756) (-535.723) (-535.503) -- 0:00:39
359500 -- (-536.176) (-534.702) (-535.653) [-535.759] * (-535.691) (-543.628) [-536.020] (-540.250) -- 0:00:39
360000 -- (-541.496) (-534.299) [-534.645] (-536.530) * (-537.343) (-538.840) (-535.718) [-537.593] -- 0:00:39
Average standard deviation of split frequencies: 0.012199
360500 -- (-538.445) (-536.580) [-535.659] (-539.197) * [-536.088] (-537.420) (-534.358) (-538.168) -- 0:00:39
361000 -- (-536.437) [-537.230] (-536.741) (-534.801) * (-535.046) (-538.757) [-534.170] (-535.458) -- 0:00:38
361500 -- (-537.835) [-537.215] (-535.854) (-535.283) * (-536.488) (-540.175) (-537.321) [-540.574] -- 0:00:38
362000 -- [-537.013] (-536.463) (-535.387) (-534.757) * [-537.718] (-538.707) (-536.949) (-535.919) -- 0:00:38
362500 -- (-535.557) [-541.898] (-538.177) (-535.480) * (-537.119) (-539.199) (-537.808) [-535.034] -- 0:00:38
363000 -- [-534.894] (-535.432) (-540.533) (-536.613) * [-535.079] (-535.800) (-537.370) (-536.723) -- 0:00:38
363500 -- [-534.422] (-535.025) (-539.264) (-538.597) * [-535.829] (-538.530) (-535.636) (-535.997) -- 0:00:38
364000 -- (-535.991) [-534.501] (-537.040) (-537.652) * (-540.506) (-536.312) [-535.674] (-537.081) -- 0:00:38
364500 -- (-537.756) (-534.370) (-535.152) [-535.559] * (-538.185) [-536.657] (-534.937) (-539.576) -- 0:00:38
365000 -- (-540.377) [-537.564] (-536.364) (-538.428) * (-538.353) (-537.122) (-534.964) [-535.009] -- 0:00:38
Average standard deviation of split frequencies: 0.011377
365500 -- (-538.854) [-535.928] (-535.434) (-534.977) * (-539.984) (-534.757) (-537.645) [-534.926] -- 0:00:38
366000 -- (-538.397) (-538.065) [-534.373] (-534.924) * [-535.428] (-537.234) (-535.370) (-537.478) -- 0:00:38
366500 -- (-538.327) (-537.076) [-534.682] (-535.545) * (-535.721) (-538.039) (-541.237) [-534.749] -- 0:00:38
367000 -- (-538.155) (-539.077) (-536.344) [-541.287] * (-542.150) (-539.814) (-537.373) [-537.143] -- 0:00:37
367500 -- (-539.649) [-534.868] (-537.028) (-536.416) * (-536.133) [-536.409] (-537.187) (-535.008) -- 0:00:37
368000 -- [-535.756] (-537.163) (-535.165) (-535.975) * (-535.929) [-535.732] (-539.987) (-535.853) -- 0:00:37
368500 -- (-538.159) (-534.995) [-534.396] (-537.802) * (-538.643) [-534.708] (-534.619) (-536.675) -- 0:00:37
369000 -- [-537.714] (-535.057) (-535.354) (-536.489) * [-535.643] (-535.033) (-536.551) (-535.721) -- 0:00:37
369500 -- [-538.027] (-535.677) (-535.288) (-534.728) * [-535.745] (-535.870) (-535.438) (-537.948) -- 0:00:37
370000 -- (-535.520) (-535.685) [-534.483] (-536.371) * (-535.601) [-536.052] (-536.136) (-535.698) -- 0:00:39
Average standard deviation of split frequencies: 0.010739
370500 -- (-534.952) (-535.184) (-535.910) [-539.584] * [-536.623] (-537.681) (-536.398) (-538.046) -- 0:00:39
371000 -- [-536.512] (-535.645) (-536.884) (-537.149) * [-535.791] (-536.012) (-538.869) (-538.349) -- 0:00:38
371500 -- [-534.338] (-536.469) (-535.211) (-540.484) * (-536.736) (-535.022) [-534.896] (-535.047) -- 0:00:38
372000 -- [-535.611] (-536.188) (-535.726) (-538.293) * (-538.037) (-539.846) [-534.639] (-535.975) -- 0:00:38
372500 -- (-535.505) [-537.585] (-534.347) (-534.535) * (-535.711) [-535.321] (-536.605) (-538.040) -- 0:00:38
373000 -- (-535.419) (-535.340) [-537.644] (-538.767) * (-537.443) (-538.223) [-535.059] (-539.039) -- 0:00:38
373500 -- [-537.022] (-536.988) (-535.666) (-538.367) * (-534.573) [-540.384] (-535.581) (-539.550) -- 0:00:38
374000 -- [-539.875] (-537.110) (-536.183) (-540.398) * [-534.866] (-537.426) (-536.479) (-537.977) -- 0:00:38
374500 -- (-534.770) [-536.447] (-537.173) (-538.470) * (-535.097) [-535.503] (-539.492) (-537.580) -- 0:00:38
375000 -- (-535.538) [-538.107] (-538.048) (-534.979) * (-537.720) [-536.431] (-540.790) (-536.066) -- 0:00:38
Average standard deviation of split frequencies: 0.009891
375500 -- (-539.282) [-534.936] (-536.444) (-540.171) * (-540.029) (-535.499) (-542.197) [-534.326] -- 0:00:38
376000 -- (-534.692) (-538.268) [-536.214] (-537.581) * (-537.882) (-535.641) (-537.808) [-535.831] -- 0:00:38
376500 -- [-538.037] (-535.812) (-537.673) (-535.451) * [-535.093] (-539.012) (-540.508) (-535.975) -- 0:00:38
377000 -- (-537.499) [-538.854] (-537.812) (-540.348) * (-536.040) (-537.122) (-537.898) [-535.497] -- 0:00:38
377500 -- [-535.440] (-537.867) (-536.298) (-536.345) * [-535.449] (-535.764) (-536.636) (-537.726) -- 0:00:37
378000 -- (-535.414) [-534.888] (-535.457) (-535.959) * (-535.353) [-537.019] (-536.478) (-537.968) -- 0:00:37
378500 -- (-536.849) [-534.818] (-540.853) (-535.593) * (-535.328) [-535.707] (-534.607) (-540.966) -- 0:00:37
379000 -- [-537.073] (-534.959) (-537.374) (-537.385) * (-539.979) (-535.626) [-535.164] (-540.537) -- 0:00:37
379500 -- (-545.610) (-536.085) [-536.494] (-542.864) * [-535.911] (-535.568) (-538.519) (-540.470) -- 0:00:37
380000 -- (-537.861) [-539.021] (-535.251) (-538.576) * (-537.305) (-536.936) [-535.062] (-534.877) -- 0:00:37
Average standard deviation of split frequencies: 0.009632
380500 -- (-535.658) [-538.461] (-534.097) (-535.720) * (-535.663) [-536.244] (-539.043) (-539.343) -- 0:00:37
381000 -- (-535.178) (-538.367) [-534.802] (-537.516) * (-536.784) [-536.946] (-536.531) (-536.200) -- 0:00:37
381500 -- (-536.931) (-537.253) [-534.581] (-535.768) * (-537.215) (-534.270) [-535.486] (-537.050) -- 0:00:37
382000 -- (-538.113) (-535.970) [-535.053] (-536.035) * [-534.808] (-536.189) (-535.049) (-540.391) -- 0:00:37
382500 -- (-536.058) (-536.824) [-535.278] (-536.137) * [-534.500] (-537.123) (-536.554) (-539.888) -- 0:00:37
383000 -- (-536.229) (-538.215) [-535.097] (-535.536) * [-537.664] (-540.142) (-537.060) (-540.007) -- 0:00:37
383500 -- (-538.514) (-540.179) [-535.123] (-536.047) * (-544.160) (-535.063) (-537.065) [-539.294] -- 0:00:36
384000 -- [-537.676] (-542.078) (-537.282) (-537.360) * (-542.399) (-537.305) [-537.088] (-541.033) -- 0:00:36
384500 -- [-536.735] (-534.280) (-535.334) (-534.611) * (-539.191) (-536.034) [-535.807] (-536.002) -- 0:00:36
385000 -- (-535.019) (-535.782) [-536.287] (-537.427) * (-539.624) [-535.715] (-543.213) (-542.152) -- 0:00:36
Average standard deviation of split frequencies: 0.009384
385500 -- [-535.942] (-535.806) (-535.715) (-538.000) * (-539.928) (-534.819) (-537.828) [-539.562] -- 0:00:36
386000 -- (-536.983) (-534.940) [-534.989] (-537.458) * (-536.014) (-537.358) [-536.043] (-540.018) -- 0:00:36
386500 -- (-537.642) [-534.313] (-537.627) (-541.937) * (-535.682) (-536.808) [-535.761] (-537.200) -- 0:00:36
387000 -- (-537.932) (-536.745) (-537.410) [-534.978] * [-535.709] (-534.980) (-537.283) (-535.038) -- 0:00:38
387500 -- [-534.624] (-536.004) (-536.811) (-535.863) * (-539.461) (-536.181) (-537.437) [-538.271] -- 0:00:37
388000 -- (-534.677) (-537.654) (-536.304) [-536.022] * (-537.443) (-536.532) (-535.518) [-535.100] -- 0:00:37
388500 -- (-535.268) (-542.727) (-536.728) [-535.140] * (-535.497) (-534.654) (-534.390) [-536.912] -- 0:00:37
389000 -- (-537.804) [-534.975] (-538.086) (-536.563) * (-535.632) [-536.303] (-534.463) (-543.159) -- 0:00:37
389500 -- [-534.320] (-536.412) (-537.151) (-539.336) * [-535.472] (-534.730) (-536.155) (-536.827) -- 0:00:37
390000 -- (-535.633) (-536.896) [-540.391] (-536.808) * [-534.945] (-535.989) (-535.126) (-537.175) -- 0:00:37
Average standard deviation of split frequencies: 0.009519
390500 -- (-536.251) [-536.996] (-540.874) (-536.719) * [-537.626] (-535.840) (-535.653) (-535.759) -- 0:00:37
391000 -- [-536.583] (-536.087) (-538.695) (-536.111) * (-538.519) [-537.275] (-539.019) (-535.865) -- 0:00:37
391500 -- [-534.671] (-536.381) (-536.644) (-537.249) * [-537.236] (-534.312) (-537.035) (-535.898) -- 0:00:37
392000 -- (-535.945) (-536.234) [-536.397] (-539.955) * (-537.930) [-535.791] (-536.728) (-535.459) -- 0:00:37
392500 -- (-535.980) (-538.517) (-540.407) [-537.345] * (-536.196) (-534.690) [-538.287] (-537.681) -- 0:00:37
393000 -- (-537.709) [-534.199] (-534.300) (-536.336) * [-535.846] (-534.483) (-535.877) (-537.559) -- 0:00:37
393500 -- (-536.284) (-537.696) [-536.171] (-535.734) * (-535.454) [-539.831] (-534.910) (-534.805) -- 0:00:36
394000 -- (-538.232) (-537.848) (-536.878) [-535.987] * (-538.677) (-537.218) (-537.327) [-535.231] -- 0:00:36
394500 -- (-539.179) (-535.604) (-538.035) [-537.157] * [-538.967] (-540.328) (-534.753) (-537.829) -- 0:00:36
395000 -- [-538.919] (-535.468) (-536.229) (-536.273) * [-536.074] (-540.071) (-536.185) (-536.020) -- 0:00:36
Average standard deviation of split frequencies: 0.009589
395500 -- (-535.507) (-535.972) [-535.992] (-535.830) * (-538.660) (-539.195) [-536.237] (-536.536) -- 0:00:36
396000 -- (-535.351) (-537.312) (-537.284) [-538.662] * (-536.108) (-536.329) [-536.343] (-537.265) -- 0:00:36
396500 -- (-536.976) (-534.783) (-536.414) [-535.884] * (-541.160) (-537.663) (-537.611) [-535.172] -- 0:00:36
397000 -- (-536.132) [-534.375] (-535.614) (-538.231) * (-535.614) [-537.092] (-536.019) (-536.196) -- 0:00:36
397500 -- (-536.210) [-536.916] (-535.498) (-537.036) * (-535.142) [-535.816] (-539.033) (-534.958) -- 0:00:36
398000 -- (-536.571) [-534.477] (-534.886) (-539.913) * (-534.970) [-535.164] (-536.541) (-543.539) -- 0:00:36
398500 -- [-536.619] (-536.433) (-536.974) (-542.463) * [-538.681] (-538.342) (-539.931) (-538.688) -- 0:00:36
399000 -- (-536.670) [-535.296] (-537.212) (-540.572) * (-538.655) (-537.326) [-537.764] (-536.530) -- 0:00:36
399500 -- (-536.801) [-534.439] (-541.572) (-538.728) * (-535.962) [-536.548] (-534.697) (-536.227) -- 0:00:36
400000 -- (-536.974) (-535.872) (-535.215) [-534.818] * (-535.490) [-534.972] (-536.240) (-539.408) -- 0:00:36
Average standard deviation of split frequencies: 0.010104
400500 -- [-537.435] (-535.848) (-539.516) (-536.469) * (-538.754) [-534.794] (-540.562) (-535.775) -- 0:00:35
401000 -- (-536.257) (-536.417) (-541.530) [-535.516] * (-540.384) (-535.690) [-535.578] (-539.595) -- 0:00:35
401500 -- (-538.172) (-535.712) [-537.431] (-537.682) * (-537.154) (-535.271) (-536.725) [-537.671] -- 0:00:35
402000 -- (-536.594) (-538.200) [-536.153] (-535.466) * (-538.921) [-537.921] (-538.251) (-540.766) -- 0:00:35
402500 -- [-535.054] (-536.531) (-534.767) (-534.524) * (-540.691) [-536.724] (-538.157) (-537.955) -- 0:00:35
403000 -- (-534.678) (-536.293) (-534.597) [-536.462] * (-538.465) [-536.042] (-541.998) (-538.257) -- 0:00:35
403500 -- [-534.544] (-536.160) (-536.129) (-535.411) * (-535.447) (-535.051) (-536.627) [-538.126] -- 0:00:35
404000 -- (-535.133) [-535.929] (-536.088) (-536.792) * (-534.617) (-538.173) [-535.489] (-537.068) -- 0:00:36
404500 -- [-536.846] (-535.543) (-537.948) (-538.575) * (-537.845) [-534.950] (-537.323) (-536.753) -- 0:00:36
405000 -- [-536.825] (-539.629) (-535.573) (-536.701) * (-535.309) [-535.916] (-535.341) (-535.871) -- 0:00:36
Average standard deviation of split frequencies: 0.010586
405500 -- [-537.520] (-543.585) (-536.875) (-536.759) * (-537.964) [-535.162] (-536.401) (-535.233) -- 0:00:36
406000 -- (-535.425) (-540.324) [-538.333] (-535.578) * (-536.330) (-536.992) (-535.497) [-534.583] -- 0:00:36
406500 -- (-535.351) (-536.932) [-535.523] (-536.570) * (-537.715) [-535.175] (-539.458) (-537.331) -- 0:00:36
407000 -- (-534.685) (-538.827) [-535.553] (-537.652) * (-535.454) (-535.291) (-535.871) [-535.849] -- 0:00:36
407500 -- [-535.731] (-537.831) (-540.883) (-535.503) * (-535.897) [-534.046] (-538.394) (-535.536) -- 0:00:36
408000 -- (-534.231) (-536.019) (-540.042) [-535.372] * (-536.721) [-538.589] (-536.874) (-537.241) -- 0:00:36
408500 -- [-535.365] (-541.746) (-536.242) (-535.732) * (-535.743) (-536.790) (-537.442) [-535.708] -- 0:00:36
409000 -- [-537.974] (-537.973) (-535.593) (-535.018) * (-538.384) (-537.244) [-545.727] (-534.932) -- 0:00:36
409500 -- (-540.945) [-535.579] (-536.281) (-537.636) * (-538.759) (-539.100) (-540.048) [-536.931] -- 0:00:36
410000 -- (-543.931) [-534.333] (-536.898) (-534.816) * (-541.663) [-536.903] (-538.122) (-537.795) -- 0:00:35
Average standard deviation of split frequencies: 0.010534
410500 -- (-535.538) (-537.229) (-537.073) [-535.830] * [-534.659] (-537.679) (-535.298) (-536.030) -- 0:00:35
411000 -- (-539.558) [-536.533] (-537.692) (-535.094) * (-537.579) (-535.588) [-536.956] (-536.279) -- 0:00:35
411500 -- (-540.457) [-537.100] (-534.988) (-535.593) * (-535.838) (-535.725) (-536.805) [-535.595] -- 0:00:35
412000 -- (-536.185) (-537.771) (-537.848) [-537.699] * (-536.126) [-540.022] (-535.671) (-534.673) -- 0:00:35
412500 -- (-537.417) [-538.334] (-534.877) (-536.770) * (-535.986) (-538.913) [-534.943] (-536.111) -- 0:00:35
413000 -- (-536.634) (-539.715) [-538.649] (-538.017) * [-535.976] (-536.346) (-535.546) (-535.528) -- 0:00:35
413500 -- (-536.538) [-536.002] (-534.856) (-536.256) * (-536.707) (-535.484) [-535.000] (-536.341) -- 0:00:35
414000 -- (-535.785) [-535.540] (-539.335) (-537.708) * (-537.225) (-535.989) (-536.535) [-538.688] -- 0:00:35
414500 -- (-536.003) (-536.130) (-535.763) [-537.645] * (-537.191) (-537.993) [-536.315] (-538.360) -- 0:00:35
415000 -- (-538.232) (-535.711) (-537.535) [-535.126] * (-536.448) (-541.162) [-535.987] (-537.380) -- 0:00:35
Average standard deviation of split frequencies: 0.010269
415500 -- (-534.543) (-535.558) [-535.185] (-536.785) * (-536.793) (-535.815) (-534.885) [-534.142] -- 0:00:35
416000 -- (-535.842) [-535.429] (-535.706) (-534.967) * (-537.239) (-537.928) [-536.340] (-534.070) -- 0:00:35
416500 -- [-538.465] (-538.045) (-537.296) (-536.958) * (-535.801) (-535.914) (-535.561) [-535.032] -- 0:00:35
417000 -- [-535.311] (-543.449) (-538.107) (-537.194) * (-535.689) (-539.270) (-538.057) [-535.779] -- 0:00:34
417500 -- [-536.433] (-534.541) (-537.641) (-537.983) * (-535.302) [-535.026] (-537.391) (-536.442) -- 0:00:34
418000 -- [-537.348] (-534.321) (-539.472) (-542.404) * [-538.298] (-535.740) (-536.735) (-535.239) -- 0:00:34
418500 -- (-535.216) (-537.213) [-535.887] (-539.698) * (-539.876) (-535.487) [-537.759] (-535.728) -- 0:00:34
419000 -- (-534.585) [-535.903] (-536.496) (-535.903) * (-537.077) (-536.447) (-538.239) [-536.852] -- 0:00:34
419500 -- (-536.194) (-536.348) [-535.875] (-536.130) * (-535.554) (-537.534) [-537.439] (-535.584) -- 0:00:34
420000 -- (-540.781) (-534.884) (-536.020) [-535.236] * (-535.053) (-537.261) [-538.960] (-539.176) -- 0:00:34
Average standard deviation of split frequencies: 0.010226
420500 -- (-535.344) [-534.093] (-536.142) (-537.016) * (-537.848) (-543.711) (-536.434) [-535.924] -- 0:00:34
421000 -- (-535.094) (-536.580) (-535.592) [-536.907] * (-538.146) (-537.176) (-535.798) [-536.350] -- 0:00:35
421500 -- [-538.464] (-535.361) (-534.617) (-538.173) * (-536.047) [-536.684] (-541.968) (-535.441) -- 0:00:35
422000 -- [-536.941] (-534.524) (-534.701) (-536.111) * (-536.492) [-534.953] (-535.562) (-535.890) -- 0:00:35
422500 -- (-539.443) [-535.597] (-539.278) (-536.621) * (-538.870) (-536.263) (-535.726) [-535.141] -- 0:00:35
423000 -- (-534.503) (-535.790) (-535.738) [-535.146] * [-535.596] (-535.427) (-537.028) (-535.470) -- 0:00:35
423500 -- (-536.561) (-534.292) [-536.257] (-535.035) * (-536.842) [-534.818] (-538.458) (-537.057) -- 0:00:35
424000 -- [-535.655] (-536.253) (-538.491) (-539.243) * (-540.178) [-534.762] (-540.375) (-540.481) -- 0:00:35
424500 -- (-537.186) (-536.215) (-537.853) [-536.497] * (-536.207) (-539.463) [-534.913] (-543.297) -- 0:00:35
425000 -- (-538.565) (-536.942) (-536.034) [-534.754] * (-537.196) (-540.736) [-535.427] (-541.407) -- 0:00:35
Average standard deviation of split frequencies: 0.009959
425500 -- (-534.833) (-536.504) (-540.299) [-535.500] * (-535.626) (-538.569) (-535.851) [-535.266] -- 0:00:35
426000 -- [-535.203] (-536.961) (-538.813) (-536.067) * (-537.072) (-537.538) (-539.306) [-534.385] -- 0:00:35
426500 -- (-535.745) [-535.940] (-536.695) (-535.148) * (-537.302) (-534.787) (-534.270) [-538.079] -- 0:00:34
427000 -- [-537.429] (-546.730) (-537.948) (-536.679) * (-537.550) [-538.937] (-540.259) (-535.109) -- 0:00:34
427500 -- (-536.310) (-541.656) [-535.656] (-535.780) * (-537.044) [-535.449] (-540.787) (-537.171) -- 0:00:34
428000 -- [-536.614] (-541.757) (-536.264) (-539.859) * (-535.197) (-536.096) [-539.745] (-535.209) -- 0:00:34
428500 -- [-535.009] (-535.714) (-539.028) (-536.896) * (-538.100) [-536.038] (-543.183) (-534.305) -- 0:00:34
429000 -- (-535.854) [-535.754] (-536.916) (-535.724) * (-537.560) (-534.942) (-535.100) [-536.005] -- 0:00:34
429500 -- (-536.553) (-538.278) [-535.614] (-537.179) * (-535.471) [-534.675] (-535.897) (-537.039) -- 0:00:34
430000 -- [-536.425] (-537.245) (-535.123) (-537.903) * (-536.916) (-535.238) (-536.237) [-535.755] -- 0:00:34
Average standard deviation of split frequencies: 0.009594
430500 -- (-535.747) [-535.422] (-536.494) (-542.058) * (-540.045) [-534.715] (-535.921) (-534.578) -- 0:00:34
431000 -- (-540.259) (-535.079) (-535.617) [-540.802] * (-538.921) (-537.024) [-535.489] (-536.997) -- 0:00:34
431500 -- (-535.585) [-535.422] (-536.033) (-539.285) * (-542.416) [-536.223] (-540.390) (-534.929) -- 0:00:34
432000 -- (-535.408) (-535.367) (-536.643) [-535.342] * (-537.034) (-539.637) [-537.859] (-536.671) -- 0:00:34
432500 -- (-538.083) (-534.893) [-535.096] (-535.165) * (-535.613) [-535.471] (-539.854) (-535.814) -- 0:00:34
433000 -- (-534.585) [-534.812] (-537.321) (-534.998) * (-536.522) (-537.194) [-536.062] (-535.492) -- 0:00:34
433500 -- (-536.827) (-536.529) [-537.016] (-536.838) * (-535.601) (-539.350) [-537.659] (-537.607) -- 0:00:33
434000 -- (-534.510) (-540.417) (-536.326) [-538.142] * (-540.343) [-535.872] (-539.328) (-536.443) -- 0:00:33
434500 -- (-539.663) (-540.303) (-535.789) [-535.479] * (-540.245) [-536.831] (-535.956) (-536.337) -- 0:00:33
435000 -- (-536.520) (-539.275) (-535.860) [-535.759] * (-534.520) (-536.330) [-534.908] (-535.216) -- 0:00:33
Average standard deviation of split frequencies: 0.008920
435500 -- (-539.000) (-546.660) (-537.541) [-534.789] * [-534.542] (-535.117) (-537.919) (-534.802) -- 0:00:33
436000 -- [-535.839] (-542.976) (-535.459) (-535.554) * (-537.787) [-536.739] (-535.271) (-536.726) -- 0:00:33
436500 -- (-536.880) [-536.793] (-537.717) (-541.191) * (-535.844) (-538.789) [-534.310] (-536.812) -- 0:00:33
437000 -- (-535.165) (-536.913) (-540.913) [-541.243] * [-536.680] (-538.288) (-535.587) (-534.964) -- 0:00:34
437500 -- (-535.762) [-537.254] (-538.794) (-546.218) * (-537.493) (-536.053) (-536.890) [-535.343] -- 0:00:34
438000 -- (-538.511) (-540.894) (-535.994) [-539.250] * (-538.680) (-534.630) (-536.298) [-536.691] -- 0:00:34
438500 -- (-536.368) (-535.969) [-534.907] (-537.834) * (-536.419) (-538.284) [-537.695] (-534.966) -- 0:00:34
439000 -- (-535.527) (-535.371) [-534.947] (-537.426) * [-535.485] (-536.278) (-537.421) (-534.538) -- 0:00:34
439500 -- [-534.978] (-539.295) (-534.952) (-537.222) * (-540.691) (-536.535) (-537.900) [-535.128] -- 0:00:34
440000 -- (-537.421) [-535.678] (-537.230) (-535.029) * (-540.800) (-538.867) [-534.317] (-539.771) -- 0:00:34
Average standard deviation of split frequencies: 0.009227
440500 -- [-538.646] (-535.009) (-536.391) (-534.955) * [-540.169] (-536.651) (-534.371) (-535.684) -- 0:00:34
441000 -- (-535.315) (-538.064) (-534.923) [-534.291] * (-538.662) (-541.971) [-536.274] (-535.160) -- 0:00:34
441500 -- (-536.169) (-536.464) (-534.617) [-534.842] * (-538.455) (-537.975) (-537.386) [-539.442] -- 0:00:34
442000 -- (-534.884) (-536.032) [-534.681] (-537.835) * (-537.720) (-536.125) (-539.668) [-536.454] -- 0:00:34
442500 -- [-534.483] (-537.541) (-537.476) (-535.737) * (-539.574) (-535.424) (-549.291) [-537.868] -- 0:00:34
443000 -- (-535.046) [-535.389] (-536.814) (-539.785) * (-540.756) (-534.462) (-535.332) [-535.557] -- 0:00:33
443500 -- (-535.885) (-534.961) [-534.788] (-536.997) * (-539.752) [-534.414] (-535.163) (-539.971) -- 0:00:33
444000 -- (-539.163) [-534.980] (-534.824) (-536.832) * (-543.309) (-534.378) [-535.317] (-534.886) -- 0:00:33
444500 -- (-535.959) (-535.342) (-536.727) [-540.486] * (-539.899) [-534.356] (-540.483) (-537.272) -- 0:00:33
445000 -- (-537.800) (-537.158) (-536.309) [-538.960] * (-537.409) [-536.269] (-539.590) (-536.731) -- 0:00:33
Average standard deviation of split frequencies: 0.009314
445500 -- (-534.248) (-535.463) (-537.600) [-539.540] * [-535.833] (-534.935) (-537.338) (-537.747) -- 0:00:33
446000 -- (-538.051) (-534.839) (-539.055) [-536.024] * [-537.436] (-534.263) (-536.433) (-534.845) -- 0:00:33
446500 -- (-534.518) (-538.315) (-536.686) [-535.108] * [-536.679] (-537.814) (-540.079) (-535.743) -- 0:00:33
447000 -- (-537.452) [-534.186] (-536.153) (-538.760) * [-535.123] (-536.165) (-545.017) (-535.258) -- 0:00:33
447500 -- (-536.408) [-534.880] (-536.487) (-535.438) * (-535.344) (-539.482) (-539.953) [-535.125] -- 0:00:33
448000 -- (-536.549) (-536.185) [-540.819] (-535.459) * (-534.798) (-540.332) (-538.768) [-534.381] -- 0:00:33
448500 -- (-538.776) [-536.318] (-538.301) (-541.039) * (-538.477) [-538.154] (-541.880) (-537.157) -- 0:00:33
449000 -- (-535.925) (-535.790) (-538.194) [-536.289] * (-535.524) (-540.644) [-536.008] (-537.270) -- 0:00:33
449500 -- (-536.021) (-535.301) [-535.959] (-539.935) * (-538.901) (-536.176) (-536.267) [-537.843] -- 0:00:33
450000 -- (-538.492) [-535.993] (-536.062) (-538.443) * (-539.502) (-534.885) (-539.057) [-534.903] -- 0:00:33
Average standard deviation of split frequencies: 0.009623
450500 -- [-537.457] (-536.462) (-535.655) (-535.001) * (-542.627) [-535.552] (-535.562) (-537.134) -- 0:00:32
451000 -- (-536.859) (-538.673) (-538.142) [-535.444] * (-542.104) (-535.289) [-536.820] (-536.521) -- 0:00:32
451500 -- (-535.617) [-536.216] (-537.940) (-535.454) * [-536.993] (-535.045) (-536.209) (-535.849) -- 0:00:32
452000 -- (-539.269) (-536.652) (-536.274) [-537.574] * (-535.000) (-536.581) (-535.024) [-535.812] -- 0:00:32
452500 -- (-535.621) (-537.904) (-535.567) [-535.722] * (-536.060) (-536.009) (-540.430) [-537.750] -- 0:00:32
453000 -- (-537.967) [-535.100] (-536.097) (-536.819) * (-536.115) [-536.627] (-538.649) (-536.317) -- 0:00:33
453500 -- [-537.143] (-536.970) (-535.193) (-535.791) * (-534.502) [-536.279] (-535.510) (-541.506) -- 0:00:33
454000 -- (-536.056) (-539.748) (-537.057) [-535.690] * (-534.427) (-537.803) (-535.385) [-536.956] -- 0:00:33
454500 -- (-535.332) (-535.130) [-538.163] (-535.572) * (-534.407) (-536.405) [-537.356] (-536.951) -- 0:00:33
455000 -- (-537.921) [-534.419] (-537.360) (-538.187) * (-536.440) (-535.173) [-537.189] (-536.566) -- 0:00:33
Average standard deviation of split frequencies: 0.009562
455500 -- (-535.491) (-534.510) [-537.000] (-536.056) * [-535.491] (-535.467) (-536.372) (-535.717) -- 0:00:33
456000 -- [-536.491] (-536.648) (-539.845) (-540.545) * (-535.670) (-534.999) [-534.636] (-540.551) -- 0:00:33
456500 -- (-536.953) (-538.045) [-537.688] (-539.994) * (-536.005) (-537.404) (-540.909) [-537.366] -- 0:00:33
457000 -- (-539.074) [-535.089] (-536.537) (-537.380) * (-534.597) (-540.387) [-537.049] (-534.539) -- 0:00:33
457500 -- (-536.771) (-536.494) [-535.576] (-535.905) * (-535.979) [-537.006] (-538.711) (-535.845) -- 0:00:33
458000 -- (-535.731) (-537.622) (-535.059) [-535.177] * (-538.116) (-539.090) [-537.113] (-534.920) -- 0:00:33
458500 -- (-536.856) (-536.711) [-537.560] (-536.967) * [-536.448] (-538.301) (-536.377) (-536.143) -- 0:00:33
459000 -- [-539.254] (-539.337) (-537.546) (-536.821) * (-536.755) [-536.968] (-537.332) (-536.581) -- 0:00:33
459500 -- (-535.783) (-538.951) [-535.445] (-540.656) * (-538.470) (-536.252) [-536.291] (-535.957) -- 0:00:32
460000 -- (-535.581) (-538.923) (-536.422) [-543.586] * (-536.127) (-539.357) [-534.761] (-538.950) -- 0:00:32
Average standard deviation of split frequencies: 0.009977
460500 -- (-536.816) [-536.127] (-535.803) (-535.251) * (-540.666) (-538.962) [-536.469] (-538.107) -- 0:00:32
461000 -- (-536.444) (-535.536) (-536.432) [-537.719] * (-538.548) (-536.752) (-538.714) [-537.448] -- 0:00:32
461500 -- (-536.744) [-534.514] (-535.581) (-536.811) * (-540.287) [-536.594] (-538.576) (-535.050) -- 0:00:32
462000 -- (-535.245) (-535.464) [-537.259] (-535.147) * (-539.531) (-535.757) [-537.312] (-536.224) -- 0:00:32
462500 -- (-536.106) (-537.004) [-536.778] (-535.889) * [-535.666] (-535.224) (-534.502) (-536.589) -- 0:00:32
463000 -- (-536.515) [-535.880] (-535.074) (-537.009) * (-534.278) (-534.843) (-537.308) [-536.389] -- 0:00:32
463500 -- (-535.369) [-535.142] (-536.125) (-535.962) * (-536.199) [-534.479] (-537.838) (-536.118) -- 0:00:32
464000 -- (-535.264) [-534.433] (-536.230) (-536.023) * (-535.567) [-535.508] (-538.974) (-535.159) -- 0:00:32
464500 -- [-537.438] (-544.350) (-538.227) (-537.319) * [-536.426] (-536.154) (-534.500) (-535.681) -- 0:00:32
465000 -- (-535.568) (-546.832) (-536.430) [-536.432] * (-537.137) (-535.483) (-535.304) [-536.073] -- 0:00:32
Average standard deviation of split frequencies: 0.010116
465500 -- (-538.117) [-536.913] (-535.481) (-536.211) * (-536.799) (-535.152) (-534.297) [-536.092] -- 0:00:32
466000 -- (-536.513) (-535.393) (-536.348) [-537.370] * (-539.226) (-537.064) [-537.983] (-534.545) -- 0:00:32
466500 -- [-536.013] (-534.546) (-537.621) (-536.116) * (-537.180) (-538.043) [-536.569] (-537.605) -- 0:00:32
467000 -- (-535.379) (-536.549) [-535.504] (-534.960) * [-537.631] (-535.742) (-536.811) (-538.097) -- 0:00:31
467500 -- (-535.674) (-535.331) (-535.541) [-538.347] * (-537.610) (-534.655) (-536.660) [-536.901] -- 0:00:31
468000 -- (-535.362) [-536.177] (-541.095) (-539.778) * (-536.304) (-536.216) [-535.739] (-534.298) -- 0:00:32
468500 -- (-536.770) (-541.772) [-538.559] (-535.610) * (-535.173) [-535.611] (-534.799) (-535.295) -- 0:00:32
469000 -- (-538.616) (-539.453) [-540.930] (-536.862) * (-536.513) (-537.387) [-535.173] (-536.451) -- 0:00:32
469500 -- (-537.742) (-541.510) [-539.495] (-535.436) * [-537.290] (-537.086) (-538.378) (-536.380) -- 0:00:32
470000 -- (-537.851) (-539.457) [-540.213] (-534.793) * (-535.960) (-539.985) [-535.858] (-538.815) -- 0:00:32
Average standard deviation of split frequencies: 0.010078
470500 -- (-538.023) [-539.700] (-535.364) (-539.160) * (-536.069) (-535.047) [-534.669] (-538.666) -- 0:00:32
471000 -- [-536.105] (-535.805) (-535.104) (-539.229) * (-536.289) (-534.324) [-537.057] (-537.418) -- 0:00:32
471500 -- (-535.005) (-538.604) [-535.409] (-534.972) * (-535.676) [-535.910] (-537.820) (-535.386) -- 0:00:32
472000 -- [-536.569] (-536.363) (-534.692) (-535.339) * (-535.618) (-534.913) [-540.180] (-537.639) -- 0:00:32
472500 -- [-536.614] (-534.347) (-534.198) (-536.507) * (-534.949) (-536.216) [-537.261] (-534.707) -- 0:00:32
473000 -- (-538.053) [-534.430] (-539.475) (-534.894) * [-536.914] (-535.951) (-534.501) (-537.206) -- 0:00:32
473500 -- (-535.142) (-535.606) (-537.459) [-534.883] * [-537.264] (-539.101) (-541.836) (-536.000) -- 0:00:32
474000 -- (-535.795) (-537.021) [-539.625] (-535.270) * (-534.890) (-539.457) [-537.838] (-537.747) -- 0:00:32
474500 -- [-536.839] (-541.050) (-536.523) (-535.312) * (-535.859) (-537.657) [-540.902] (-537.974) -- 0:00:32
475000 -- (-536.015) [-538.047] (-539.617) (-536.556) * (-537.100) (-534.337) (-541.485) [-536.389] -- 0:00:32
Average standard deviation of split frequencies: 0.010399
475500 -- (-536.125) (-537.155) [-536.057] (-542.122) * (-535.051) (-536.464) (-534.274) [-538.387] -- 0:00:31
476000 -- (-537.756) (-536.490) [-536.224] (-534.777) * [-535.422] (-537.476) (-535.652) (-534.336) -- 0:00:31
476500 -- [-536.142] (-537.830) (-535.965) (-535.487) * (-535.632) (-534.240) (-535.695) [-534.658] -- 0:00:31
477000 -- [-536.566] (-547.229) (-535.419) (-537.179) * (-535.863) [-541.600] (-535.160) (-536.647) -- 0:00:31
477500 -- [-539.768] (-543.340) (-535.558) (-538.048) * (-535.026) (-536.050) [-534.742] (-539.141) -- 0:00:31
478000 -- (-539.132) [-534.785] (-535.655) (-535.598) * [-534.912] (-534.886) (-537.066) (-537.697) -- 0:00:31
478500 -- (-538.193) (-534.824) [-534.461] (-535.465) * (-534.252) [-534.391] (-538.196) (-536.211) -- 0:00:31
479000 -- (-543.169) (-534.577) (-537.216) [-536.911] * (-535.929) (-538.357) (-534.736) [-534.889] -- 0:00:31
479500 -- (-535.089) (-537.650) [-535.952] (-535.134) * [-538.363] (-536.366) (-537.349) (-535.494) -- 0:00:31
480000 -- (-541.445) (-539.597) (-536.938) [-534.894] * [-537.040] (-536.044) (-534.989) (-539.451) -- 0:00:31
Average standard deviation of split frequencies: 0.010665
480500 -- (-536.871) (-536.015) (-536.428) [-536.744] * [-539.323] (-536.161) (-536.271) (-539.218) -- 0:00:31
481000 -- [-535.873] (-535.547) (-535.466) (-534.101) * (-537.047) (-535.597) (-536.188) [-535.439] -- 0:00:31
481500 -- (-535.615) [-534.572] (-536.965) (-536.847) * [-537.024] (-535.184) (-536.014) (-535.602) -- 0:00:31
482000 -- [-535.237] (-537.163) (-539.283) (-535.576) * (-534.973) [-538.066] (-536.935) (-536.922) -- 0:00:31
482500 -- [-536.666] (-536.620) (-541.180) (-534.884) * (-536.714) (-535.674) [-535.782] (-534.955) -- 0:00:31
483000 -- (-536.219) [-534.966] (-542.501) (-535.289) * (-539.728) (-534.708) (-536.988) [-534.914] -- 0:00:31
483500 -- (-534.571) (-536.644) [-535.107] (-536.988) * (-535.453) (-536.428) (-534.774) [-536.953] -- 0:00:30
484000 -- (-534.744) [-536.560] (-536.496) (-535.059) * [-535.226] (-536.588) (-536.065) (-543.384) -- 0:00:30
484500 -- (-539.914) (-537.886) (-536.787) [-534.943] * (-535.164) [-537.680] (-535.184) (-537.956) -- 0:00:30
485000 -- [-536.700] (-535.015) (-538.475) (-538.813) * [-540.613] (-537.203) (-534.981) (-537.791) -- 0:00:31
Average standard deviation of split frequencies: 0.010852
485500 -- (-535.354) [-538.602] (-539.179) (-539.176) * (-537.922) [-535.181] (-538.979) (-537.285) -- 0:00:31
486000 -- (-536.796) [-534.881] (-542.154) (-535.851) * (-536.587) [-538.348] (-535.805) (-536.552) -- 0:00:31
486500 -- (-537.845) [-537.416] (-537.627) (-535.886) * [-536.263] (-535.513) (-536.194) (-539.534) -- 0:00:31
487000 -- (-539.735) [-534.482] (-534.071) (-537.933) * (-536.418) [-534.646] (-536.771) (-537.774) -- 0:00:31
487500 -- (-537.564) (-535.217) (-538.055) [-538.055] * [-535.534] (-537.071) (-537.139) (-536.094) -- 0:00:31
488000 -- [-536.128] (-538.715) (-538.774) (-534.943) * (-537.679) (-535.409) [-536.093] (-539.408) -- 0:00:31
488500 -- [-534.880] (-535.619) (-537.038) (-535.674) * [-536.710] (-539.895) (-534.602) (-536.646) -- 0:00:31
489000 -- (-536.950) (-535.952) [-538.236] (-535.466) * (-536.972) (-535.895) (-536.341) [-535.280] -- 0:00:31
489500 -- (-534.919) (-536.654) [-534.558] (-535.134) * (-534.946) (-536.310) (-537.127) [-537.347] -- 0:00:31
490000 -- (-536.156) [-534.237] (-536.042) (-535.606) * [-534.666] (-534.765) (-536.046) (-539.072) -- 0:00:31
Average standard deviation of split frequencies: 0.010628
490500 -- (-539.081) [-534.997] (-541.373) (-535.985) * [-534.483] (-536.343) (-538.966) (-537.143) -- 0:00:31
491000 -- [-535.033] (-539.129) (-540.001) (-536.153) * (-539.764) (-535.174) [-535.865] (-538.518) -- 0:00:31
491500 -- (-536.552) [-536.087] (-537.044) (-536.676) * (-539.724) [-534.906] (-538.932) (-537.661) -- 0:00:31
492000 -- (-536.948) (-537.516) (-536.338) [-535.329] * (-535.529) (-536.708) [-536.933] (-537.056) -- 0:00:30
492500 -- (-537.979) (-536.668) (-536.252) [-535.360] * (-537.959) (-536.509) (-538.110) [-537.405] -- 0:00:30
493000 -- (-535.171) (-538.971) [-536.622] (-535.772) * (-538.114) (-536.748) (-535.033) [-537.961] -- 0:00:30
493500 -- [-534.968] (-535.190) (-535.192) (-534.635) * (-537.732) (-536.634) (-537.160) [-534.331] -- 0:00:30
494000 -- [-536.610] (-536.167) (-535.615) (-534.424) * (-536.800) (-540.696) [-535.715] (-536.781) -- 0:00:30
494500 -- (-539.973) (-537.274) [-536.399] (-535.723) * (-535.126) (-536.782) (-535.233) [-539.057] -- 0:00:30
495000 -- (-535.606) (-537.983) (-536.385) [-536.302] * (-537.548) [-536.521] (-536.665) (-537.598) -- 0:00:30
Average standard deviation of split frequencies: 0.010870
495500 -- (-534.564) (-537.520) (-537.681) [-536.816] * (-534.880) (-537.880) (-536.039) [-535.516] -- 0:00:30
496000 -- [-535.316] (-536.178) (-537.864) (-535.352) * [-534.952] (-537.863) (-536.868) (-540.817) -- 0:00:30
496500 -- (-539.265) (-538.683) (-535.550) [-536.616] * (-534.813) [-535.789] (-535.119) (-542.750) -- 0:00:30
497000 -- (-537.591) [-535.247] (-537.568) (-535.009) * (-538.752) (-535.789) (-537.392) [-536.969] -- 0:00:30
497500 -- (-535.170) [-534.525] (-538.055) (-536.008) * (-535.430) (-535.995) [-538.320] (-536.850) -- 0:00:30
498000 -- (-536.606) [-534.898] (-536.384) (-536.276) * (-536.645) [-539.661] (-537.571) (-536.781) -- 0:00:30
498500 -- (-535.856) [-535.849] (-537.612) (-535.575) * (-540.653) [-534.355] (-536.320) (-537.761) -- 0:00:30
499000 -- [-538.967] (-537.004) (-536.202) (-537.043) * (-534.894) [-536.936] (-535.586) (-537.590) -- 0:00:30
499500 -- [-538.894] (-535.819) (-536.003) (-541.304) * (-538.449) (-537.558) (-535.157) [-539.201] -- 0:00:30
500000 -- (-534.686) (-536.764) (-536.855) [-538.111] * (-538.480) [-535.305] (-537.214) (-534.997) -- 0:00:30
Average standard deviation of split frequencies: 0.011240
500500 -- [-536.096] (-539.077) (-536.037) (-535.871) * (-537.351) (-538.698) [-538.226] (-534.902) -- 0:00:29
501000 -- [-535.621] (-535.338) (-535.411) (-538.644) * (-535.198) (-536.814) [-537.324] (-538.032) -- 0:00:29
501500 -- (-535.188) (-540.063) [-535.245] (-536.631) * (-536.151) (-535.016) (-536.387) [-537.812] -- 0:00:29
502000 -- (-535.107) [-535.244] (-534.941) (-535.694) * (-535.704) [-535.529] (-535.799) (-535.238) -- 0:00:30
502500 -- (-535.077) (-535.441) (-539.086) [-536.331] * [-534.801] (-536.781) (-538.246) (-537.414) -- 0:00:30
503000 -- (-536.319) [-535.451] (-540.719) (-534.834) * (-536.090) [-535.923] (-536.361) (-536.536) -- 0:00:30
503500 -- (-537.295) (-535.753) [-534.898] (-535.041) * (-536.251) (-535.427) (-536.570) [-536.634] -- 0:00:30
504000 -- (-538.885) (-539.275) [-534.444] (-538.085) * [-538.338] (-535.659) (-534.442) (-536.621) -- 0:00:30
504500 -- [-536.309] (-540.385) (-536.868) (-536.499) * [-537.764] (-536.496) (-534.614) (-537.607) -- 0:00:30
505000 -- [-538.218] (-538.485) (-535.209) (-537.156) * [-539.280] (-535.786) (-538.833) (-539.545) -- 0:00:30
Average standard deviation of split frequencies: 0.011180
505500 -- (-536.222) [-537.181] (-536.789) (-534.883) * [-539.143] (-536.773) (-537.270) (-534.882) -- 0:00:30
506000 -- (-538.002) (-535.082) [-534.795] (-537.130) * (-537.912) (-537.028) (-537.964) [-538.201] -- 0:00:30
506500 -- [-536.697] (-535.662) (-536.247) (-538.216) * (-537.510) [-534.715] (-537.996) (-537.339) -- 0:00:30
507000 -- (-536.379) [-537.607] (-536.241) (-535.457) * [-535.733] (-535.300) (-537.285) (-534.658) -- 0:00:30
507500 -- (-535.255) (-536.430) [-538.516] (-536.585) * [-540.489] (-539.246) (-535.779) (-535.642) -- 0:00:30
508000 -- [-535.079] (-538.573) (-539.060) (-535.002) * (-536.709) (-537.159) [-534.905] (-538.480) -- 0:00:30
508500 -- [-536.355] (-535.513) (-536.662) (-542.964) * (-535.203) (-538.829) [-534.752] (-542.016) -- 0:00:29
509000 -- (-538.090) [-535.762] (-535.674) (-542.125) * (-536.529) (-542.653) [-536.926] (-538.118) -- 0:00:29
509500 -- (-539.153) (-534.878) [-537.429] (-535.622) * (-536.599) (-534.381) [-536.258] (-535.855) -- 0:00:29
510000 -- [-536.780] (-539.287) (-536.158) (-541.254) * (-535.250) (-535.831) [-536.391] (-536.322) -- 0:00:29
Average standard deviation of split frequencies: 0.010270
510500 -- [-535.888] (-541.027) (-535.621) (-534.527) * (-535.225) (-537.605) [-536.714] (-538.002) -- 0:00:29
511000 -- (-534.341) (-539.033) [-535.942] (-536.452) * (-538.602) (-538.911) [-537.113] (-540.006) -- 0:00:29
511500 -- (-536.831) (-537.267) [-536.013] (-535.816) * (-536.320) (-539.276) [-535.596] (-536.516) -- 0:00:29
512000 -- [-534.848] (-535.643) (-535.211) (-537.643) * (-536.331) (-537.308) [-534.874] (-535.945) -- 0:00:29
512500 -- (-537.470) (-538.300) [-535.880] (-538.919) * (-536.961) [-538.269] (-535.156) (-535.857) -- 0:00:29
513000 -- (-540.424) [-538.303] (-537.272) (-538.266) * [-536.965] (-535.969) (-535.281) (-536.297) -- 0:00:29
513500 -- [-535.653] (-536.574) (-535.926) (-535.065) * [-536.994] (-534.508) (-537.625) (-536.600) -- 0:00:29
514000 -- (-535.731) (-540.332) (-535.187) [-535.518] * (-537.621) (-534.882) (-534.988) [-535.983] -- 0:00:29
514500 -- (-541.447) (-536.698) (-535.276) [-538.918] * (-538.120) (-535.003) (-534.946) [-535.952] -- 0:00:29
515000 -- (-540.773) (-534.407) [-538.393] (-537.248) * [-535.434] (-539.590) (-539.706) (-535.563) -- 0:00:29
Average standard deviation of split frequencies: 0.009318
515500 -- (-536.595) (-536.026) [-536.422] (-536.113) * (-536.676) (-541.619) [-537.896] (-535.189) -- 0:00:29
516000 -- [-536.414] (-534.349) (-540.970) (-536.534) * (-534.607) (-536.227) (-537.432) [-537.928] -- 0:00:29
516500 -- (-536.327) (-537.511) (-541.884) [-535.096] * (-538.824) (-535.406) [-537.290] (-538.264) -- 0:00:29
517000 -- (-535.965) (-537.855) (-541.347) [-536.062] * (-540.740) (-539.674) [-540.758] (-540.664) -- 0:00:28
517500 -- (-534.481) (-536.023) [-536.243] (-538.267) * (-536.218) (-539.332) (-537.375) [-537.814] -- 0:00:28
518000 -- [-535.909] (-536.908) (-534.164) (-536.115) * (-537.230) (-541.015) (-534.883) [-534.613] -- 0:00:28
518500 -- [-535.438] (-535.435) (-535.504) (-534.836) * (-536.281) [-537.123] (-535.577) (-535.633) -- 0:00:28
519000 -- (-535.592) (-535.982) (-537.548) [-535.095] * (-536.491) [-538.205] (-536.254) (-535.329) -- 0:00:29
519500 -- (-534.887) (-538.300) (-539.940) [-536.285] * (-537.109) [-534.796] (-536.926) (-534.602) -- 0:00:29
520000 -- [-535.211] (-535.309) (-536.522) (-535.835) * (-535.819) (-540.484) [-535.430] (-536.928) -- 0:00:29
Average standard deviation of split frequencies: 0.009175
520500 -- (-534.180) (-534.697) (-537.459) [-535.282] * (-537.286) (-540.270) (-534.569) [-534.864] -- 0:00:29
521000 -- [-535.868] (-536.793) (-536.283) (-538.105) * [-535.446] (-537.989) (-535.687) (-537.234) -- 0:00:29
521500 -- [-537.656] (-534.938) (-534.626) (-535.861) * (-535.356) (-536.334) (-534.522) [-538.450] -- 0:00:29
522000 -- (-537.301) (-537.449) [-536.370] (-538.033) * (-538.134) (-535.625) [-538.092] (-537.672) -- 0:00:29
522500 -- (-535.125) (-535.309) [-535.071] (-537.205) * [-540.134] (-538.478) (-536.330) (-536.247) -- 0:00:29
523000 -- [-534.481] (-537.150) (-534.765) (-535.168) * (-537.078) [-540.113] (-538.186) (-536.106) -- 0:00:29
523500 -- (-539.237) [-536.730] (-534.542) (-537.764) * [-536.115] (-537.018) (-534.523) (-534.173) -- 0:00:29
524000 -- [-537.036] (-535.368) (-540.406) (-537.104) * (-534.972) (-537.216) [-535.574] (-538.485) -- 0:00:29
524500 -- [-534.808] (-534.226) (-534.970) (-540.315) * (-534.748) (-535.124) (-539.838) [-536.313] -- 0:00:29
525000 -- (-536.960) [-536.122] (-537.460) (-537.126) * (-536.796) (-535.541) [-535.973] (-537.728) -- 0:00:28
Average standard deviation of split frequencies: 0.009466
525500 -- (-538.887) [-536.216] (-535.966) (-535.580) * (-536.009) [-536.796] (-534.976) (-536.539) -- 0:00:28
526000 -- [-538.016] (-535.369) (-541.392) (-536.357) * (-536.055) (-538.739) (-538.514) [-538.374] -- 0:00:28
526500 -- [-537.647] (-536.476) (-536.551) (-538.457) * (-538.072) (-535.071) [-534.932] (-538.345) -- 0:00:28
527000 -- (-535.157) [-536.256] (-537.934) (-536.724) * (-535.673) (-537.448) (-536.666) [-537.981] -- 0:00:28
527500 -- [-537.885] (-537.334) (-538.826) (-536.330) * [-535.648] (-536.205) (-537.245) (-540.322) -- 0:00:28
528000 -- (-535.352) (-534.579) (-537.781) [-535.004] * (-547.118) [-537.011] (-536.535) (-538.634) -- 0:00:28
528500 -- (-536.401) (-537.680) [-537.647] (-536.723) * (-535.711) [-536.772] (-535.885) (-537.081) -- 0:00:28
529000 -- (-542.239) (-538.919) (-536.897) [-535.503] * (-534.478) (-536.773) [-535.007] (-538.189) -- 0:00:28
529500 -- (-541.979) [-535.223] (-537.893) (-535.399) * (-534.089) (-536.917) [-536.616] (-538.494) -- 0:00:28
530000 -- [-535.961] (-537.485) (-536.036) (-543.634) * [-534.446] (-535.563) (-535.979) (-538.137) -- 0:00:28
Average standard deviation of split frequencies: 0.009535
530500 -- (-535.501) (-535.288) (-535.766) [-538.836] * (-537.689) [-535.441] (-535.811) (-536.580) -- 0:00:28
531000 -- [-537.295] (-538.731) (-535.137) (-534.259) * (-535.242) (-538.817) (-537.720) [-535.590] -- 0:00:28
531500 -- [-534.625] (-538.174) (-536.076) (-538.195) * (-536.354) (-537.069) (-539.166) [-537.781] -- 0:00:28
532000 -- (-537.585) (-534.845) (-536.620) [-535.766] * [-535.308] (-537.478) (-543.947) (-534.740) -- 0:00:28
532500 -- (-535.943) (-535.366) (-536.746) [-535.623] * (-538.445) [-535.031] (-542.330) (-539.561) -- 0:00:28
533000 -- (-537.160) [-535.449] (-534.473) (-535.406) * (-535.348) (-535.053) (-539.632) [-536.998] -- 0:00:28
533500 -- [-536.388] (-536.307) (-534.432) (-538.159) * [-534.268] (-539.528) (-534.805) (-535.711) -- 0:00:27
534000 -- [-536.718] (-539.313) (-535.645) (-535.184) * (-534.785) (-535.874) (-535.671) [-534.957] -- 0:00:27
534500 -- (-536.882) (-536.952) [-537.877] (-538.015) * (-534.341) (-540.385) (-535.388) [-534.914] -- 0:00:27
535000 -- (-537.545) [-541.167] (-535.307) (-538.775) * (-538.053) (-537.959) [-534.292] (-536.267) -- 0:00:27
Average standard deviation of split frequencies: 0.009498
535500 -- [-536.648] (-537.428) (-536.074) (-537.333) * [-536.328] (-535.185) (-537.973) (-537.878) -- 0:00:28
536000 -- (-541.100) [-535.822] (-541.650) (-536.829) * (-537.163) (-536.926) (-538.351) [-537.814] -- 0:00:28
536500 -- (-536.572) [-535.827] (-535.340) (-538.225) * (-534.948) (-534.889) [-535.930] (-539.245) -- 0:00:28
537000 -- (-539.102) (-535.563) (-534.965) [-539.395] * (-535.051) [-534.704] (-540.211) (-536.301) -- 0:00:28
537500 -- (-536.299) (-535.992) [-538.079] (-535.368) * (-538.952) (-538.847) (-538.693) [-537.765] -- 0:00:28
538000 -- (-537.958) (-535.111) [-534.729] (-535.828) * (-538.217) (-537.414) [-536.845] (-534.237) -- 0:00:28
538500 -- [-536.829] (-534.332) (-539.367) (-538.057) * (-535.598) [-536.283] (-536.383) (-536.770) -- 0:00:28
539000 -- [-535.409] (-535.582) (-535.952) (-539.551) * (-534.710) (-537.685) [-536.764] (-535.991) -- 0:00:28
539500 -- (-534.990) (-535.544) [-540.296] (-536.340) * (-535.791) (-534.974) [-534.501] (-534.613) -- 0:00:28
540000 -- (-539.068) (-535.977) (-537.596) [-534.945] * (-536.118) (-534.826) [-534.346] (-535.009) -- 0:00:28
Average standard deviation of split frequencies: 0.008951
540500 -- (-538.691) (-537.704) (-537.314) [-534.988] * (-534.874) (-535.837) (-535.522) [-535.230] -- 0:00:28
541000 -- (-538.283) (-536.655) (-537.320) [-535.733] * (-534.937) (-534.210) [-535.935] (-535.429) -- 0:00:27
541500 -- (-536.435) (-539.086) [-534.602] (-535.689) * [-534.911] (-539.095) (-536.564) (-537.185) -- 0:00:27
542000 -- (-537.571) (-534.483) [-537.796] (-536.347) * (-535.592) (-536.844) [-536.675] (-536.270) -- 0:00:27
542500 -- (-536.488) (-536.522) (-536.594) [-538.925] * (-535.243) (-536.267) [-535.008] (-534.727) -- 0:00:27
543000 -- [-536.963] (-535.760) (-535.210) (-535.593) * [-538.683] (-540.836) (-541.374) (-535.003) -- 0:00:27
543500 -- (-536.966) (-534.741) (-535.160) [-539.155] * [-536.407] (-538.142) (-535.270) (-535.582) -- 0:00:27
544000 -- (-535.533) (-537.398) [-535.551] (-535.510) * (-537.727) (-536.897) (-537.689) [-534.319] -- 0:00:27
544500 -- (-537.047) (-538.423) (-536.184) [-537.658] * (-537.298) (-536.915) [-535.593] (-535.520) -- 0:00:27
545000 -- (-535.603) (-538.476) (-536.039) [-536.793] * [-537.860] (-542.652) (-535.687) (-536.158) -- 0:00:27
Average standard deviation of split frequencies: 0.009012
545500 -- (-535.401) (-537.774) [-534.590] (-534.910) * (-544.410) [-540.222] (-537.272) (-536.823) -- 0:00:27
546000 -- (-537.117) (-536.322) [-535.441] (-539.701) * (-537.345) (-534.352) [-537.391] (-538.345) -- 0:00:27
546500 -- [-538.396] (-536.468) (-535.686) (-536.438) * (-534.919) [-538.750] (-537.902) (-535.332) -- 0:00:27
547000 -- [-536.983] (-536.150) (-535.541) (-537.304) * (-535.704) (-535.905) [-535.980] (-536.289) -- 0:00:27
547500 -- (-538.371) [-536.724] (-534.845) (-536.351) * [-537.898] (-535.639) (-537.010) (-536.524) -- 0:00:27
548000 -- (-535.657) [-534.719] (-535.135) (-538.493) * (-535.772) (-534.799) [-535.832] (-534.910) -- 0:00:27
548500 -- (-534.671) (-535.332) [-537.142] (-537.547) * (-537.658) [-537.017] (-537.848) (-534.305) -- 0:00:27
549000 -- (-536.641) (-537.224) [-536.473] (-538.891) * (-536.028) (-536.643) [-537.472] (-540.045) -- 0:00:27
549500 -- (-534.929) (-538.895) [-536.330] (-537.631) * (-539.600) (-537.630) (-539.112) [-537.625] -- 0:00:27
550000 -- (-534.999) [-536.867] (-535.955) (-536.586) * (-539.910) [-535.088] (-536.536) (-537.457) -- 0:00:27
Average standard deviation of split frequencies: 0.008400
550500 -- (-537.409) (-535.239) (-540.192) [-535.568] * (-536.503) (-537.701) [-534.625] (-537.837) -- 0:00:26
551000 -- (-535.226) (-537.028) (-538.787) [-535.801] * [-536.332] (-534.593) (-538.334) (-539.665) -- 0:00:26
551500 -- (-537.042) (-534.360) (-538.024) [-536.513] * (-534.472) [-536.485] (-536.108) (-535.473) -- 0:00:26
552000 -- (-539.801) [-534.805] (-535.602) (-535.130) * [-536.016] (-536.380) (-536.175) (-534.325) -- 0:00:27
552500 -- [-534.664] (-536.769) (-535.498) (-537.653) * [-536.324] (-536.325) (-540.783) (-534.653) -- 0:00:27
553000 -- [-537.999] (-536.070) (-536.802) (-538.601) * (-536.656) (-534.996) [-540.231] (-535.588) -- 0:00:27
553500 -- (-538.886) (-538.689) [-536.631] (-534.760) * (-534.418) [-538.232] (-537.961) (-535.168) -- 0:00:27
554000 -- (-537.526) [-536.497] (-537.460) (-535.762) * (-545.302) [-537.204] (-536.217) (-538.432) -- 0:00:27
554500 -- (-534.739) (-538.985) (-536.042) [-535.221] * (-539.845) (-537.763) [-543.257] (-536.328) -- 0:00:27
555000 -- (-534.990) [-538.771] (-540.521) (-535.708) * (-537.810) (-539.538) (-538.370) [-536.139] -- 0:00:27
Average standard deviation of split frequencies: 0.007857
555500 -- (-536.447) (-537.261) [-536.490] (-536.598) * (-535.511) [-539.431] (-537.014) (-536.920) -- 0:00:27
556000 -- (-536.760) (-539.082) [-536.436] (-536.549) * [-538.784] (-534.682) (-538.331) (-534.689) -- 0:00:27
556500 -- (-542.249) [-537.498] (-535.507) (-535.241) * [-536.039] (-534.864) (-538.559) (-534.852) -- 0:00:27
557000 -- (-536.377) [-535.933] (-534.556) (-535.827) * [-534.864] (-536.906) (-539.844) (-536.475) -- 0:00:27
557500 -- (-535.430) (-537.685) (-535.783) [-536.074] * (-535.305) [-536.760] (-536.459) (-536.802) -- 0:00:26
558000 -- [-536.648] (-542.625) (-543.964) (-537.122) * [-534.920] (-534.907) (-538.212) (-535.375) -- 0:00:26
558500 -- [-536.250] (-535.921) (-539.314) (-537.138) * (-539.642) [-535.883] (-534.646) (-537.754) -- 0:00:26
559000 -- (-536.643) [-534.706] (-539.826) (-539.796) * (-537.041) (-536.226) (-536.662) [-535.920] -- 0:00:26
559500 -- (-535.666) [-534.233] (-535.306) (-536.487) * (-542.927) (-538.663) [-536.586] (-539.027) -- 0:00:26
560000 -- [-535.125] (-534.179) (-541.167) (-536.921) * (-536.656) [-541.339] (-540.812) (-535.067) -- 0:00:26
Average standard deviation of split frequencies: 0.007791
560500 -- [-534.574] (-535.094) (-535.599) (-535.413) * [-535.322] (-535.727) (-538.752) (-534.990) -- 0:00:26
561000 -- (-534.948) (-534.833) [-535.809] (-536.072) * (-535.581) (-537.230) [-536.816] (-541.860) -- 0:00:26
561500 -- (-540.533) [-537.042] (-536.817) (-535.859) * (-538.242) (-541.809) [-538.070] (-538.972) -- 0:00:26
562000 -- (-537.816) (-534.894) (-535.959) [-536.395] * (-538.834) (-541.140) (-537.150) [-535.469] -- 0:00:26
562500 -- (-537.781) [-534.485] (-536.532) (-534.499) * (-536.125) (-537.802) (-537.191) [-538.097] -- 0:00:26
563000 -- (-534.752) (-534.816) (-539.350) [-536.032] * (-534.893) (-537.980) [-535.282] (-535.294) -- 0:00:26
563500 -- (-536.753) [-536.821] (-534.479) (-535.388) * (-535.311) (-536.476) (-535.583) [-536.323] -- 0:00:26
564000 -- [-534.590] (-536.250) (-535.592) (-535.136) * (-536.236) (-535.268) [-537.145] (-537.473) -- 0:00:26
564500 -- (-535.044) (-536.899) (-536.992) [-535.406] * (-535.607) (-537.557) (-535.603) [-534.464] -- 0:00:26
565000 -- (-538.672) (-536.254) [-537.252] (-535.549) * (-536.453) (-535.151) [-536.020] (-535.764) -- 0:00:26
Average standard deviation of split frequencies: 0.007551
565500 -- (-535.772) (-534.760) (-537.958) [-535.250] * (-535.109) [-535.153] (-535.995) (-539.809) -- 0:00:26
566000 -- [-535.948] (-537.258) (-535.234) (-534.839) * (-540.108) [-540.598] (-537.094) (-536.878) -- 0:00:26
566500 -- [-537.370] (-539.003) (-535.244) (-536.810) * [-534.942] (-536.484) (-537.873) (-536.098) -- 0:00:26
567000 -- (-534.540) [-538.715] (-535.779) (-537.410) * (-534.273) (-535.372) [-535.567] (-534.716) -- 0:00:25
567500 -- [-539.574] (-538.256) (-534.623) (-540.846) * (-536.298) (-537.332) (-538.398) [-535.509] -- 0:00:26
568000 -- [-542.173] (-535.566) (-537.883) (-537.003) * (-535.263) (-539.080) [-535.599] (-535.262) -- 0:00:26
568500 -- (-535.789) [-538.019] (-535.749) (-539.863) * (-534.922) (-535.486) (-536.097) [-535.231] -- 0:00:26
569000 -- [-535.376] (-535.889) (-536.221) (-534.631) * (-535.128) [-535.367] (-537.394) (-536.221) -- 0:00:26
569500 -- (-536.372) [-536.202] (-537.690) (-537.074) * (-535.048) (-536.444) (-536.327) [-536.502] -- 0:00:26
570000 -- [-537.817] (-538.132) (-536.964) (-535.186) * (-535.060) (-535.508) (-536.560) [-539.049] -- 0:00:26
Average standard deviation of split frequencies: 0.007324
570500 -- [-534.578] (-537.534) (-535.996) (-538.042) * (-534.487) [-535.940] (-540.940) (-538.748) -- 0:00:26
571000 -- (-543.437) (-536.817) (-534.792) [-535.279] * (-535.433) [-536.070] (-538.634) (-538.035) -- 0:00:26
571500 -- (-535.726) (-535.164) [-536.592] (-536.104) * (-540.172) (-536.032) [-535.427] (-537.129) -- 0:00:26
572000 -- (-535.897) (-535.164) [-537.329] (-537.955) * (-536.287) (-536.843) (-535.027) [-539.023] -- 0:00:26
572500 -- (-535.808) [-536.007] (-535.773) (-535.913) * [-536.496] (-543.291) (-535.283) (-538.807) -- 0:00:26
573000 -- [-534.678] (-539.232) (-536.950) (-535.624) * (-538.066) (-541.322) (-536.589) [-537.887] -- 0:00:26
573500 -- (-534.981) (-536.252) (-538.217) [-536.670] * [-535.653] (-537.143) (-535.920) (-534.577) -- 0:00:26
574000 -- (-538.976) (-535.168) [-536.732] (-538.669) * (-537.848) (-536.791) (-535.840) [-539.103] -- 0:00:25
574500 -- (-534.231) (-534.959) (-537.430) [-535.648] * (-536.930) (-537.652) [-537.476] (-535.940) -- 0:00:25
575000 -- (-535.768) (-535.259) (-537.916) [-537.657] * (-537.376) (-536.614) (-535.208) [-536.333] -- 0:00:25
Average standard deviation of split frequencies: 0.006656
575500 -- (-534.813) (-536.865) [-535.742] (-536.828) * [-535.536] (-535.316) (-537.118) (-534.955) -- 0:00:25
576000 -- (-539.060) [-536.583] (-536.921) (-537.472) * [-536.062] (-535.723) (-535.933) (-541.446) -- 0:00:25
576500 -- (-534.202) (-535.879) [-539.654] (-536.563) * (-535.960) (-535.031) (-534.751) [-540.349] -- 0:00:25
577000 -- (-534.310) [-538.061] (-535.596) (-535.988) * (-536.837) (-538.206) [-535.486] (-537.969) -- 0:00:25
577500 -- (-534.779) [-537.288] (-535.804) (-536.933) * (-536.665) (-535.639) [-534.968] (-537.432) -- 0:00:25
578000 -- (-534.967) (-535.901) (-542.336) [-541.012] * (-534.605) (-536.640) [-537.105] (-538.206) -- 0:00:25
578500 -- (-536.504) (-538.991) (-536.491) [-536.401] * [-535.171] (-537.577) (-536.577) (-540.669) -- 0:00:25
579000 -- (-535.786) [-537.266] (-535.392) (-536.397) * (-536.636) (-535.775) [-535.684] (-537.857) -- 0:00:25
579500 -- (-534.697) (-537.523) [-534.991] (-537.538) * (-538.101) [-535.774] (-535.816) (-538.369) -- 0:00:25
580000 -- (-537.387) (-543.080) (-535.749) [-538.777] * (-537.642) (-535.500) [-537.087] (-536.273) -- 0:00:25
Average standard deviation of split frequencies: 0.006819
580500 -- (-537.769) [-537.103] (-539.946) (-541.031) * [-543.365] (-540.480) (-535.236) (-536.733) -- 0:00:25
581000 -- [-535.343] (-537.169) (-540.633) (-537.051) * (-539.891) (-536.077) [-534.788] (-534.522) -- 0:00:25
581500 -- (-538.615) [-536.533] (-536.108) (-534.845) * [-538.516] (-534.696) (-534.753) (-541.030) -- 0:00:25
582000 -- (-534.131) (-536.806) (-536.310) [-537.452] * [-536.237] (-535.301) (-537.530) (-536.921) -- 0:00:25
582500 -- [-534.688] (-535.956) (-535.610) (-537.590) * (-534.878) [-535.687] (-538.952) (-538.774) -- 0:00:25
583000 -- (-537.409) (-536.129) [-538.817] (-539.957) * [-535.646] (-537.161) (-537.246) (-534.788) -- 0:00:25
583500 -- (-538.270) [-536.613] (-535.865) (-537.118) * (-540.545) (-535.534) [-535.535] (-536.769) -- 0:00:24
584000 -- (-537.531) (-538.886) (-537.208) [-534.794] * (-535.012) [-536.764] (-537.089) (-538.750) -- 0:00:25
584500 -- (-536.817) (-539.348) (-536.038) [-537.818] * (-535.833) (-535.903) [-535.016] (-539.185) -- 0:00:25
585000 -- [-537.620] (-536.513) (-538.230) (-535.875) * [-538.842] (-537.045) (-537.382) (-537.171) -- 0:00:25
Average standard deviation of split frequencies: 0.007455
585500 -- (-534.966) (-536.733) (-536.205) [-537.047] * (-537.077) (-538.477) [-536.251] (-536.794) -- 0:00:25
586000 -- [-535.975] (-537.128) (-539.249) (-535.993) * (-535.201) [-536.455] (-538.195) (-540.457) -- 0:00:25
586500 -- (-535.836) (-536.028) (-535.370) [-535.258] * (-540.250) (-541.306) (-539.597) [-535.986] -- 0:00:25
587000 -- (-538.086) [-536.490] (-536.462) (-535.705) * (-537.164) [-539.444] (-540.590) (-536.916) -- 0:00:25
587500 -- [-535.695] (-535.637) (-534.863) (-535.072) * (-536.703) (-537.477) (-536.437) [-535.400] -- 0:00:25
588000 -- [-534.782] (-539.007) (-536.115) (-535.004) * (-535.276) (-535.667) (-535.302) [-535.244] -- 0:00:25
588500 -- (-540.171) (-535.504) [-538.011] (-536.065) * (-535.579) (-535.121) [-539.498] (-537.461) -- 0:00:25
589000 -- (-540.930) [-534.574] (-537.135) (-535.408) * (-539.463) (-537.777) (-538.603) [-535.605] -- 0:00:25
589500 -- (-534.513) [-539.110] (-539.173) (-535.534) * (-536.187) (-534.980) [-534.713] (-536.294) -- 0:00:25
590000 -- (-536.147) [-539.600] (-536.091) (-535.839) * (-534.376) (-535.041) [-534.629] (-536.152) -- 0:00:25
Average standard deviation of split frequencies: 0.007746
590500 -- (-538.525) [-538.973] (-536.131) (-537.258) * (-536.253) (-537.185) [-534.902] (-535.962) -- 0:00:24
591000 -- (-535.732) [-536.427] (-535.448) (-534.802) * (-540.063) [-539.087] (-535.593) (-534.892) -- 0:00:24
591500 -- (-535.706) (-538.773) (-535.268) [-536.851] * [-535.179] (-538.277) (-535.544) (-536.819) -- 0:00:24
592000 -- [-537.788] (-534.916) (-535.785) (-536.917) * (-535.703) (-535.016) (-535.896) [-536.534] -- 0:00:24
592500 -- (-541.812) [-534.987] (-535.516) (-537.082) * (-534.273) [-537.848] (-539.342) (-536.125) -- 0:00:24
593000 -- (-536.719) (-537.044) (-536.191) [-536.336] * [-538.399] (-537.461) (-539.318) (-535.456) -- 0:00:24
593500 -- (-536.688) (-536.934) (-537.787) [-536.437] * (-537.159) (-534.431) (-539.890) [-535.489] -- 0:00:24
594000 -- (-535.639) [-535.739] (-536.860) (-537.766) * (-536.752) (-535.275) (-542.298) [-535.787] -- 0:00:24
594500 -- (-538.943) [-535.633] (-536.611) (-535.002) * (-535.552) [-535.010] (-536.018) (-539.037) -- 0:00:24
595000 -- [-535.637] (-537.477) (-539.666) (-536.365) * (-535.846) [-540.959] (-535.228) (-536.645) -- 0:00:24
Average standard deviation of split frequencies: 0.007267
595500 -- [-537.081] (-535.876) (-535.338) (-536.594) * (-538.835) (-535.608) (-535.879) [-537.151] -- 0:00:24
596000 -- (-539.346) (-537.353) [-535.427] (-537.370) * (-538.962) (-537.737) (-535.603) [-534.404] -- 0:00:24
596500 -- [-535.138] (-536.131) (-535.336) (-544.631) * [-537.278] (-536.131) (-536.896) (-535.285) -- 0:00:24
597000 -- (-536.851) (-535.489) [-534.325] (-539.770) * (-537.836) [-539.418] (-537.473) (-536.027) -- 0:00:24
597500 -- (-541.607) (-535.492) [-534.853] (-537.386) * (-537.834) (-538.848) [-535.571] (-538.789) -- 0:00:24
598000 -- [-534.439] (-537.585) (-538.442) (-536.989) * (-535.152) (-538.331) (-537.373) [-537.710] -- 0:00:24
598500 -- (-535.510) (-535.544) (-538.372) [-537.772] * (-537.991) [-538.636] (-536.998) (-534.571) -- 0:00:24
599000 -- (-535.417) (-537.065) (-536.745) [-535.217] * (-542.169) (-535.931) (-535.130) [-535.417] -- 0:00:24
599500 -- (-536.289) (-539.241) (-538.480) [-535.714] * (-537.689) [-534.537] (-535.876) (-536.084) -- 0:00:24
600000 -- (-536.844) [-536.374] (-538.054) (-535.041) * (-540.544) (-534.602) (-535.793) [-534.980] -- 0:00:24
Average standard deviation of split frequencies: 0.008217
600500 -- [-536.531] (-539.805) (-536.749) (-535.770) * [-536.421] (-537.492) (-534.983) (-537.285) -- 0:00:24
601000 -- (-536.735) (-541.187) (-536.527) [-534.744] * [-535.538] (-538.432) (-535.522) (-538.567) -- 0:00:24
601500 -- [-540.171] (-535.018) (-536.329) (-540.159) * [-534.676] (-535.348) (-538.071) (-538.111) -- 0:00:24
602000 -- [-536.060] (-535.029) (-535.797) (-538.095) * (-538.329) (-537.386) (-537.304) [-534.488] -- 0:00:24
602500 -- [-535.756] (-538.802) (-537.769) (-538.025) * [-535.640] (-537.189) (-536.382) (-538.493) -- 0:00:24
603000 -- (-535.346) (-539.624) (-537.891) [-538.223] * [-536.084] (-537.279) (-537.500) (-534.715) -- 0:00:24
603500 -- (-534.944) (-538.677) (-535.578) [-536.615] * (-535.712) (-535.777) (-534.554) [-534.396] -- 0:00:24
604000 -- (-534.596) (-539.451) [-535.074] (-536.450) * (-538.002) [-536.328] (-537.032) (-536.832) -- 0:00:24
604500 -- (-535.785) (-536.978) [-536.752] (-536.096) * (-535.893) [-534.976] (-537.197) (-535.985) -- 0:00:24
605000 -- (-535.945) [-537.237] (-537.742) (-536.307) * [-535.944] (-534.527) (-537.835) (-538.447) -- 0:00:24
Average standard deviation of split frequencies: 0.008191
605500 -- (-536.800) (-537.539) (-536.363) [-536.859] * (-535.171) [-537.538] (-537.445) (-536.449) -- 0:00:24
606000 -- (-541.008) [-535.699] (-538.797) (-537.003) * [-534.516] (-537.101) (-539.341) (-537.503) -- 0:00:24
606500 -- (-536.709) (-535.793) [-538.080] (-539.136) * (-534.215) (-537.975) [-534.639] (-535.149) -- 0:00:24
607000 -- (-536.955) [-538.326] (-535.987) (-535.562) * (-540.347) (-537.903) [-538.228] (-538.752) -- 0:00:23
607500 -- (-538.223) (-538.946) [-539.724] (-537.806) * (-541.229) [-536.166] (-539.086) (-536.229) -- 0:00:23
608000 -- [-536.660] (-541.057) (-535.597) (-536.394) * [-537.592] (-535.644) (-539.991) (-534.936) -- 0:00:23
608500 -- [-537.440] (-539.673) (-537.272) (-534.516) * [-537.508] (-536.612) (-539.763) (-534.840) -- 0:00:23
609000 -- [-535.217] (-536.996) (-545.169) (-535.485) * [-537.754] (-540.888) (-536.281) (-536.400) -- 0:00:23
609500 -- [-535.867] (-536.475) (-535.329) (-535.372) * (-536.306) (-535.542) (-538.214) [-535.912] -- 0:00:23
610000 -- (-537.442) (-536.822) (-536.229) [-535.312] * [-535.980] (-536.283) (-536.962) (-537.701) -- 0:00:23
Average standard deviation of split frequencies: 0.008491
610500 -- (-536.195) (-535.733) [-536.577] (-535.537) * (-536.087) (-535.896) (-534.558) [-535.807] -- 0:00:23
611000 -- (-537.828) [-535.011] (-537.075) (-537.347) * (-540.711) (-535.953) [-536.164] (-538.298) -- 0:00:23
611500 -- (-537.515) (-535.201) [-538.314] (-534.712) * (-538.700) [-534.928] (-537.911) (-541.058) -- 0:00:23
612000 -- (-541.079) [-534.991] (-538.520) (-534.729) * (-538.474) (-535.222) (-539.624) [-536.943] -- 0:00:23
612500 -- (-541.120) (-539.087) [-535.687] (-536.501) * (-534.940) [-534.868] (-535.399) (-538.813) -- 0:00:23
613000 -- (-535.905) (-534.887) [-535.204] (-536.257) * (-536.017) [-539.214] (-535.867) (-536.784) -- 0:00:23
613500 -- (-539.702) [-535.388] (-537.059) (-534.833) * [-535.680] (-540.583) (-534.439) (-536.560) -- 0:00:23
614000 -- (-538.185) (-536.031) [-534.274] (-534.787) * (-538.339) (-538.083) (-536.849) [-535.338] -- 0:00:23
614500 -- (-537.250) (-534.284) (-535.269) [-536.184] * (-535.294) (-536.774) (-537.683) [-541.124] -- 0:00:23
615000 -- (-535.800) (-537.754) [-534.969] (-538.545) * [-536.494] (-539.096) (-535.163) (-535.771) -- 0:00:23
Average standard deviation of split frequencies: 0.008463
615500 -- (-538.301) (-535.728) [-534.262] (-535.781) * [-535.915] (-537.774) (-535.212) (-534.904) -- 0:00:23
616000 -- (-535.585) [-536.325] (-537.541) (-535.377) * (-538.686) [-541.316] (-537.757) (-538.512) -- 0:00:23
616500 -- [-536.268] (-536.870) (-539.780) (-535.361) * [-536.039] (-541.002) (-537.353) (-537.374) -- 0:00:23
617000 -- (-535.059) (-537.401) [-542.383] (-535.543) * (-536.566) [-540.200] (-542.429) (-540.044) -- 0:00:23
617500 -- (-536.402) (-535.087) [-535.910] (-538.077) * (-535.893) (-540.283) [-537.234] (-535.381) -- 0:00:23
618000 -- (-537.659) (-537.112) (-536.683) [-535.937] * (-534.967) (-536.345) [-536.140] (-535.525) -- 0:00:23
618500 -- (-535.065) [-537.487] (-534.835) (-536.944) * [-538.445] (-537.609) (-535.517) (-537.861) -- 0:00:23
619000 -- (-535.429) [-534.935] (-537.530) (-538.280) * (-538.498) [-535.549] (-535.302) (-542.709) -- 0:00:23
619500 -- (-536.003) (-535.432) [-535.399] (-535.811) * (-542.688) (-540.941) (-534.553) [-536.115] -- 0:00:23
620000 -- (-540.530) (-536.409) [-534.893] (-535.560) * [-536.675] (-541.713) (-538.068) (-537.903) -- 0:00:23
Average standard deviation of split frequencies: 0.008980
620500 -- (-538.976) (-539.512) (-539.901) [-535.279] * (-536.182) [-538.832] (-536.399) (-535.728) -- 0:00:23
621000 -- (-540.429) (-539.199) (-537.083) [-534.860] * [-535.292] (-541.138) (-545.269) (-537.255) -- 0:00:23
621500 -- (-538.463) (-537.253) (-540.617) [-537.124] * (-535.593) [-535.416] (-537.801) (-536.202) -- 0:00:23
622000 -- [-538.396] (-541.387) (-537.827) (-536.757) * (-534.586) [-537.062] (-537.329) (-538.772) -- 0:00:23
622500 -- (-535.629) [-536.273] (-538.265) (-539.739) * (-537.050) (-536.293) (-536.593) [-535.558] -- 0:00:23
623000 -- (-536.281) (-536.856) (-538.329) [-535.707] * (-538.057) (-535.620) (-535.291) [-536.203] -- 0:00:22
623500 -- (-541.244) (-536.430) [-536.475] (-537.606) * (-534.806) (-536.137) (-537.526) [-535.024] -- 0:00:22
624000 -- (-537.725) (-536.936) [-536.047] (-535.302) * (-535.999) [-535.648] (-537.758) (-534.985) -- 0:00:22
624500 -- (-540.055) [-536.256] (-535.821) (-534.163) * [-534.847] (-536.823) (-537.631) (-540.361) -- 0:00:22
625000 -- (-536.665) (-537.261) [-535.804] (-535.054) * (-535.712) (-535.581) (-540.341) [-536.999] -- 0:00:22
Average standard deviation of split frequencies: 0.009258
625500 -- (-538.731) (-535.570) (-538.008) [-535.357] * (-536.574) [-535.827] (-538.171) (-535.815) -- 0:00:22
626000 -- [-535.375] (-536.267) (-534.990) (-536.533) * (-537.858) (-539.135) [-539.368] (-535.080) -- 0:00:22
626500 -- [-536.560] (-537.867) (-536.799) (-535.324) * [-534.243] (-537.958) (-535.215) (-538.866) -- 0:00:22
627000 -- (-537.813) (-538.875) [-535.905] (-536.402) * (-534.474) (-536.156) (-541.399) [-539.813] -- 0:00:22
627500 -- (-537.814) (-542.584) [-535.563] (-537.062) * [-535.803] (-538.287) (-542.728) (-537.911) -- 0:00:22
628000 -- (-540.846) (-537.534) [-536.295] (-537.825) * [-534.665] (-539.887) (-538.147) (-535.729) -- 0:00:22
628500 -- (-534.908) (-535.834) [-538.876] (-535.327) * (-535.951) [-534.956] (-535.790) (-535.118) -- 0:00:22
629000 -- (-534.841) (-538.682) (-539.771) [-536.889] * (-538.758) (-540.987) [-536.160] (-536.562) -- 0:00:22
629500 -- (-536.462) [-540.451] (-537.846) (-537.895) * [-537.527] (-537.964) (-538.396) (-535.016) -- 0:00:22
630000 -- [-537.248] (-535.022) (-537.827) (-536.236) * [-534.844] (-536.789) (-536.018) (-534.852) -- 0:00:22
Average standard deviation of split frequencies: 0.009014
630500 -- [-535.421] (-535.255) (-544.258) (-535.438) * (-535.407) (-537.067) (-536.320) [-535.098] -- 0:00:22
631000 -- (-535.717) (-536.122) (-538.949) [-537.347] * (-536.899) [-535.446] (-535.761) (-535.589) -- 0:00:22
631500 -- (-536.141) [-538.332] (-540.986) (-535.213) * (-535.869) [-534.717] (-536.849) (-539.122) -- 0:00:22
632000 -- [-536.193] (-536.138) (-535.973) (-536.629) * (-535.525) [-534.405] (-535.594) (-537.950) -- 0:00:22
632500 -- (-541.842) [-536.484] (-536.243) (-535.987) * (-534.794) [-536.349] (-534.585) (-537.385) -- 0:00:22
633000 -- (-539.454) [-537.273] (-537.872) (-534.858) * (-535.782) (-534.867) [-536.486] (-535.207) -- 0:00:22
633500 -- (-536.021) [-535.406] (-536.108) (-535.586) * (-536.225) [-535.246] (-536.767) (-534.740) -- 0:00:22
634000 -- (-535.381) [-536.576] (-534.844) (-534.191) * [-534.394] (-535.805) (-538.386) (-537.377) -- 0:00:22
634500 -- [-536.256] (-534.897) (-538.867) (-534.361) * [-534.302] (-538.313) (-534.659) (-535.780) -- 0:00:22
635000 -- (-539.175) (-538.378) (-538.026) [-534.289] * (-534.628) [-536.388] (-536.350) (-539.615) -- 0:00:22
Average standard deviation of split frequencies: 0.008153
635500 -- [-540.928] (-542.313) (-536.351) (-537.753) * (-536.693) (-544.303) [-536.188] (-534.749) -- 0:00:22
636000 -- (-539.655) (-534.206) (-536.251) [-538.342] * (-536.493) (-539.524) (-536.256) [-537.179] -- 0:00:22
636500 -- (-535.060) (-534.693) [-537.575] (-536.100) * (-534.995) (-538.304) (-535.539) [-536.175] -- 0:00:22
637000 -- (-536.551) (-534.571) (-535.898) [-535.168] * [-534.247] (-536.362) (-537.459) (-538.441) -- 0:00:22
637500 -- [-536.654] (-534.738) (-537.533) (-538.427) * (-537.773) (-535.607) [-536.093] (-536.239) -- 0:00:22
638000 -- [-537.243] (-537.225) (-536.656) (-536.414) * (-535.062) [-538.608] (-535.927) (-539.717) -- 0:00:22
638500 -- (-536.210) (-536.063) [-534.961] (-538.546) * (-538.861) (-534.492) [-537.398] (-539.608) -- 0:00:22
639000 -- [-535.439] (-536.886) (-535.604) (-537.353) * (-542.998) (-534.470) [-534.440] (-547.004) -- 0:00:22
639500 -- (-534.845) (-537.464) [-535.378] (-537.497) * (-536.898) (-534.731) [-535.963] (-538.574) -- 0:00:21
640000 -- (-541.140) [-535.202] (-537.137) (-535.273) * (-536.312) (-534.927) [-539.058] (-534.665) -- 0:00:21
Average standard deviation of split frequencies: 0.007588
640500 -- (-535.124) (-535.457) (-535.822) [-536.789] * (-538.923) (-538.884) (-537.456) [-535.244] -- 0:00:21
641000 -- [-539.360] (-535.119) (-534.356) (-539.037) * (-540.134) [-537.606] (-537.546) (-536.221) -- 0:00:21
641500 -- (-537.906) [-537.126] (-535.759) (-536.952) * [-536.311] (-537.087) (-539.004) (-535.067) -- 0:00:21
642000 -- (-537.977) (-534.924) [-536.041] (-535.998) * (-536.757) (-534.781) [-536.443] (-535.885) -- 0:00:21
642500 -- (-537.335) (-535.616) [-534.904] (-534.258) * (-537.312) [-534.293] (-539.348) (-537.151) -- 0:00:21
643000 -- (-535.181) [-536.189] (-536.147) (-534.788) * [-537.626] (-534.344) (-536.245) (-535.408) -- 0:00:21
643500 -- [-534.468] (-538.467) (-540.144) (-534.792) * (-538.635) [-538.382] (-536.669) (-537.297) -- 0:00:21
644000 -- (-536.196) (-535.917) [-540.610] (-535.849) * (-539.003) (-537.176) (-536.650) [-535.178] -- 0:00:21
644500 -- (-535.061) (-535.587) [-537.179] (-535.670) * (-536.589) (-538.905) [-537.401] (-534.714) -- 0:00:21
645000 -- (-534.616) (-536.657) (-539.888) [-534.436] * [-535.086] (-537.882) (-538.381) (-535.682) -- 0:00:21
Average standard deviation of split frequencies: 0.007480
645500 -- (-534.782) (-535.185) (-537.951) [-534.908] * [-534.956] (-536.958) (-536.451) (-537.863) -- 0:00:21
646000 -- (-534.688) [-537.423] (-540.253) (-534.853) * (-535.202) (-534.435) [-535.732] (-537.608) -- 0:00:21
646500 -- (-535.322) (-538.383) [-539.992] (-536.125) * (-534.313) [-534.655] (-537.939) (-535.514) -- 0:00:21
647000 -- [-535.155] (-537.343) (-535.949) (-536.192) * (-537.146) (-536.740) [-535.316] (-534.513) -- 0:00:21
647500 -- [-535.029] (-541.730) (-541.135) (-535.506) * [-536.087] (-537.704) (-536.383) (-535.628) -- 0:00:21
648000 -- (-537.343) [-541.531] (-535.810) (-535.499) * [-535.788] (-536.249) (-535.880) (-534.881) -- 0:00:21
648500 -- (-537.806) [-537.051] (-535.520) (-534.886) * [-539.945] (-536.640) (-536.531) (-536.390) -- 0:00:21
649000 -- (-535.955) (-536.183) (-536.987) [-544.039] * (-535.175) (-535.459) [-536.477] (-537.482) -- 0:00:21
649500 -- [-535.967] (-535.644) (-536.194) (-540.694) * (-537.068) (-536.987) (-535.292) [-540.236] -- 0:00:21
650000 -- (-540.544) [-536.588] (-538.969) (-536.985) * (-538.810) (-543.773) (-537.430) [-535.439] -- 0:00:21
Average standard deviation of split frequencies: 0.007834
650500 -- (-537.968) (-535.864) [-535.528] (-534.606) * (-537.741) (-535.732) (-535.258) [-538.053] -- 0:00:21
651000 -- (-534.853) [-537.325] (-536.694) (-536.651) * (-534.952) [-538.223] (-535.894) (-535.060) -- 0:00:21
651500 -- (-535.226) (-536.954) [-535.509] (-536.860) * (-538.709) (-536.708) [-535.240] (-534.133) -- 0:00:21
652000 -- (-535.310) (-542.378) (-534.313) [-534.504] * [-537.278] (-537.111) (-536.484) (-537.016) -- 0:00:21
652500 -- [-535.163] (-539.659) (-540.059) (-534.577) * (-537.623) [-540.602] (-538.216) (-537.037) -- 0:00:21
653000 -- (-535.761) (-537.087) [-534.931] (-536.339) * [-535.283] (-541.125) (-535.288) (-536.957) -- 0:00:21
653500 -- (-534.937) [-537.008] (-537.814) (-538.060) * (-534.802) (-536.551) [-534.837] (-536.686) -- 0:00:21
654000 -- (-540.441) (-535.508) [-536.833] (-537.691) * (-536.196) [-538.382] (-536.782) (-535.479) -- 0:00:21
654500 -- (-537.776) (-534.871) (-536.709) [-537.873] * (-535.829) (-539.475) [-540.791] (-536.869) -- 0:00:21
655000 -- (-538.117) [-535.099] (-539.091) (-539.538) * [-534.996] (-537.281) (-535.767) (-535.275) -- 0:00:21
Average standard deviation of split frequencies: 0.007905
655500 -- [-535.433] (-538.691) (-537.103) (-535.889) * (-536.693) (-537.037) [-535.008] (-535.310) -- 0:00:21
656000 -- (-535.829) [-535.239] (-534.848) (-535.347) * (-536.752) (-536.627) (-536.845) [-535.509] -- 0:00:20
656500 -- [-535.063] (-538.929) (-537.610) (-534.824) * (-537.462) (-536.132) [-538.883] (-536.656) -- 0:00:20
657000 -- (-536.663) (-542.061) [-536.599] (-535.263) * (-535.516) [-536.286] (-540.183) (-537.573) -- 0:00:20
657500 -- (-534.415) [-536.470] (-538.616) (-538.624) * [-536.954] (-535.438) (-539.913) (-538.533) -- 0:00:20
658000 -- (-534.850) (-535.265) (-541.635) [-541.182] * (-536.798) [-535.646] (-537.270) (-535.861) -- 0:00:20
658500 -- (-534.888) (-536.997) [-534.830] (-536.000) * [-537.579] (-537.392) (-536.759) (-534.426) -- 0:00:20
659000 -- (-537.112) (-537.128) (-539.967) [-536.828] * (-537.388) (-537.540) [-536.388] (-535.548) -- 0:00:20
659500 -- (-537.296) (-537.469) [-539.623] (-540.484) * [-536.412] (-537.545) (-537.755) (-535.382) -- 0:00:20
660000 -- (-539.697) [-535.952] (-534.881) (-537.914) * (-538.925) (-537.243) (-535.597) [-535.160] -- 0:00:20
Average standard deviation of split frequencies: 0.007230
660500 -- (-536.122) [-535.744] (-535.981) (-537.499) * (-535.869) [-535.632] (-538.245) (-536.997) -- 0:00:20
661000 -- (-535.619) (-536.099) (-535.905) [-536.164] * (-537.683) [-534.973] (-535.683) (-538.248) -- 0:00:20
661500 -- (-536.832) (-539.004) [-535.192] (-534.330) * (-536.099) [-534.855] (-536.910) (-537.186) -- 0:00:20
662000 -- (-536.801) (-536.475) (-534.595) [-535.132] * (-534.798) [-538.522] (-534.370) (-535.951) -- 0:00:20
662500 -- (-535.406) (-534.984) (-537.176) [-535.236] * [-535.845] (-541.212) (-535.081) (-535.467) -- 0:00:20
663000 -- (-534.712) [-535.610] (-539.331) (-537.739) * [-535.526] (-537.062) (-537.743) (-537.168) -- 0:00:20
663500 -- (-539.933) (-534.871) (-535.210) [-536.100] * (-536.149) (-537.949) [-535.382] (-536.852) -- 0:00:20
664000 -- [-534.068] (-536.943) (-538.380) (-537.003) * (-542.375) (-537.410) [-535.714] (-540.092) -- 0:00:20
664500 -- (-535.235) (-536.422) [-535.785] (-535.736) * (-543.176) (-535.972) [-535.208] (-535.142) -- 0:00:20
665000 -- (-535.375) (-542.951) (-537.679) [-536.554] * (-536.040) [-536.973] (-536.671) (-535.302) -- 0:00:20
Average standard deviation of split frequencies: 0.007220
665500 -- (-535.264) (-536.403) [-537.862] (-538.115) * (-536.513) [-535.957] (-539.913) (-537.084) -- 0:00:20
666000 -- (-537.373) (-537.752) [-534.833] (-536.615) * (-535.334) [-536.160] (-536.031) (-535.301) -- 0:00:20
666500 -- [-535.165] (-537.581) (-538.302) (-535.401) * (-539.329) [-541.902] (-534.261) (-537.082) -- 0:00:20
667000 -- (-538.142) (-536.108) [-535.361] (-537.113) * (-539.010) (-536.444) [-536.247] (-535.328) -- 0:00:20
667500 -- (-534.684) (-538.169) [-534.852] (-535.332) * (-537.755) [-535.598] (-537.270) (-534.771) -- 0:00:20
668000 -- [-537.494] (-536.758) (-535.444) (-536.222) * (-536.562) [-535.348] (-537.958) (-540.840) -- 0:00:20
668500 -- [-536.585] (-534.824) (-535.749) (-534.618) * (-536.424) [-535.525] (-536.313) (-540.803) -- 0:00:20
669000 -- (-536.489) (-535.054) [-535.567] (-536.390) * (-537.347) [-536.410] (-536.301) (-538.020) -- 0:00:20
669500 -- (-536.399) (-536.090) [-536.090] (-534.365) * (-535.318) [-536.280] (-536.783) (-537.676) -- 0:00:20
670000 -- (-536.945) [-537.147] (-540.687) (-534.311) * (-537.203) (-536.079) [-535.525] (-535.644) -- 0:00:20
Average standard deviation of split frequencies: 0.007205
670500 -- (-537.499) (-536.966) [-539.269] (-534.314) * (-536.613) [-535.125] (-536.153) (-537.817) -- 0:00:20
671000 -- (-537.771) (-535.819) (-539.053) [-536.782] * (-535.424) [-536.558] (-534.901) (-534.636) -- 0:00:20
671500 -- [-539.737] (-535.187) (-536.158) (-537.011) * (-536.364) (-535.889) [-536.857] (-536.157) -- 0:00:20
672000 -- (-534.682) (-536.415) (-535.416) [-536.292] * (-535.377) (-536.361) (-536.731) [-534.793] -- 0:00:20
672500 -- (-536.197) (-535.548) (-535.081) [-536.204] * (-534.254) [-535.329] (-539.065) (-534.901) -- 0:00:19
673000 -- (-539.026) [-535.483] (-536.736) (-538.012) * (-536.902) [-537.247] (-538.575) (-541.449) -- 0:00:19
673500 -- (-537.859) (-535.547) (-536.632) [-538.412] * (-535.053) [-534.440] (-537.763) (-538.198) -- 0:00:19
674000 -- (-542.046) (-538.601) (-539.514) [-538.024] * [-537.648] (-534.848) (-539.638) (-536.749) -- 0:00:19
674500 -- (-536.665) (-536.210) [-539.133] (-535.369) * (-538.449) [-539.280] (-536.368) (-535.454) -- 0:00:19
675000 -- (-536.172) [-537.756] (-536.462) (-535.390) * (-536.609) [-536.349] (-538.091) (-537.505) -- 0:00:19
Average standard deviation of split frequencies: 0.007061
675500 -- (-535.458) [-535.656] (-534.650) (-535.311) * (-536.506) [-535.513] (-537.229) (-536.243) -- 0:00:19
676000 -- [-535.832] (-539.112) (-536.522) (-535.071) * (-535.063) [-535.493] (-537.362) (-536.026) -- 0:00:19
676500 -- [-535.291] (-536.726) (-537.159) (-538.036) * (-534.493) [-539.514] (-538.571) (-537.597) -- 0:00:19
677000 -- (-535.813) (-535.768) (-536.558) [-538.209] * (-534.611) (-542.955) (-536.414) [-538.231] -- 0:00:19
677500 -- (-536.817) (-536.536) [-535.347] (-536.508) * (-536.229) [-538.326] (-538.975) (-542.615) -- 0:00:19
678000 -- (-536.665) [-537.270] (-536.244) (-535.868) * (-538.323) [-539.190] (-537.815) (-535.766) -- 0:00:19
678500 -- (-537.818) [-534.902] (-537.872) (-540.187) * (-535.697) (-535.533) [-536.949] (-538.625) -- 0:00:19
679000 -- [-536.076] (-538.276) (-542.679) (-537.010) * (-536.776) (-537.757) [-536.720] (-537.641) -- 0:00:19
679500 -- (-535.858) [-536.613] (-538.727) (-536.483) * (-534.119) [-534.617] (-534.745) (-539.429) -- 0:00:19
680000 -- (-536.330) [-537.350] (-538.126) (-536.944) * (-535.112) (-538.397) (-536.670) [-535.620] -- 0:00:19
Average standard deviation of split frequencies: 0.007142
680500 -- (-534.425) (-535.909) (-537.988) [-535.856] * [-537.678] (-536.334) (-536.446) (-536.776) -- 0:00:19
681000 -- (-535.767) (-535.088) [-534.841] (-535.521) * (-536.334) (-536.328) (-538.864) [-536.258] -- 0:00:19
681500 -- (-535.264) (-535.127) [-535.884] (-534.908) * (-539.358) (-536.351) [-536.639] (-535.515) -- 0:00:19
682000 -- (-536.471) (-536.656) (-534.925) [-534.759] * (-535.140) (-536.869) (-535.091) [-540.723] -- 0:00:19
682500 -- (-537.700) (-537.083) [-538.242] (-536.387) * (-537.160) (-538.115) [-534.643] (-543.339) -- 0:00:19
683000 -- [-535.153] (-537.231) (-537.482) (-536.887) * [-536.105] (-534.197) (-536.897) (-539.021) -- 0:00:19
683500 -- (-535.424) (-537.173) (-537.742) [-538.627] * (-538.819) (-536.010) [-536.914] (-536.255) -- 0:00:19
684000 -- (-537.644) (-536.418) [-535.034] (-538.030) * (-534.545) (-538.165) (-536.558) [-535.181] -- 0:00:19
684500 -- (-535.769) (-534.900) (-535.692) [-535.517] * (-535.007) (-538.342) (-536.382) [-535.650] -- 0:00:19
685000 -- (-536.135) [-535.701] (-536.181) (-535.232) * [-536.178] (-536.234) (-536.752) (-535.012) -- 0:00:19
Average standard deviation of split frequencies: 0.006743
685500 -- (-535.770) (-535.133) [-538.069] (-535.417) * (-537.319) (-536.185) (-538.658) [-534.399] -- 0:00:19
686000 -- [-536.953] (-539.021) (-535.581) (-536.938) * (-537.463) [-538.816] (-538.474) (-534.604) -- 0:00:19
686500 -- (-537.351) (-537.065) [-534.667] (-535.792) * (-534.590) (-538.278) (-535.492) [-537.706] -- 0:00:19
687000 -- (-535.849) [-535.505] (-536.364) (-537.505) * (-535.803) (-534.916) [-534.460] (-536.316) -- 0:00:19
687500 -- (-538.106) [-537.205] (-541.633) (-538.191) * (-536.116) (-534.871) [-535.937] (-538.033) -- 0:00:19
688000 -- [-536.315] (-538.181) (-538.055) (-539.418) * (-540.802) [-535.552] (-538.354) (-539.239) -- 0:00:19
688500 -- (-535.366) [-540.817] (-536.081) (-540.541) * [-536.291] (-534.838) (-536.191) (-535.264) -- 0:00:19
689000 -- (-536.201) (-535.905) (-535.890) [-536.298] * (-536.511) (-534.954) [-536.234] (-536.858) -- 0:00:18
689500 -- (-538.317) (-540.705) [-535.885] (-536.688) * (-536.756) [-539.276] (-535.761) (-537.861) -- 0:00:18
690000 -- (-536.923) (-543.377) (-538.160) [-534.986] * (-535.787) (-538.994) (-535.492) [-536.842] -- 0:00:18
Average standard deviation of split frequencies: 0.006655
690500 -- (-538.862) (-535.921) (-536.135) [-534.959] * (-536.169) (-536.594) (-538.797) [-536.870] -- 0:00:18
691000 -- (-541.602) (-536.035) (-538.311) [-535.468] * (-535.688) [-537.852] (-537.459) (-536.334) -- 0:00:18
691500 -- (-536.055) (-535.740) [-537.415] (-534.840) * [-535.542] (-536.083) (-535.430) (-536.490) -- 0:00:18
692000 -- [-536.385] (-534.726) (-536.134) (-535.815) * (-542.080) (-537.184) (-535.196) [-538.756] -- 0:00:18
692500 -- (-539.257) (-541.222) [-534.782] (-535.999) * (-534.642) (-539.671) (-536.307) [-539.500] -- 0:00:18
693000 -- [-536.821] (-535.804) (-535.313) (-534.626) * [-534.669] (-542.501) (-537.715) (-537.979) -- 0:00:18
693500 -- (-535.988) [-535.111] (-535.809) (-535.691) * (-534.577) [-536.939] (-537.559) (-535.461) -- 0:00:18
694000 -- (-538.499) (-538.194) (-538.761) [-537.999] * (-540.337) (-536.227) (-536.301) [-535.228] -- 0:00:18
694500 -- [-537.010] (-537.401) (-536.207) (-538.765) * (-541.391) (-536.796) (-536.282) [-535.551] -- 0:00:18
695000 -- (-535.927) [-537.748] (-536.105) (-537.486) * [-537.567] (-536.412) (-536.983) (-535.269) -- 0:00:18
Average standard deviation of split frequencies: 0.007027
695500 -- (-536.423) [-534.521] (-536.678) (-535.483) * (-536.993) [-535.960] (-542.893) (-535.085) -- 0:00:18
696000 -- (-534.321) [-535.420] (-537.772) (-536.229) * [-538.076] (-537.028) (-539.160) (-536.873) -- 0:00:18
696500 -- (-540.391) (-535.423) (-541.774) [-535.855] * [-540.463] (-534.526) (-538.474) (-536.728) -- 0:00:18
697000 -- (-535.473) (-534.903) (-542.431) [-537.534] * (-539.922) [-534.243] (-538.956) (-535.002) -- 0:00:18
697500 -- (-537.201) [-534.473] (-536.536) (-535.698) * (-538.885) [-536.079] (-538.909) (-535.147) -- 0:00:18
698000 -- (-540.963) [-535.956] (-536.534) (-537.884) * (-536.618) (-537.875) (-536.277) [-534.851] -- 0:00:18
698500 -- (-537.706) [-536.709] (-536.884) (-539.950) * (-534.995) [-535.974] (-535.500) (-536.022) -- 0:00:18
699000 -- (-538.338) (-534.347) [-537.569] (-536.656) * (-535.864) (-540.173) [-536.044] (-537.229) -- 0:00:18
699500 -- (-535.257) (-535.423) [-534.559] (-534.396) * (-534.266) (-539.294) [-539.012] (-537.380) -- 0:00:18
700000 -- [-535.630] (-535.997) (-534.455) (-534.597) * [-535.318] (-539.192) (-537.960) (-535.983) -- 0:00:18
Average standard deviation of split frequencies: 0.007317
700500 -- (-535.945) (-538.809) [-537.305] (-537.612) * (-537.264) (-536.254) [-535.535] (-535.623) -- 0:00:18
701000 -- (-535.000) (-534.851) [-537.280] (-537.592) * (-541.485) (-543.422) [-535.583] (-537.409) -- 0:00:18
701500 -- (-535.541) [-536.963] (-536.334) (-535.754) * (-536.057) (-535.860) (-537.048) [-535.828] -- 0:00:18
702000 -- (-539.222) (-536.634) [-540.243] (-538.892) * (-535.612) (-534.343) [-537.918] (-535.311) -- 0:00:18
702500 -- [-535.386] (-537.051) (-539.018) (-535.740) * [-538.227] (-536.450) (-537.730) (-538.464) -- 0:00:18
703000 -- (-536.298) (-536.730) (-536.866) [-538.202] * [-538.404] (-536.281) (-536.428) (-538.163) -- 0:00:18
703500 -- (-534.785) (-542.313) [-536.180] (-537.286) * (-535.970) [-535.316] (-538.411) (-537.401) -- 0:00:18
704000 -- (-538.825) [-537.252] (-535.005) (-540.638) * (-535.564) [-535.165] (-537.301) (-539.145) -- 0:00:18
704500 -- (-537.832) (-538.838) [-535.750] (-536.542) * (-537.283) (-540.130) (-536.936) [-537.634] -- 0:00:18
705000 -- [-537.518] (-535.235) (-537.849) (-535.157) * (-537.928) (-534.961) [-537.017] (-536.726) -- 0:00:17
Average standard deviation of split frequencies: 0.007011
705500 -- [-539.787] (-535.519) (-535.850) (-535.839) * (-535.886) [-534.881] (-534.050) (-535.672) -- 0:00:17
706000 -- (-539.797) (-535.000) [-535.799] (-541.932) * [-535.728] (-535.440) (-534.484) (-534.626) -- 0:00:17
706500 -- (-540.638) [-536.912] (-538.445) (-536.135) * (-536.199) (-539.557) (-535.890) [-538.470] -- 0:00:17
707000 -- (-535.794) (-540.871) (-537.863) [-535.018] * (-538.144) (-539.138) (-536.602) [-536.469] -- 0:00:17
707500 -- (-539.634) [-534.412] (-536.659) (-535.888) * (-535.156) (-539.992) (-535.992) [-539.928] -- 0:00:17
708000 -- [-535.211] (-539.101) (-536.476) (-535.258) * (-536.164) (-535.645) (-534.796) [-537.120] -- 0:00:17
708500 -- [-537.760] (-537.229) (-535.455) (-536.998) * (-536.745) (-537.362) (-537.908) [-535.511] -- 0:00:17
709000 -- (-537.147) (-535.334) [-534.846] (-536.601) * (-541.958) [-534.773] (-538.098) (-536.287) -- 0:00:17
709500 -- (-538.974) [-534.946] (-539.789) (-537.217) * (-537.714) [-535.498] (-536.061) (-535.967) -- 0:00:17
710000 -- (-540.062) (-536.521) [-538.556] (-537.437) * (-536.584) [-538.331] (-536.313) (-534.932) -- 0:00:17
Average standard deviation of split frequencies: 0.007380
710500 -- (-539.270) (-535.328) (-535.386) [-535.582] * [-534.889] (-538.921) (-534.741) (-537.228) -- 0:00:17
711000 -- (-537.322) [-535.729] (-536.164) (-536.473) * (-536.750) (-537.673) (-536.885) [-537.771] -- 0:00:17
711500 -- (-535.099) [-534.508] (-537.373) (-537.442) * (-537.357) [-535.270] (-534.841) (-535.372) -- 0:00:17
712000 -- (-534.373) (-534.508) (-535.399) [-538.897] * (-534.837) (-535.707) (-538.813) [-536.596] -- 0:00:17
712500 -- (-534.705) [-534.772] (-535.844) (-536.002) * (-537.505) (-536.081) (-535.991) [-536.629] -- 0:00:17
713000 -- [-535.425] (-536.351) (-537.926) (-535.757) * [-535.187] (-535.084) (-539.022) (-535.388) -- 0:00:17
713500 -- (-537.695) [-535.626] (-536.353) (-534.733) * (-539.814) (-534.613) [-535.030] (-536.743) -- 0:00:17
714000 -- [-534.871] (-535.503) (-535.128) (-534.951) * (-536.802) (-536.261) (-536.716) [-535.764] -- 0:00:17
714500 -- (-534.871) (-535.261) [-536.433] (-538.368) * (-535.549) [-535.086] (-534.572) (-535.606) -- 0:00:17
715000 -- (-536.771) [-540.584] (-539.330) (-541.465) * (-537.794) [-536.774] (-534.353) (-536.279) -- 0:00:17
Average standard deviation of split frequencies: 0.007695
715500 -- [-536.437] (-540.889) (-535.317) (-537.612) * (-535.883) (-537.902) (-537.743) [-537.188] -- 0:00:17
716000 -- [-537.497] (-535.684) (-535.020) (-538.245) * (-537.965) (-536.104) [-536.249] (-539.190) -- 0:00:17
716500 -- [-536.930] (-534.231) (-534.829) (-536.136) * (-536.337) (-535.890) [-535.189] (-540.589) -- 0:00:17
717000 -- (-541.053) (-535.682) [-535.305] (-537.927) * (-537.669) [-538.414] (-535.338) (-537.548) -- 0:00:17
717500 -- (-534.586) (-545.124) [-535.982] (-534.964) * (-535.649) [-538.127] (-537.000) (-536.176) -- 0:00:17
718000 -- (-538.200) (-537.498) [-535.217] (-536.968) * [-536.760] (-536.035) (-536.094) (-537.503) -- 0:00:17
718500 -- (-540.273) (-539.686) [-537.257] (-535.399) * [-538.907] (-535.485) (-536.869) (-536.764) -- 0:00:17
719000 -- (-535.627) (-539.031) [-536.871] (-536.007) * (-538.053) (-536.978) (-535.118) [-537.979] -- 0:00:17
719500 -- (-535.492) [-536.941] (-538.021) (-534.828) * (-535.184) (-539.338) [-536.098] (-534.951) -- 0:00:17
720000 -- [-536.696] (-536.987) (-538.744) (-538.024) * (-539.073) (-538.490) (-537.110) [-534.542] -- 0:00:17
Average standard deviation of split frequencies: 0.007400
720500 -- (-534.451) [-535.327] (-538.315) (-538.811) * (-536.036) (-534.962) [-535.663] (-535.731) -- 0:00:17
721000 -- [-534.364] (-538.221) (-538.734) (-537.818) * (-537.907) (-534.715) [-535.989] (-541.250) -- 0:00:17
721500 -- (-534.538) [-534.729] (-536.541) (-540.637) * (-536.525) [-534.776] (-534.568) (-539.909) -- 0:00:16
722000 -- (-537.423) (-536.446) [-541.150] (-536.812) * (-534.906) [-535.724] (-535.311) (-537.495) -- 0:00:16
722500 -- (-537.044) (-535.965) (-539.654) [-535.453] * (-538.159) (-538.942) [-535.452] (-536.370) -- 0:00:16
723000 -- [-536.760] (-539.110) (-536.962) (-536.128) * (-539.396) (-539.504) (-537.807) [-536.571] -- 0:00:16
723500 -- (-535.888) [-536.377] (-536.050) (-534.470) * (-538.774) [-535.745] (-538.914) (-538.518) -- 0:00:16
724000 -- (-537.016) (-538.581) [-534.481] (-536.426) * [-536.032] (-535.646) (-536.059) (-536.471) -- 0:00:16
724500 -- (-535.111) [-535.594] (-534.502) (-544.150) * (-536.211) (-537.012) (-536.126) [-537.566] -- 0:00:16
725000 -- [-535.170] (-536.017) (-537.687) (-536.574) * (-537.364) [-535.675] (-543.717) (-545.275) -- 0:00:16
Average standard deviation of split frequencies: 0.007711
725500 -- (-535.417) (-537.920) (-535.370) [-538.150] * (-536.351) (-539.470) [-536.834] (-534.628) -- 0:00:16
726000 -- [-534.721] (-538.696) (-536.948) (-534.593) * (-536.488) (-537.348) [-535.068] (-535.457) -- 0:00:16
726500 -- [-537.441] (-539.180) (-536.513) (-536.382) * (-536.918) [-535.855] (-538.056) (-539.114) -- 0:00:16
727000 -- [-536.236] (-535.268) (-536.103) (-536.860) * (-538.605) (-535.322) [-536.376] (-536.669) -- 0:00:16
727500 -- [-534.503] (-535.661) (-537.295) (-538.350) * (-538.936) (-535.741) (-535.154) [-535.042] -- 0:00:16
728000 -- (-538.956) (-536.371) (-540.276) [-535.198] * (-539.082) [-535.150] (-539.563) (-535.552) -- 0:00:16
728500 -- (-540.849) [-535.431] (-540.062) (-535.662) * (-538.759) [-535.449] (-539.411) (-537.069) -- 0:00:16
729000 -- (-537.841) (-534.368) (-537.682) [-535.061] * (-535.236) (-535.719) (-539.725) [-535.345] -- 0:00:16
729500 -- (-535.995) (-535.200) (-537.754) [-535.659] * (-535.068) (-535.493) [-536.428] (-537.802) -- 0:00:16
730000 -- [-535.757] (-535.056) (-534.524) (-537.185) * [-535.771] (-534.512) (-537.928) (-535.777) -- 0:00:16
Average standard deviation of split frequencies: 0.008024
730500 -- [-534.890] (-537.268) (-535.033) (-537.095) * (-536.894) [-535.459] (-536.460) (-539.398) -- 0:00:16
731000 -- (-535.800) [-534.500] (-536.583) (-534.747) * (-534.518) (-536.813) (-534.711) [-535.032] -- 0:00:16
731500 -- [-535.784] (-537.452) (-538.115) (-535.583) * (-537.592) [-535.399] (-534.517) (-541.118) -- 0:00:16
732000 -- (-539.879) (-539.101) (-535.489) [-536.417] * (-540.356) [-536.250] (-536.303) (-534.830) -- 0:00:16
732500 -- [-537.026] (-537.147) (-536.807) (-540.020) * (-540.724) (-539.139) (-535.554) [-535.345] -- 0:00:16
733000 -- (-536.010) (-536.158) [-537.171] (-543.387) * (-537.343) [-536.367] (-535.324) (-534.836) -- 0:00:16
733500 -- (-536.151) (-534.510) [-536.618] (-537.575) * (-535.464) (-535.865) (-538.975) [-535.851] -- 0:00:16
734000 -- (-535.704) (-537.368) (-535.739) [-535.252] * (-538.344) (-536.468) [-535.392] (-535.586) -- 0:00:16
734500 -- [-535.288] (-535.924) (-538.036) (-536.788) * [-535.082] (-538.057) (-539.194) (-536.004) -- 0:00:16
735000 -- (-534.214) (-534.543) (-544.712) [-535.349] * [-535.626] (-536.750) (-538.552) (-541.153) -- 0:00:16
Average standard deviation of split frequencies: 0.007899
735500 -- (-535.788) (-534.632) (-538.647) [-535.803] * (-536.503) (-539.747) (-538.448) [-537.048] -- 0:00:16
736000 -- (-535.652) (-534.493) (-537.129) [-537.976] * (-536.108) (-537.192) (-538.208) [-537.450] -- 0:00:16
736500 -- (-536.121) (-536.590) [-539.061] (-537.245) * (-542.559) (-534.347) (-540.369) [-534.833] -- 0:00:16
737000 -- [-536.381] (-536.890) (-534.806) (-541.383) * (-534.944) (-537.871) (-536.338) [-534.961] -- 0:00:16
737500 -- (-537.652) (-536.354) (-538.503) [-536.852] * (-535.408) [-537.450] (-539.960) (-537.035) -- 0:00:16
738000 -- (-534.627) (-540.010) [-537.421] (-534.476) * (-536.280) (-537.900) [-535.359] (-535.743) -- 0:00:15
738500 -- [-534.922] (-535.021) (-536.337) (-537.334) * (-536.834) (-537.335) [-535.708] (-534.026) -- 0:00:15
739000 -- (-538.635) [-534.968] (-536.706) (-539.299) * (-537.299) [-536.085] (-536.356) (-535.314) -- 0:00:15
739500 -- (-536.423) (-537.537) [-536.370] (-535.276) * (-538.764) (-538.346) (-537.976) [-537.644] -- 0:00:15
740000 -- [-537.946] (-536.386) (-536.796) (-535.929) * (-538.986) (-534.498) (-537.111) [-535.426] -- 0:00:15
Average standard deviation of split frequencies: 0.008062
740500 -- [-537.840] (-534.861) (-535.762) (-540.316) * [-535.273] (-536.685) (-538.864) (-535.421) -- 0:00:15
741000 -- (-536.486) (-540.402) (-535.344) [-536.325] * [-535.211] (-538.500) (-536.440) (-535.097) -- 0:00:15
741500 -- (-535.272) (-539.145) [-536.939] (-537.693) * [-536.592] (-535.765) (-535.768) (-535.480) -- 0:00:15
742000 -- (-536.410) (-536.060) (-539.884) [-539.404] * (-535.721) (-536.338) (-540.183) [-535.247] -- 0:00:15
742500 -- (-536.381) (-536.633) [-539.112] (-540.024) * (-537.890) [-535.800] (-537.093) (-535.656) -- 0:00:15
743000 -- (-536.686) [-536.571] (-536.897) (-537.986) * (-536.100) [-536.385] (-535.793) (-539.192) -- 0:00:15
743500 -- (-540.963) (-536.786) [-539.441] (-538.370) * (-539.676) [-534.931] (-537.644) (-536.241) -- 0:00:15
744000 -- (-538.134) (-535.723) (-538.915) [-537.171] * (-536.299) [-539.798] (-540.919) (-535.603) -- 0:00:15
744500 -- (-540.990) (-535.432) [-535.933] (-534.914) * (-535.339) (-539.322) [-536.177] (-534.862) -- 0:00:15
745000 -- (-535.637) [-536.338] (-536.833) (-538.249) * (-537.467) (-535.408) (-537.800) [-535.679] -- 0:00:15
Average standard deviation of split frequencies: 0.008046
745500 -- (-534.625) (-536.043) [-537.687] (-537.231) * [-535.880] (-537.693) (-536.529) (-539.898) -- 0:00:15
746000 -- (-536.343) (-536.709) (-538.339) [-535.847] * (-535.554) [-536.081] (-538.326) (-536.029) -- 0:00:15
746500 -- (-537.560) (-538.967) (-539.550) [-536.444] * [-535.486] (-535.832) (-536.945) (-536.366) -- 0:00:15
747000 -- (-538.664) [-537.668] (-539.619) (-538.018) * [-538.640] (-536.842) (-537.807) (-538.645) -- 0:00:15
747500 -- [-536.708] (-536.115) (-539.553) (-536.093) * [-538.987] (-539.875) (-535.840) (-536.313) -- 0:00:15
748000 -- (-536.980) (-535.218) [-538.988] (-540.486) * (-539.992) (-538.890) [-535.822] (-539.158) -- 0:00:15
748500 -- (-537.408) [-534.349] (-537.221) (-536.271) * (-539.225) (-538.441) [-535.643] (-541.694) -- 0:00:15
749000 -- (-536.872) [-534.373] (-535.731) (-536.287) * (-535.882) (-537.811) [-536.584] (-535.829) -- 0:00:15
749500 -- (-537.353) (-535.999) [-535.467] (-535.509) * (-537.943) (-537.653) [-537.451] (-534.994) -- 0:00:15
750000 -- (-535.966) (-535.997) [-535.130] (-535.665) * (-537.721) (-536.432) (-537.309) [-538.185] -- 0:00:15
Average standard deviation of split frequencies: 0.007703
750500 -- (-537.439) [-534.709] (-536.570) (-534.830) * (-540.397) [-536.809] (-537.596) (-535.701) -- 0:00:15
751000 -- (-537.785) (-535.930) [-537.282] (-537.466) * (-539.367) (-534.568) (-537.573) [-537.761] -- 0:00:15
751500 -- (-536.430) [-535.459] (-534.793) (-536.638) * (-537.915) [-534.783] (-537.761) (-538.222) -- 0:00:15
752000 -- (-536.526) (-536.102) [-536.242] (-536.600) * [-536.485] (-539.109) (-535.628) (-542.260) -- 0:00:15
752500 -- (-539.796) (-535.661) [-535.756] (-537.651) * (-541.407) [-538.014] (-537.053) (-535.619) -- 0:00:15
753000 -- (-542.067) (-535.166) (-536.137) [-536.998] * [-544.563] (-538.826) (-535.156) (-535.843) -- 0:00:15
753500 -- (-537.795) (-534.783) (-544.154) [-539.538] * (-538.819) [-534.840] (-535.400) (-536.297) -- 0:00:15
754000 -- (-537.355) [-534.787] (-537.270) (-538.209) * [-536.175] (-535.526) (-536.142) (-537.096) -- 0:00:15
754500 -- (-535.094) [-537.554] (-539.595) (-535.314) * [-536.344] (-536.859) (-538.985) (-535.393) -- 0:00:14
755000 -- (-536.597) (-539.635) (-536.145) [-534.795] * (-535.563) [-538.704] (-540.342) (-536.681) -- 0:00:14
Average standard deviation of split frequencies: 0.007275
755500 -- (-535.377) (-538.851) (-535.496) [-537.737] * (-535.543) [-535.853] (-540.734) (-534.703) -- 0:00:14
756000 -- (-537.006) [-534.520] (-534.232) (-537.397) * [-535.811] (-534.321) (-536.360) (-537.894) -- 0:00:14
756500 -- (-537.319) (-535.943) [-535.306] (-536.308) * [-535.723] (-535.361) (-539.631) (-538.483) -- 0:00:14
757000 -- (-537.879) (-536.319) [-537.039] (-539.079) * (-535.078) [-536.016] (-540.330) (-534.866) -- 0:00:14
757500 -- [-537.460] (-540.799) (-537.013) (-542.217) * (-535.723) [-537.552] (-536.863) (-535.445) -- 0:00:14
758000 -- (-538.884) (-538.315) (-537.016) [-535.736] * [-534.705] (-535.738) (-534.901) (-534.883) -- 0:00:14
758500 -- [-535.089] (-535.881) (-534.608) (-538.563) * [-535.158] (-539.958) (-539.003) (-536.192) -- 0:00:14
759000 -- (-535.062) [-535.996] (-537.585) (-537.151) * [-536.997] (-538.370) (-536.455) (-535.093) -- 0:00:14
759500 -- (-537.013) [-535.182] (-536.943) (-539.404) * (-535.409) [-538.885] (-535.962) (-535.109) -- 0:00:14
760000 -- [-534.992] (-538.165) (-537.693) (-538.066) * (-535.657) (-535.194) (-537.530) [-535.701] -- 0:00:14
Average standard deviation of split frequencies: 0.007354
760500 -- (-539.643) [-537.940] (-534.628) (-537.998) * (-534.580) [-539.084] (-535.678) (-535.619) -- 0:00:14
761000 -- (-534.618) (-535.622) [-536.053] (-535.489) * (-537.638) [-539.529] (-537.690) (-537.326) -- 0:00:14
761500 -- (-537.597) (-534.699) (-537.429) [-536.384] * (-534.610) (-538.728) (-537.591) [-535.725] -- 0:00:14
762000 -- (-537.557) [-538.937] (-536.746) (-534.829) * (-534.603) (-537.719) [-537.381] (-539.548) -- 0:00:14
762500 -- (-537.618) (-537.086) [-534.952] (-535.152) * (-536.001) [-537.032] (-535.712) (-537.539) -- 0:00:14
763000 -- [-536.858] (-535.454) (-534.867) (-534.840) * (-535.016) [-536.499] (-536.775) (-535.237) -- 0:00:14
763500 -- (-541.845) (-538.278) [-534.338] (-535.721) * (-534.710) (-534.763) [-536.656] (-537.002) -- 0:00:14
764000 -- [-538.681] (-536.428) (-536.867) (-535.243) * (-535.828) [-538.977] (-535.281) (-539.611) -- 0:00:14
764500 -- (-538.974) (-535.689) [-535.586] (-536.233) * (-538.276) [-540.473] (-535.141) (-540.511) -- 0:00:14
765000 -- (-536.238) (-534.915) (-536.086) [-536.130] * (-535.379) [-534.363] (-535.296) (-535.881) -- 0:00:14
Average standard deviation of split frequencies: 0.007508
765500 -- (-534.983) (-535.154) [-538.888] (-537.360) * (-536.055) (-534.549) (-540.192) [-536.408] -- 0:00:14
766000 -- (-539.719) (-535.670) [-539.361] (-537.432) * [-534.392] (-535.849) (-541.666) (-534.855) -- 0:00:14
766500 -- (-536.525) (-535.437) [-536.300] (-536.428) * [-538.911] (-535.012) (-537.345) (-536.544) -- 0:00:14
767000 -- [-536.260] (-536.208) (-535.502) (-537.955) * (-540.305) [-539.086] (-538.152) (-539.014) -- 0:00:14
767500 -- (-538.481) [-536.235] (-536.438) (-536.887) * (-534.814) (-541.100) (-536.691) [-537.924] -- 0:00:14
768000 -- [-535.724] (-537.367) (-535.646) (-537.510) * (-538.113) (-537.667) (-539.614) [-535.046] -- 0:00:14
768500 -- (-536.784) [-539.947] (-537.838) (-536.329) * (-540.605) (-537.924) [-537.736] (-536.745) -- 0:00:14
769000 -- (-539.892) [-544.185] (-536.066) (-537.542) * [-534.802] (-538.868) (-537.831) (-536.366) -- 0:00:14
769500 -- (-536.102) (-536.610) [-535.515] (-540.699) * (-539.393) [-535.480] (-536.416) (-540.926) -- 0:00:14
770000 -- (-536.949) (-536.906) [-537.437] (-535.723) * (-537.073) [-536.509] (-536.749) (-537.603) -- 0:00:14
Average standard deviation of split frequencies: 0.006973
770500 -- [-535.595] (-537.884) (-538.487) (-538.377) * (-538.971) [-539.536] (-537.604) (-535.500) -- 0:00:13
771000 -- [-534.908] (-536.252) (-536.501) (-539.828) * [-537.109] (-538.156) (-537.051) (-534.752) -- 0:00:13
771500 -- (-542.779) (-536.177) (-537.029) [-537.769] * (-535.898) (-535.144) [-536.276] (-537.275) -- 0:00:13
772000 -- (-536.163) [-539.448] (-539.005) (-535.301) * [-534.619] (-535.090) (-536.894) (-535.985) -- 0:00:13
772500 -- (-538.221) (-537.242) [-534.193] (-540.751) * (-534.720) [-537.777] (-540.071) (-536.178) -- 0:00:13
773000 -- (-535.614) (-538.765) (-536.886) [-537.540] * [-534.621] (-540.482) (-537.987) (-537.786) -- 0:00:13
773500 -- (-536.206) [-536.935] (-536.598) (-534.863) * (-536.587) [-538.534] (-538.192) (-538.850) -- 0:00:13
774000 -- (-536.480) (-535.311) (-538.528) [-535.634] * (-537.329) (-538.207) (-538.510) [-535.052] -- 0:00:13
774500 -- (-535.990) [-537.387] (-535.990) (-541.401) * (-536.885) (-542.302) [-535.919] (-535.358) -- 0:00:13
775000 -- (-535.287) (-540.979) [-535.733] (-540.097) * (-539.634) (-536.725) (-538.718) [-535.922] -- 0:00:13
Average standard deviation of split frequencies: 0.006763
775500 -- (-536.773) (-539.131) (-537.762) [-535.960] * (-546.896) (-535.295) [-540.524] (-536.130) -- 0:00:13
776000 -- [-536.851] (-538.647) (-537.720) (-538.490) * (-542.339) (-534.605) [-535.632] (-535.768) -- 0:00:13
776500 -- (-536.624) [-538.067] (-539.258) (-537.245) * [-536.351] (-534.975) (-535.938) (-534.963) -- 0:00:13
777000 -- (-537.635) (-536.360) (-539.334) [-536.381] * (-536.359) (-535.927) [-536.024] (-539.340) -- 0:00:13
777500 -- (-535.604) [-537.756] (-535.780) (-536.557) * (-535.069) [-536.088] (-535.636) (-536.270) -- 0:00:13
778000 -- (-538.280) [-535.748] (-539.814) (-536.938) * (-536.551) [-535.429] (-536.177) (-535.372) -- 0:00:13
778500 -- [-536.094] (-539.884) (-538.298) (-535.364) * (-539.005) (-539.198) [-537.590] (-535.290) -- 0:00:13
779000 -- (-534.868) (-536.852) [-535.995] (-534.716) * (-535.720) [-538.666] (-535.385) (-536.101) -- 0:00:13
779500 -- [-539.920] (-535.721) (-540.057) (-535.234) * (-543.141) (-541.343) [-535.889] (-535.076) -- 0:00:13
780000 -- [-536.614] (-538.555) (-535.176) (-537.187) * (-538.244) (-536.348) (-539.824) [-536.554] -- 0:00:13
Average standard deviation of split frequencies: 0.007085
780500 -- (-535.065) [-536.145] (-536.735) (-536.128) * [-536.217] (-535.115) (-534.983) (-535.739) -- 0:00:13
781000 -- (-537.494) [-539.610] (-541.968) (-535.944) * (-539.587) [-536.520] (-535.859) (-536.636) -- 0:00:13
781500 -- [-537.995] (-535.748) (-539.989) (-536.168) * (-536.306) (-536.307) [-534.869] (-536.792) -- 0:00:13
782000 -- (-535.285) (-538.134) [-536.952] (-534.556) * [-536.174] (-535.930) (-539.226) (-539.054) -- 0:00:13
782500 -- [-534.812] (-540.170) (-536.563) (-535.469) * (-534.606) [-536.378] (-535.276) (-537.276) -- 0:00:13
783000 -- (-536.028) [-537.461] (-536.928) (-540.087) * [-535.801] (-537.979) (-534.959) (-536.158) -- 0:00:13
783500 -- [-536.855] (-537.113) (-540.557) (-537.031) * (-535.776) (-537.454) (-538.973) [-538.264] -- 0:00:13
784000 -- [-535.082] (-535.865) (-537.591) (-540.542) * (-535.919) (-534.886) [-535.883] (-535.352) -- 0:00:13
784500 -- (-535.595) [-537.049] (-536.078) (-535.531) * [-536.986] (-535.078) (-535.905) (-537.074) -- 0:00:13
785000 -- [-535.433] (-539.200) (-538.791) (-539.320) * [-536.957] (-539.518) (-536.260) (-539.631) -- 0:00:13
Average standard deviation of split frequencies: 0.007309
785500 -- (-535.440) [-534.898] (-535.956) (-535.309) * (-535.703) (-536.491) [-535.702] (-538.009) -- 0:00:13
786000 -- (-537.149) (-535.829) [-535.054] (-536.225) * (-536.457) (-534.356) (-537.829) [-536.635] -- 0:00:13
786500 -- (-535.469) [-535.305] (-537.639) (-536.318) * (-534.362) (-535.521) [-538.177] (-536.500) -- 0:00:13
787000 -- (-535.030) [-534.720] (-535.579) (-535.887) * (-539.125) (-537.954) (-535.607) [-537.716] -- 0:00:12
787500 -- [-536.175] (-534.116) (-535.927) (-537.640) * (-540.014) [-535.302] (-542.082) (-537.837) -- 0:00:12
788000 -- [-536.568] (-536.397) (-538.889) (-536.335) * [-536.426] (-535.390) (-537.447) (-538.272) -- 0:00:12
788500 -- (-536.542) (-536.018) [-536.437] (-536.752) * (-535.596) (-537.932) (-542.834) [-535.005] -- 0:00:12
789000 -- (-540.443) (-536.156) [-537.826] (-540.657) * (-537.526) (-537.405) (-535.908) [-535.177] -- 0:00:12
789500 -- (-535.754) [-534.266] (-537.820) (-534.983) * (-540.102) [-534.941] (-537.341) (-534.764) -- 0:00:12
790000 -- [-535.763] (-538.318) (-534.844) (-537.761) * [-535.900] (-535.806) (-536.263) (-536.225) -- 0:00:12
Average standard deviation of split frequencies: 0.007490
790500 -- (-537.155) (-536.945) (-539.373) [-534.586] * (-534.363) (-535.887) [-536.744] (-536.155) -- 0:00:12
791000 -- [-538.086] (-535.288) (-536.112) (-539.538) * [-536.966] (-537.599) (-536.062) (-534.944) -- 0:00:12
791500 -- (-535.563) [-535.300] (-535.248) (-538.161) * (-534.769) (-536.957) (-538.650) [-535.038] -- 0:00:12
792000 -- (-535.917) (-535.486) [-536.996] (-537.915) * [-536.393] (-535.397) (-536.061) (-538.606) -- 0:00:12
792500 -- (-537.431) [-537.428] (-534.688) (-537.851) * (-536.306) (-534.356) (-537.831) [-535.619] -- 0:00:12
793000 -- (-537.819) [-535.069] (-534.282) (-540.455) * (-535.987) (-535.120) (-534.981) [-539.286] -- 0:00:12
793500 -- (-536.164) (-534.882) [-537.409] (-540.573) * (-538.212) [-536.649] (-535.039) (-537.452) -- 0:00:12
794000 -- (-534.630) (-535.713) (-538.531) [-538.006] * (-536.112) (-538.540) (-535.448) [-537.130] -- 0:00:12
794500 -- (-536.136) (-535.309) [-538.924] (-536.848) * (-536.273) [-535.734] (-535.181) (-537.781) -- 0:00:12
795000 -- (-536.092) (-536.364) [-537.400] (-535.472) * (-535.816) (-534.510) (-535.650) [-535.821] -- 0:00:12
Average standard deviation of split frequencies: 0.007304
795500 -- (-536.387) (-535.651) (-537.781) [-535.302] * (-534.460) [-536.693] (-536.651) (-535.845) -- 0:00:12
796000 -- [-536.986] (-536.069) (-538.789) (-536.154) * [-538.389] (-539.222) (-535.782) (-542.127) -- 0:00:12
796500 -- (-534.795) (-538.514) (-539.707) [-536.102] * [-535.515] (-536.007) (-535.422) (-535.579) -- 0:00:12
797000 -- (-535.198) [-537.771] (-536.200) (-537.333) * [-537.855] (-536.436) (-535.721) (-536.475) -- 0:00:12
797500 -- (-534.982) (-539.560) [-538.167] (-535.375) * (-536.209) [-534.706] (-535.580) (-536.342) -- 0:00:12
798000 -- (-537.327) [-539.476] (-535.925) (-534.556) * (-536.936) (-535.828) (-534.417) [-534.952] -- 0:00:12
798500 -- [-534.969] (-538.393) (-535.147) (-534.282) * (-542.434) [-537.093] (-534.951) (-535.626) -- 0:00:12
799000 -- (-534.848) [-536.042] (-535.017) (-535.060) * (-535.696) (-534.893) (-535.009) [-537.977] -- 0:00:12
799500 -- (-536.347) [-535.993] (-535.459) (-539.435) * (-534.635) [-536.959] (-534.667) (-536.097) -- 0:00:12
800000 -- (-535.234) [-534.545] (-535.322) (-538.568) * (-536.431) (-539.863) [-537.480] (-536.363) -- 0:00:12
Average standard deviation of split frequencies: 0.006947
800500 -- (-537.178) [-536.585] (-536.092) (-538.475) * (-535.738) (-537.870) [-537.903] (-535.472) -- 0:00:12
801000 -- (-538.388) [-535.890] (-536.142) (-538.735) * (-541.391) [-537.438] (-540.195) (-538.674) -- 0:00:12
801500 -- (-539.606) [-534.789] (-536.437) (-536.791) * [-534.743] (-535.341) (-535.142) (-538.359) -- 0:00:12
802000 -- (-536.925) (-537.892) [-534.785] (-539.715) * (-535.257) (-535.779) (-535.171) [-541.004] -- 0:00:12
802500 -- (-536.108) [-534.611] (-535.760) (-537.402) * (-538.291) (-534.913) (-534.139) [-538.236] -- 0:00:12
803000 -- [-535.297] (-536.307) (-534.933) (-536.884) * (-539.390) (-537.139) [-534.944] (-535.396) -- 0:00:12
803500 -- [-535.702] (-539.766) (-534.599) (-536.121) * (-536.455) [-537.910] (-537.246) (-536.636) -- 0:00:11
804000 -- (-535.570) [-534.942] (-535.077) (-535.727) * (-537.458) (-538.962) [-536.842] (-536.739) -- 0:00:11
804500 -- (-534.291) (-537.976) [-535.607] (-535.682) * (-539.621) (-539.246) [-537.096] (-537.014) -- 0:00:11
805000 -- (-534.261) [-539.359] (-536.947) (-535.669) * (-535.952) (-539.165) (-536.256) [-534.758] -- 0:00:12
Average standard deviation of split frequencies: 0.006629
805500 -- (-536.266) (-538.615) (-537.173) [-535.631] * (-535.236) (-536.402) (-537.240) [-534.230] -- 0:00:12
806000 -- [-534.627] (-536.719) (-539.807) (-542.769) * [-534.691] (-536.173) (-538.596) (-537.304) -- 0:00:12
806500 -- (-537.895) (-539.991) [-535.641] (-536.230) * (-537.009) [-535.623] (-537.868) (-535.805) -- 0:00:11
807000 -- (-534.656) (-537.168) [-536.420] (-535.387) * [-539.578] (-535.869) (-539.873) (-542.140) -- 0:00:11
807500 -- [-535.495] (-536.308) (-535.690) (-535.402) * (-534.387) (-536.362) (-538.033) [-539.922] -- 0:00:11
808000 -- (-535.494) (-538.217) [-535.536] (-535.874) * (-535.052) (-535.702) (-536.059) [-537.716] -- 0:00:11
808500 -- (-535.542) [-535.481] (-534.959) (-538.295) * (-535.241) (-536.612) [-535.744] (-537.371) -- 0:00:11
809000 -- (-535.847) (-535.466) [-535.008] (-535.277) * (-536.417) (-538.257) (-535.190) [-537.376] -- 0:00:11
809500 -- (-536.019) (-535.396) (-535.747) [-535.600] * (-535.041) (-537.283) (-535.940) [-538.301] -- 0:00:11
810000 -- (-538.824) [-534.633] (-537.297) (-537.026) * (-535.936) [-534.565] (-536.493) (-535.809) -- 0:00:11
Average standard deviation of split frequencies: 0.006397
810500 -- (-535.559) (-535.219) [-535.526] (-536.660) * [-536.050] (-534.475) (-536.693) (-535.569) -- 0:00:11
811000 -- (-538.179) [-535.304] (-536.552) (-535.170) * [-534.507] (-537.555) (-535.863) (-536.167) -- 0:00:11
811500 -- (-535.194) (-535.747) (-534.835) [-534.610] * (-536.505) [-537.033] (-535.810) (-535.869) -- 0:00:11
812000 -- [-535.301] (-540.772) (-534.370) (-535.009) * (-535.944) (-538.823) [-536.555] (-538.085) -- 0:00:11
812500 -- (-536.852) (-540.171) [-536.789] (-534.795) * (-537.607) (-534.892) (-536.506) [-535.372] -- 0:00:11
813000 -- (-535.134) (-539.529) (-536.573) [-535.296] * (-538.765) [-534.810] (-536.479) (-535.125) -- 0:00:11
813500 -- (-535.657) (-536.416) (-535.892) [-538.717] * (-538.454) (-536.122) [-538.388] (-534.651) -- 0:00:11
814000 -- (-536.787) (-534.434) (-538.835) [-535.118] * [-536.078] (-540.468) (-539.356) (-535.960) -- 0:00:11
814500 -- (-536.145) (-537.724) (-535.362) [-537.301] * (-538.998) [-535.548] (-534.837) (-535.782) -- 0:00:11
815000 -- [-536.203] (-537.157) (-537.864) (-535.806) * (-535.956) (-537.543) [-535.708] (-536.189) -- 0:00:11
Average standard deviation of split frequencies: 0.006047
815500 -- (-537.975) (-540.982) [-536.160] (-537.892) * (-538.379) (-539.580) [-536.809] (-538.851) -- 0:00:11
816000 -- (-534.702) (-534.643) [-536.528] (-537.796) * (-539.315) (-538.203) [-535.362] (-535.217) -- 0:00:11
816500 -- (-535.924) (-537.127) [-535.898] (-536.479) * (-538.367) [-538.250] (-540.067) (-539.290) -- 0:00:11
817000 -- [-535.089] (-539.575) (-535.368) (-535.746) * (-537.781) (-536.168) [-535.395] (-535.695) -- 0:00:11
817500 -- [-535.504] (-539.891) (-535.785) (-536.893) * (-535.430) (-538.133) [-536.729] (-534.761) -- 0:00:11
818000 -- [-538.153] (-536.987) (-537.936) (-534.245) * (-536.080) (-540.388) [-538.441] (-537.884) -- 0:00:11
818500 -- [-538.328] (-534.526) (-534.911) (-536.056) * (-534.635) (-534.712) (-537.661) [-534.724] -- 0:00:11
819000 -- (-538.240) [-535.443] (-536.935) (-534.479) * (-535.249) (-536.138) (-536.142) [-534.499] -- 0:00:11
819500 -- (-538.376) [-536.614] (-538.692) (-541.039) * (-535.211) (-534.667) (-537.138) [-536.725] -- 0:00:11
820000 -- [-537.242] (-537.979) (-537.461) (-537.022) * (-536.445) (-536.125) [-535.193] (-535.119) -- 0:00:11
Average standard deviation of split frequencies: 0.005974
820500 -- (-536.656) (-535.353) [-537.030] (-535.630) * [-535.833] (-540.247) (-537.391) (-534.797) -- 0:00:11
821000 -- [-535.703] (-536.170) (-543.890) (-536.682) * (-535.126) (-535.569) (-537.598) [-534.338] -- 0:00:11
821500 -- [-535.425] (-538.177) (-536.539) (-536.558) * (-534.468) [-538.277] (-535.372) (-536.422) -- 0:00:11
822000 -- [-538.092] (-538.690) (-535.479) (-537.416) * (-538.172) [-536.184] (-536.159) (-535.308) -- 0:00:11
822500 -- (-537.097) (-541.741) [-536.283] (-536.118) * (-538.276) (-541.472) (-537.577) [-538.119] -- 0:00:11
823000 -- [-535.378] (-534.422) (-535.726) (-536.512) * [-536.250] (-536.825) (-538.515) (-534.724) -- 0:00:10
823500 -- (-535.242) [-535.337] (-536.137) (-536.677) * (-534.912) (-536.025) (-534.394) [-534.317] -- 0:00:10
824000 -- (-542.360) (-536.657) (-536.293) [-537.397] * (-539.032) (-540.003) [-534.859] (-536.768) -- 0:00:10
824500 -- (-536.364) (-537.014) [-535.885] (-537.822) * (-539.085) (-539.498) [-535.972] (-536.111) -- 0:00:10
825000 -- (-536.773) [-534.706] (-537.214) (-538.857) * (-537.773) (-538.683) (-536.349) [-539.426] -- 0:00:10
Average standard deviation of split frequencies: 0.005783
825500 -- (-537.057) (-539.552) [-534.800] (-534.736) * (-537.948) (-535.463) [-535.513] (-535.122) -- 0:00:10
826000 -- (-539.696) (-537.997) [-536.529] (-535.357) * (-537.705) (-538.070) (-535.891) [-535.663] -- 0:00:10
826500 -- (-535.720) [-537.058] (-534.638) (-535.159) * [-536.088] (-535.411) (-536.239) (-536.534) -- 0:00:10
827000 -- (-541.891) (-534.966) (-536.016) [-537.216] * (-536.403) (-537.561) (-536.994) [-536.544] -- 0:00:10
827500 -- (-536.095) (-542.088) (-537.433) [-536.369] * (-536.364) (-535.184) (-536.537) [-536.514] -- 0:00:10
828000 -- (-535.725) (-539.642) [-535.900] (-538.406) * (-539.772) [-535.478] (-534.648) (-534.963) -- 0:00:10
828500 -- [-536.234] (-534.964) (-536.805) (-538.486) * [-539.970] (-536.530) (-535.251) (-534.652) -- 0:00:10
829000 -- (-536.573) (-535.632) [-536.516] (-534.649) * [-535.832] (-536.599) (-538.404) (-535.517) -- 0:00:10
829500 -- [-535.575] (-537.442) (-535.429) (-535.686) * (-538.454) [-537.334] (-537.244) (-536.285) -- 0:00:10
830000 -- (-535.932) (-539.646) [-534.301] (-537.336) * (-537.773) (-535.821) [-535.297] (-536.670) -- 0:00:10
Average standard deviation of split frequencies: 0.006129
830500 -- (-536.448) (-534.505) [-535.346] (-535.565) * (-537.725) (-536.232) (-534.934) [-535.839] -- 0:00:10
831000 -- (-535.749) (-535.427) [-537.274] (-536.493) * (-544.686) (-539.659) (-534.650) [-537.365] -- 0:00:10
831500 -- (-542.578) [-535.927] (-537.470) (-537.083) * (-547.539) (-542.985) (-534.684) [-537.596] -- 0:00:10
832000 -- (-539.637) (-535.965) [-537.620] (-537.986) * (-541.598) [-539.737] (-536.114) (-538.192) -- 0:00:10
832500 -- [-538.267] (-537.621) (-538.335) (-535.954) * (-539.381) [-535.496] (-536.920) (-536.680) -- 0:00:10
833000 -- (-541.253) (-535.762) (-538.392) [-534.991] * (-538.300) (-536.072) (-537.421) [-534.709] -- 0:00:10
833500 -- (-537.156) (-536.150) [-534.929] (-534.979) * [-539.265] (-534.623) (-538.338) (-534.735) -- 0:00:10
834000 -- (-536.270) (-535.729) [-535.159] (-534.506) * (-541.928) (-535.060) (-539.181) [-538.051] -- 0:00:10
834500 -- (-537.126) (-535.339) [-535.929] (-537.310) * (-536.643) (-538.907) (-538.861) [-536.004] -- 0:00:10
835000 -- (-538.094) [-535.607] (-536.413) (-536.284) * (-537.798) [-535.514] (-535.735) (-537.509) -- 0:00:10
Average standard deviation of split frequencies: 0.005940
835500 -- (-536.049) [-535.972] (-536.841) (-534.509) * (-536.346) (-537.400) (-539.902) [-535.519] -- 0:00:10
836000 -- (-535.261) (-535.744) [-536.168] (-534.565) * (-536.589) [-536.738] (-536.727) (-536.396) -- 0:00:10
836500 -- (-535.106) [-537.352] (-534.806) (-534.471) * (-535.733) (-539.605) [-536.114] (-537.267) -- 0:00:10
837000 -- (-539.633) (-539.889) [-534.587] (-535.155) * (-537.176) [-536.211] (-535.033) (-537.976) -- 0:00:10
837500 -- (-537.903) [-536.014] (-536.616) (-536.618) * (-536.476) [-538.196] (-534.820) (-540.570) -- 0:00:10
838000 -- [-535.959] (-536.006) (-534.617) (-536.650) * (-537.139) (-541.230) [-536.606] (-537.243) -- 0:00:10
838500 -- [-534.341] (-536.239) (-537.723) (-537.718) * (-538.588) [-537.920] (-537.993) (-538.012) -- 0:00:10
839000 -- (-537.408) (-534.441) (-535.789) [-537.722] * (-538.336) (-534.528) [-538.671] (-537.255) -- 0:00:09
839500 -- [-535.727] (-541.261) (-536.137) (-535.547) * (-539.162) (-537.617) (-540.013) [-537.244] -- 0:00:09
840000 -- (-534.770) (-540.295) (-535.122) [-535.357] * (-537.629) (-535.297) (-536.418) [-535.788] -- 0:00:09
Average standard deviation of split frequencies: 0.005757
840500 -- [-535.070] (-539.274) (-537.459) (-535.866) * (-535.846) [-535.749] (-536.445) (-537.106) -- 0:00:09
841000 -- (-536.202) (-535.655) (-535.172) [-535.889] * [-536.576] (-534.260) (-536.744) (-535.160) -- 0:00:09
841500 -- (-535.615) (-538.493) (-535.478) [-535.380] * [-535.207] (-537.573) (-536.384) (-536.675) -- 0:00:09
842000 -- (-536.959) (-535.022) (-542.097) [-538.574] * (-534.886) (-535.709) (-536.016) [-535.716] -- 0:00:09
842500 -- (-537.704) (-535.645) [-537.745] (-539.427) * (-534.923) [-535.128] (-535.555) (-537.943) -- 0:00:09
843000 -- (-536.990) (-538.983) (-535.549) [-536.571] * [-535.326] (-536.203) (-541.400) (-537.283) -- 0:00:09
843500 -- [-536.352] (-537.392) (-535.995) (-538.341) * (-539.848) (-539.698) (-540.516) [-535.577] -- 0:00:09
844000 -- (-536.903) (-536.507) [-535.772] (-535.270) * (-539.850) (-536.718) (-536.907) [-534.807] -- 0:00:09
844500 -- (-538.443) (-538.107) [-538.786] (-537.359) * (-540.385) [-540.031] (-536.568) (-536.681) -- 0:00:09
845000 -- (-535.506) [-538.241] (-537.161) (-537.023) * (-537.072) (-535.994) [-537.874] (-537.617) -- 0:00:09
Average standard deviation of split frequencies: 0.005609
845500 -- [-536.090] (-535.946) (-542.472) (-535.520) * (-540.850) [-536.353] (-540.320) (-536.815) -- 0:00:09
846000 -- (-536.428) (-535.071) (-538.994) [-537.000] * (-538.785) (-535.654) (-541.640) [-535.622] -- 0:00:09
846500 -- [-535.959] (-535.033) (-535.961) (-539.772) * (-537.750) [-535.196] (-535.840) (-535.128) -- 0:00:09
847000 -- (-536.232) (-536.337) (-538.329) [-537.631] * (-537.417) (-538.199) (-538.319) [-536.878] -- 0:00:09
847500 -- [-534.777] (-535.173) (-535.700) (-535.731) * [-536.972] (-538.497) (-536.434) (-535.172) -- 0:00:09
848000 -- (-534.494) (-535.408) (-536.187) [-535.463] * (-535.277) (-540.675) (-535.228) [-534.766] -- 0:00:09
848500 -- [-534.675] (-536.368) (-535.870) (-535.949) * (-535.833) (-534.740) [-534.752] (-537.406) -- 0:00:09
849000 -- (-537.192) (-534.846) [-535.278] (-534.269) * (-537.623) [-534.908] (-535.151) (-536.833) -- 0:00:09
849500 -- (-538.492) [-534.342] (-535.980) (-534.212) * (-535.831) (-537.763) [-535.133] (-539.205) -- 0:00:09
850000 -- (-536.045) (-534.432) (-538.423) [-535.426] * (-536.344) [-537.719] (-535.877) (-537.808) -- 0:00:09
Average standard deviation of split frequencies: 0.006022
850500 -- (-537.044) (-534.570) [-541.501] (-540.533) * [-536.337] (-539.457) (-536.102) (-537.223) -- 0:00:09
851000 -- (-535.982) [-535.532] (-535.379) (-539.426) * (-537.526) (-537.411) [-535.349] (-542.697) -- 0:00:09
851500 -- (-535.766) (-534.713) [-535.385] (-535.565) * (-535.421) (-537.472) [-538.979] (-536.266) -- 0:00:09
852000 -- (-536.144) [-539.095] (-539.723) (-534.069) * (-537.660) (-535.686) [-538.732] (-537.868) -- 0:00:09
852500 -- (-537.926) [-539.021] (-537.927) (-534.295) * (-536.628) (-534.481) (-536.561) [-534.701] -- 0:00:09
853000 -- (-534.348) (-537.496) [-536.073] (-534.952) * (-539.554) (-534.566) (-536.762) [-535.115] -- 0:00:09
853500 -- (-534.213) (-535.318) (-537.179) [-535.073] * (-537.419) [-535.422] (-538.544) (-534.634) -- 0:00:09
854000 -- (-536.797) (-535.752) (-538.370) [-537.453] * [-538.759] (-535.417) (-536.468) (-534.314) -- 0:00:09
854500 -- [-537.845] (-534.867) (-542.168) (-538.660) * (-538.337) (-536.146) (-535.093) [-534.545] -- 0:00:09
855000 -- (-537.380) (-536.414) (-536.288) [-539.948] * (-538.176) [-536.515] (-536.166) (-535.588) -- 0:00:08
Average standard deviation of split frequencies: 0.005727
855500 -- [-534.647] (-534.793) (-534.820) (-535.746) * [-537.347] (-536.795) (-538.337) (-537.059) -- 0:00:08
856000 -- (-534.789) (-537.486) (-538.366) [-535.155] * (-535.505) [-536.711] (-537.306) (-536.339) -- 0:00:08
856500 -- (-542.051) [-536.950] (-537.415) (-535.852) * (-536.134) (-542.047) [-536.638] (-536.795) -- 0:00:08
857000 -- (-537.524) (-538.076) (-535.626) [-538.580] * [-535.186] (-538.345) (-536.779) (-535.295) -- 0:00:08
857500 -- (-535.088) (-537.734) (-536.155) [-537.380] * (-537.914) (-536.531) [-537.365] (-535.287) -- 0:00:08
858000 -- (-534.981) (-539.396) [-535.647] (-537.318) * [-536.047] (-537.589) (-538.384) (-536.315) -- 0:00:08
858500 -- (-536.640) (-538.070) [-534.316] (-540.281) * (-535.208) (-537.193) (-536.408) [-536.110] -- 0:00:08
859000 -- (-534.743) [-535.607] (-536.705) (-537.436) * (-536.967) (-537.008) [-542.265] (-537.351) -- 0:00:08
859500 -- (-537.217) (-536.084) [-534.568] (-538.517) * [-536.643] (-536.754) (-535.541) (-539.356) -- 0:00:08
860000 -- (-534.824) (-536.667) [-535.216] (-537.377) * [-534.705] (-537.411) (-541.632) (-542.623) -- 0:00:08
Average standard deviation of split frequencies: 0.005769
860500 -- (-534.586) (-537.029) (-536.717) [-537.622] * (-537.287) [-534.919] (-536.236) (-534.781) -- 0:00:08
861000 -- (-536.982) [-538.475] (-540.969) (-535.625) * (-540.879) (-535.070) [-536.008] (-534.688) -- 0:00:08
861500 -- (-535.719) [-534.779] (-539.248) (-538.534) * (-537.669) (-536.903) (-542.108) [-534.843] -- 0:00:08
862000 -- (-536.112) [-534.186] (-537.951) (-536.962) * (-535.390) (-537.102) (-535.882) [-534.528] -- 0:00:08
862500 -- (-535.413) (-537.370) [-538.369] (-538.000) * (-535.105) (-535.702) (-536.175) [-534.185] -- 0:00:08
863000 -- (-540.592) (-535.541) [-536.998] (-538.153) * (-535.705) (-535.878) [-537.721] (-535.225) -- 0:00:08
863500 -- (-535.082) [-539.371] (-537.281) (-535.218) * (-534.647) [-538.485] (-536.682) (-537.100) -- 0:00:08
864000 -- [-541.877] (-536.480) (-536.049) (-537.556) * (-537.560) (-537.017) (-536.872) [-537.149] -- 0:00:08
864500 -- (-539.276) [-535.169] (-536.897) (-539.412) * (-538.403) (-535.702) [-538.232] (-537.053) -- 0:00:08
865000 -- (-539.726) (-534.855) (-535.254) [-536.752] * (-535.240) [-534.503] (-536.463) (-540.786) -- 0:00:08
Average standard deviation of split frequencies: 0.005552
865500 -- (-540.722) (-535.019) [-540.260] (-543.551) * (-537.281) [-536.508] (-535.320) (-540.327) -- 0:00:08
866000 -- (-539.330) (-538.647) (-537.378) [-539.420] * (-537.458) (-536.953) (-535.343) [-535.248] -- 0:00:08
866500 -- (-534.350) [-534.650] (-537.202) (-536.626) * (-534.993) [-537.245] (-535.174) (-535.475) -- 0:00:08
867000 -- [-536.036] (-538.848) (-537.588) (-536.120) * (-534.410) (-536.318) (-536.011) [-536.061] -- 0:00:08
867500 -- [-537.432] (-537.276) (-534.915) (-534.921) * (-534.745) (-537.223) [-537.046] (-538.012) -- 0:00:08
868000 -- (-540.133) (-535.963) (-538.031) [-535.889] * (-535.290) [-536.052] (-537.862) (-536.687) -- 0:00:08
868500 -- [-535.405] (-536.399) (-537.500) (-537.605) * (-534.748) (-537.377) (-538.862) [-536.440] -- 0:00:08
869000 -- [-535.254] (-540.490) (-538.173) (-534.866) * (-536.867) [-535.269] (-535.918) (-535.377) -- 0:00:08
869500 -- (-534.455) (-536.933) [-538.992] (-537.503) * (-536.544) (-536.793) (-536.243) [-535.274] -- 0:00:08
870000 -- [-536.174] (-535.532) (-536.106) (-534.803) * [-535.632] (-534.164) (-534.720) (-538.957) -- 0:00:08
Average standard deviation of split frequencies: 0.005523
870500 -- (-538.191) (-535.740) (-536.357) [-535.119] * (-537.830) [-535.072] (-542.064) (-538.095) -- 0:00:08
871000 -- (-535.064) [-536.450] (-536.980) (-534.578) * [-539.202] (-535.451) (-539.566) (-535.611) -- 0:00:07
871500 -- [-535.115] (-540.425) (-544.789) (-535.022) * (-539.064) (-541.477) (-535.838) [-536.220] -- 0:00:07
872000 -- (-535.882) [-539.388] (-536.699) (-537.943) * (-536.197) (-542.253) [-536.521] (-535.009) -- 0:00:07
872500 -- (-537.091) (-541.703) (-537.207) [-536.238] * [-535.535] (-537.357) (-538.607) (-535.839) -- 0:00:07
873000 -- (-537.695) [-535.801] (-534.484) (-535.003) * (-536.437) (-540.070) [-537.717] (-536.992) -- 0:00:07
873500 -- [-536.304] (-538.298) (-535.845) (-538.217) * [-534.576] (-537.628) (-535.820) (-535.813) -- 0:00:07
874000 -- (-535.738) (-545.711) [-540.117] (-536.148) * (-535.292) (-537.107) (-536.607) [-535.588] -- 0:00:07
874500 -- (-534.239) (-538.710) (-538.784) [-535.212] * (-534.489) (-542.191) (-536.492) [-536.619] -- 0:00:07
875000 -- [-536.344] (-538.161) (-535.286) (-539.206) * [-535.479] (-536.080) (-535.307) (-535.034) -- 0:00:07
Average standard deviation of split frequencies: 0.005417
875500 -- (-538.897) (-535.149) (-535.919) [-535.014] * (-538.079) [-535.708] (-536.238) (-534.834) -- 0:00:07
876000 -- (-541.220) [-536.270] (-535.200) (-538.494) * [-535.173] (-537.050) (-537.577) (-534.717) -- 0:00:07
876500 -- (-541.249) (-536.722) (-538.159) [-536.129] * (-536.860) [-534.744] (-537.776) (-538.932) -- 0:00:07
877000 -- (-537.146) (-536.100) [-538.649] (-536.720) * (-534.947) [-534.979] (-535.624) (-537.743) -- 0:00:07
877500 -- (-537.867) (-536.827) (-534.742) [-535.361] * [-536.263] (-536.386) (-536.880) (-539.065) -- 0:00:07
878000 -- (-536.639) (-534.737) (-535.782) [-538.775] * (-534.933) [-536.016] (-538.101) (-537.603) -- 0:00:07
878500 -- [-540.348] (-535.058) (-536.306) (-537.813) * (-535.599) [-536.738] (-538.073) (-535.841) -- 0:00:07
879000 -- (-537.789) (-539.309) [-535.846] (-534.780) * (-534.461) (-535.643) [-534.483] (-536.594) -- 0:00:07
879500 -- [-539.875] (-539.458) (-535.736) (-534.581) * (-535.296) (-537.055) (-536.802) [-538.545] -- 0:00:07
880000 -- (-538.540) (-538.142) (-538.089) [-537.467] * (-535.738) (-540.846) (-536.575) [-538.088] -- 0:00:07
Average standard deviation of split frequencies: 0.005745
880500 -- (-535.722) (-535.862) (-535.972) [-535.902] * [-536.570] (-535.165) (-537.385) (-535.187) -- 0:00:07
881000 -- (-537.408) (-535.293) (-536.603) [-535.614] * (-537.009) (-535.577) (-539.311) [-537.439] -- 0:00:07
881500 -- (-536.313) [-535.447] (-536.650) (-542.974) * [-536.359] (-539.416) (-537.043) (-538.760) -- 0:00:07
882000 -- (-534.403) [-538.461] (-538.822) (-536.647) * [-536.213] (-537.724) (-540.970) (-540.276) -- 0:00:07
882500 -- [-535.147] (-546.829) (-537.080) (-535.467) * (-537.147) [-535.338] (-539.475) (-535.432) -- 0:00:07
883000 -- (-537.841) (-543.217) (-537.712) [-536.103] * (-539.544) (-535.295) [-536.327] (-538.349) -- 0:00:07
883500 -- [-534.759] (-537.316) (-537.282) (-536.137) * [-535.400] (-538.631) (-535.871) (-539.024) -- 0:00:07
884000 -- [-534.059] (-540.889) (-535.985) (-535.806) * (-538.266) [-535.056] (-534.677) (-538.089) -- 0:00:07
884500 -- [-536.724] (-535.731) (-534.960) (-534.318) * (-538.219) (-535.705) [-534.465] (-539.860) -- 0:00:07
885000 -- (-534.780) (-536.447) [-536.750] (-536.776) * [-534.927] (-535.280) (-536.212) (-536.908) -- 0:00:07
Average standard deviation of split frequencies: 0.005959
885500 -- [-537.364] (-540.460) (-540.433) (-534.434) * (-536.292) (-536.310) (-538.329) [-535.832] -- 0:00:07
886000 -- [-540.058] (-540.368) (-538.515) (-534.434) * (-535.907) (-537.524) [-536.737] (-536.432) -- 0:00:07
886500 -- (-535.624) (-540.681) (-534.377) [-534.234] * [-534.841] (-535.366) (-538.606) (-535.309) -- 0:00:07
887000 -- (-536.585) (-542.619) (-536.364) [-534.224] * (-536.452) (-534.934) [-535.577] (-537.184) -- 0:00:07
887500 -- (-537.741) (-534.801) (-535.498) [-535.020] * [-537.806] (-536.002) (-535.412) (-538.120) -- 0:00:06
888000 -- (-537.299) (-534.769) [-534.692] (-538.489) * (-535.623) (-535.267) [-534.955] (-537.378) -- 0:00:06
888500 -- [-535.161] (-535.643) (-537.917) (-535.493) * (-536.527) (-534.736) [-537.191] (-536.036) -- 0:00:06
889000 -- (-536.920) (-534.788) (-538.533) [-535.443] * (-539.139) (-535.202) [-534.733] (-535.352) -- 0:00:06
889500 -- (-536.460) (-537.597) (-537.025) [-536.046] * (-537.655) (-535.370) (-538.229) [-535.773] -- 0:00:06
890000 -- (-538.771) (-538.494) (-535.662) [-536.035] * (-535.905) (-535.327) (-541.199) [-534.772] -- 0:00:06
Average standard deviation of split frequencies: 0.006034
890500 -- (-538.390) [-536.425] (-535.489) (-535.865) * (-536.033) (-536.909) (-538.492) [-535.627] -- 0:00:06
891000 -- (-537.594) (-537.674) (-537.356) [-535.313] * (-536.862) (-535.287) (-539.138) [-535.897] -- 0:00:06
891500 -- [-534.890] (-536.882) (-537.429) (-536.042) * (-536.847) [-537.623] (-537.152) (-535.808) -- 0:00:06
892000 -- (-539.028) (-538.062) [-535.367] (-537.673) * [-534.407] (-538.008) (-536.466) (-535.062) -- 0:00:06
892500 -- [-535.354] (-536.770) (-536.750) (-538.124) * (-535.983) (-536.996) (-534.938) [-536.072] -- 0:00:06
893000 -- (-535.692) (-535.357) [-535.333] (-538.422) * (-535.663) [-535.332] (-534.754) (-536.623) -- 0:00:06
893500 -- (-538.103) (-538.103) [-536.868] (-537.090) * [-535.416] (-537.910) (-534.240) (-538.871) -- 0:00:06
894000 -- (-534.851) (-537.107) [-536.616] (-537.246) * [-536.639] (-543.966) (-538.826) (-538.102) -- 0:00:06
894500 -- (-534.867) (-537.664) [-537.504] (-535.238) * (-542.752) [-537.771] (-534.713) (-537.141) -- 0:00:06
895000 -- (-540.914) [-538.915] (-535.316) (-536.312) * [-538.288] (-537.569) (-534.892) (-536.225) -- 0:00:06
Average standard deviation of split frequencies: 0.005752
895500 -- (-542.044) (-535.891) (-536.494) [-536.865] * (-536.483) (-537.017) [-537.248] (-535.291) -- 0:00:06
896000 -- (-534.460) (-535.375) [-535.114] (-537.214) * (-539.529) [-535.911] (-535.614) (-536.574) -- 0:00:06
896500 -- (-535.139) (-535.964) (-539.136) [-538.957] * [-539.413] (-536.149) (-536.502) (-534.224) -- 0:00:06
897000 -- (-534.577) [-539.031] (-535.915) (-535.798) * (-535.686) (-535.862) [-535.841] (-536.765) -- 0:00:06
897500 -- (-539.188) [-539.641] (-535.723) (-534.754) * (-536.728) (-536.160) [-535.901] (-537.596) -- 0:00:06
898000 -- (-538.298) (-534.449) [-535.949] (-534.205) * (-537.327) (-535.394) (-535.419) [-534.836] -- 0:00:06
898500 -- (-543.807) (-534.496) (-534.505) [-534.413] * (-538.476) (-534.914) [-535.726] (-535.076) -- 0:00:06
899000 -- (-535.855) (-535.259) [-534.974] (-535.288) * (-534.682) [-537.031] (-534.911) (-535.835) -- 0:00:06
899500 -- (-537.667) (-536.858) (-535.808) [-536.115] * [-534.856] (-539.198) (-535.926) (-535.840) -- 0:00:06
900000 -- (-537.878) (-536.391) [-535.569] (-534.748) * (-535.739) (-535.441) [-535.079] (-535.757) -- 0:00:06
Average standard deviation of split frequencies: 0.006525
900500 -- [-536.359] (-536.097) (-543.220) (-536.374) * (-535.753) [-535.534] (-536.941) (-537.104) -- 0:00:06
901000 -- (-536.625) (-535.258) (-537.557) [-536.229] * [-535.419] (-538.910) (-535.250) (-541.477) -- 0:00:06
901500 -- (-534.757) (-534.942) (-537.890) [-538.188] * (-540.314) [-538.469] (-540.347) (-537.211) -- 0:00:06
902000 -- (-537.819) [-535.070] (-536.507) (-536.158) * (-538.299) (-538.518) [-536.105] (-538.196) -- 0:00:06
902500 -- (-536.443) (-542.360) [-535.675] (-535.922) * (-538.520) [-535.823] (-535.609) (-535.633) -- 0:00:06
903000 -- (-537.165) (-537.131) [-535.279] (-536.021) * (-537.849) [-534.455] (-536.345) (-539.959) -- 0:00:06
903500 -- (-539.761) (-535.419) [-535.583] (-535.165) * (-535.841) [-535.511] (-535.253) (-541.955) -- 0:00:05
904000 -- (-541.797) (-536.343) [-535.299] (-536.754) * (-536.915) (-536.545) [-534.569] (-536.551) -- 0:00:05
904500 -- (-535.359) [-538.143] (-534.543) (-535.382) * (-535.068) (-536.923) [-535.342] (-535.380) -- 0:00:05
905000 -- [-535.618] (-538.446) (-534.584) (-538.959) * (-534.455) (-537.583) [-535.254] (-539.289) -- 0:00:05
Average standard deviation of split frequencies: 0.006417
905500 -- (-537.727) [-534.356] (-535.112) (-537.930) * (-539.389) (-537.849) (-534.694) [-537.102] -- 0:00:05
906000 -- [-535.485] (-534.959) (-538.333) (-536.258) * (-535.732) (-536.235) (-535.558) [-535.129] -- 0:00:05
906500 -- (-536.024) (-535.312) (-535.792) [-538.768] * (-536.522) (-535.569) [-535.975] (-535.566) -- 0:00:05
907000 -- [-537.287] (-537.673) (-535.694) (-536.057) * [-536.280] (-536.573) (-535.072) (-536.131) -- 0:00:05
907500 -- (-537.123) [-537.861] (-535.550) (-536.911) * (-535.631) (-536.151) (-536.586) [-535.559] -- 0:00:05
908000 -- (-536.739) (-536.590) (-534.528) [-534.849] * (-534.754) (-536.197) (-537.817) [-534.945] -- 0:00:05
908500 -- (-534.865) (-537.005) [-536.657] (-537.219) * (-535.728) (-537.023) [-534.788] (-536.638) -- 0:00:05
909000 -- [-535.689] (-535.434) (-534.669) (-535.886) * (-535.723) (-537.902) [-539.603] (-538.185) -- 0:00:05
909500 -- [-537.378] (-538.223) (-539.679) (-536.522) * [-535.490] (-536.078) (-539.938) (-539.009) -- 0:00:05
910000 -- (-536.263) [-535.990] (-535.691) (-537.110) * (-537.480) [-540.916] (-539.223) (-536.328) -- 0:00:05
Average standard deviation of split frequencies: 0.006453
910500 -- (-539.599) (-535.460) (-539.669) [-536.876] * (-534.802) [-538.131] (-538.695) (-540.215) -- 0:00:05
911000 -- (-537.350) (-538.344) (-536.083) [-535.287] * (-536.311) (-537.664) [-539.322] (-536.370) -- 0:00:05
911500 -- (-535.975) [-536.002] (-536.507) (-537.886) * (-537.299) (-538.781) (-538.813) [-536.031] -- 0:00:05
912000 -- [-535.114] (-537.472) (-537.783) (-535.270) * [-536.426] (-535.874) (-536.667) (-537.022) -- 0:00:05
912500 -- [-534.730] (-535.747) (-535.916) (-534.539) * (-536.583) (-535.495) [-535.437] (-536.744) -- 0:00:05
913000 -- (-534.475) (-536.426) (-535.760) [-534.183] * [-535.539] (-538.567) (-535.184) (-536.758) -- 0:00:05
913500 -- (-538.329) [-534.765] (-535.765) (-538.048) * (-536.233) (-539.139) [-534.331] (-538.221) -- 0:00:05
914000 -- (-536.856) [-535.949] (-534.641) (-535.132) * (-535.923) (-541.052) (-535.730) [-535.876] -- 0:00:05
914500 -- [-536.557] (-536.720) (-537.484) (-534.444) * [-535.010] (-539.462) (-535.822) (-535.041) -- 0:00:05
915000 -- (-540.361) (-537.243) [-536.193] (-535.010) * (-539.702) (-539.929) (-536.895) [-535.634] -- 0:00:05
Average standard deviation of split frequencies: 0.006416
915500 -- (-535.799) (-536.966) (-538.860) [-535.010] * (-536.848) (-542.747) (-538.720) [-537.261] -- 0:00:05
916000 -- [-536.007] (-537.584) (-539.691) (-535.379) * (-534.656) [-534.672] (-534.944) (-541.606) -- 0:00:05
916500 -- (-539.966) (-534.769) [-534.938] (-535.841) * (-537.528) (-535.326) (-536.897) [-537.731] -- 0:00:05
917000 -- (-538.550) (-536.771) (-537.069) [-535.643] * (-537.731) [-537.262] (-535.488) (-537.604) -- 0:00:05
917500 -- [-539.499] (-538.282) (-538.552) (-536.711) * [-534.537] (-538.032) (-537.160) (-537.405) -- 0:00:05
918000 -- (-537.657) (-538.986) (-536.274) [-535.445] * [-535.396] (-534.709) (-536.429) (-540.128) -- 0:00:05
918500 -- (-535.245) (-535.412) [-535.582] (-535.141) * (-535.952) [-540.572] (-540.372) (-541.049) -- 0:00:05
919000 -- [-535.235] (-536.668) (-534.823) (-535.136) * (-540.261) (-535.972) (-535.851) [-539.228] -- 0:00:05
919500 -- (-535.152) (-536.019) [-535.525] (-534.632) * (-537.961) (-536.294) (-536.256) [-541.726] -- 0:00:04
920000 -- (-537.738) [-534.814] (-535.391) (-536.233) * (-539.753) [-534.347] (-536.740) (-537.367) -- 0:00:04
Average standard deviation of split frequencies: 0.006520
920500 -- (-537.726) (-535.317) (-537.462) [-536.938] * (-535.229) (-540.501) [-539.224] (-541.408) -- 0:00:04
921000 -- (-535.646) (-538.594) [-536.002] (-534.370) * (-534.185) (-537.702) (-538.359) [-538.121] -- 0:00:04
921500 -- (-538.296) (-535.433) [-535.299] (-534.766) * (-534.407) (-536.302) (-534.988) [-537.154] -- 0:00:04
922000 -- (-537.516) (-534.940) [-534.706] (-535.664) * [-540.686] (-537.858) (-535.770) (-539.849) -- 0:00:04
922500 -- (-536.081) [-536.155] (-537.653) (-535.988) * [-535.409] (-534.945) (-534.541) (-542.140) -- 0:00:04
923000 -- (-535.452) (-536.568) [-537.165] (-538.064) * (-535.026) (-535.857) (-535.153) [-534.757] -- 0:00:04
923500 -- (-538.571) (-536.416) (-536.136) [-538.009] * (-535.415) [-543.250] (-535.226) (-535.199) -- 0:00:04
924000 -- (-535.480) [-536.467] (-535.835) (-538.486) * (-538.829) [-539.335] (-538.867) (-541.304) -- 0:00:04
924500 -- (-537.365) [-536.479] (-536.566) (-539.279) * (-542.850) (-537.676) [-535.278] (-539.975) -- 0:00:04
925000 -- (-535.961) [-537.428] (-536.002) (-538.767) * (-541.808) [-536.196] (-534.317) (-541.303) -- 0:00:04
Average standard deviation of split frequencies: 0.006618
925500 -- [-535.873] (-536.310) (-539.418) (-536.346) * (-534.782) [-534.717] (-534.280) (-534.639) -- 0:00:04
926000 -- (-534.744) [-536.823] (-538.670) (-539.359) * (-536.220) [-537.527] (-540.257) (-537.705) -- 0:00:04
926500 -- (-535.911) (-535.343) [-536.150] (-536.827) * [-537.386] (-535.808) (-537.924) (-534.802) -- 0:00:04
927000 -- [-535.180] (-535.646) (-535.169) (-535.928) * [-535.838] (-534.982) (-535.328) (-535.417) -- 0:00:04
927500 -- (-535.523) (-535.612) (-535.839) [-535.089] * (-535.530) (-537.883) [-536.419] (-538.506) -- 0:00:04
928000 -- [-535.978] (-535.485) (-536.373) (-535.888) * (-539.941) [-537.028] (-537.297) (-539.436) -- 0:00:04
928500 -- (-534.953) [-535.191] (-537.399) (-536.026) * [-537.315] (-535.160) (-536.185) (-536.912) -- 0:00:04
929000 -- (-538.357) (-535.995) (-538.328) [-540.000] * (-535.345) [-537.873] (-535.612) (-538.130) -- 0:00:04
929500 -- (-537.616) [-537.018] (-535.333) (-539.672) * (-542.002) [-536.722] (-534.907) (-536.870) -- 0:00:04
930000 -- (-536.672) (-535.924) (-537.614) [-536.200] * (-535.862) [-537.873] (-539.419) (-536.909) -- 0:00:04
Average standard deviation of split frequencies: 0.006754
930500 -- [-537.781] (-536.140) (-538.940) (-536.263) * (-538.427) (-538.742) [-538.031] (-537.905) -- 0:00:04
931000 -- [-536.461] (-535.510) (-537.070) (-536.159) * (-535.407) (-534.490) (-535.582) [-537.202] -- 0:00:04
931500 -- (-536.211) [-535.684] (-535.592) (-537.145) * (-534.830) (-534.971) [-535.575] (-537.389) -- 0:00:04
932000 -- (-535.786) (-535.982) [-535.336] (-534.545) * [-536.547] (-537.803) (-535.185) (-536.596) -- 0:00:04
932500 -- [-534.868] (-536.545) (-535.101) (-535.503) * (-540.059) (-539.130) (-536.882) [-535.662] -- 0:00:04
933000 -- (-535.406) [-536.998] (-540.730) (-534.687) * [-535.277] (-540.212) (-540.163) (-534.701) -- 0:00:04
933500 -- (-536.103) (-537.555) (-537.564) [-534.132] * (-537.100) [-537.095] (-535.243) (-535.536) -- 0:00:04
934000 -- [-536.579] (-535.825) (-539.873) (-534.310) * (-536.047) (-535.845) [-535.676] (-537.068) -- 0:00:04
934500 -- [-537.250] (-537.605) (-541.990) (-535.135) * [-537.352] (-534.802) (-537.123) (-535.806) -- 0:00:04
935000 -- (-536.891) [-535.772] (-537.641) (-537.790) * (-538.473) (-537.315) [-535.910] (-536.999) -- 0:00:04
Average standard deviation of split frequencies: 0.006614
935500 -- [-536.176] (-539.493) (-537.795) (-537.133) * (-536.586) (-536.103) (-534.339) [-534.809] -- 0:00:03
936000 -- [-535.030] (-537.075) (-537.306) (-534.563) * (-535.658) [-534.989] (-536.736) (-535.720) -- 0:00:03
936500 -- [-536.313] (-535.564) (-538.139) (-538.581) * [-535.060] (-539.120) (-537.921) (-535.327) -- 0:00:03
937000 -- [-539.063] (-534.222) (-535.837) (-535.561) * (-536.183) (-537.297) (-535.481) [-535.689] -- 0:00:03
937500 -- [-535.957] (-534.463) (-536.292) (-535.132) * (-535.893) (-534.711) (-536.002) [-536.900] -- 0:00:03
938000 -- (-535.765) (-535.922) [-535.991] (-535.364) * (-534.821) [-535.300] (-537.858) (-539.846) -- 0:00:03
938500 -- (-537.386) (-538.634) [-536.599] (-535.061) * (-535.158) (-537.518) (-538.046) [-534.919] -- 0:00:03
939000 -- (-537.144) [-536.230] (-536.463) (-534.510) * [-538.453] (-541.189) (-535.141) (-534.876) -- 0:00:03
939500 -- [-538.327] (-537.622) (-537.875) (-535.753) * [-537.893] (-535.108) (-535.200) (-534.672) -- 0:00:03
940000 -- (-543.538) (-539.248) [-539.597] (-534.928) * [-535.292] (-536.201) (-535.165) (-536.617) -- 0:00:03
Average standard deviation of split frequencies: 0.006715
940500 -- (-538.454) (-537.809) (-535.272) [-536.454] * (-542.823) [-535.085] (-535.626) (-536.366) -- 0:00:03
941000 -- [-537.948] (-540.486) (-535.585) (-536.510) * (-538.825) (-535.116) (-537.101) [-534.170] -- 0:00:03
941500 -- [-540.920] (-536.583) (-535.850) (-536.513) * (-534.494) [-537.075] (-535.943) (-534.527) -- 0:00:03
942000 -- (-539.490) (-535.110) [-534.791] (-538.227) * [-536.219] (-541.661) (-537.365) (-535.508) -- 0:00:03
942500 -- (-535.378) (-534.824) [-536.002] (-540.126) * (-537.072) (-537.833) [-535.342] (-535.549) -- 0:00:03
943000 -- (-538.923) (-535.594) [-534.694] (-538.971) * (-537.346) (-537.224) (-535.118) [-537.640] -- 0:00:03
943500 -- (-541.721) [-534.599] (-535.365) (-535.099) * [-537.600] (-534.792) (-538.208) (-538.975) -- 0:00:03
944000 -- [-536.539] (-538.691) (-535.480) (-536.559) * (-536.547) (-542.700) (-535.645) [-535.869] -- 0:00:03
944500 -- (-536.021) [-536.382] (-535.153) (-535.391) * [-535.628] (-538.537) (-535.258) (-536.265) -- 0:00:03
945000 -- [-534.514] (-535.010) (-537.398) (-535.667) * (-536.425) (-539.489) (-535.241) [-535.354] -- 0:00:03
Average standard deviation of split frequencies: 0.006945
945500 -- [-536.215] (-536.840) (-535.362) (-536.543) * (-537.957) [-535.498] (-535.235) (-538.901) -- 0:00:03
946000 -- (-535.416) [-538.999] (-537.579) (-537.176) * (-537.397) [-535.175] (-535.872) (-537.238) -- 0:00:03
946500 -- (-537.235) (-536.582) [-537.223] (-538.691) * (-535.657) [-536.991] (-539.559) (-538.457) -- 0:00:03
947000 -- (-536.234) [-535.661] (-534.563) (-534.317) * (-535.933) (-537.112) [-537.549] (-535.651) -- 0:00:03
947500 -- [-536.680] (-535.421) (-534.476) (-537.752) * (-538.032) (-536.130) [-537.526] (-534.712) -- 0:00:03
948000 -- [-537.737] (-536.529) (-534.603) (-535.077) * (-534.575) (-539.790) (-537.380) [-535.063] -- 0:00:03
948500 -- (-536.865) [-536.886] (-537.528) (-534.654) * (-534.593) (-536.197) [-537.326] (-542.645) -- 0:00:03
949000 -- (-534.754) [-535.316] (-535.836) (-537.058) * (-534.718) [-535.434] (-537.436) (-541.021) -- 0:00:03
949500 -- [-535.150] (-535.831) (-535.480) (-536.172) * (-538.569) (-535.483) (-541.298) [-540.762] -- 0:00:03
950000 -- (-538.086) [-536.881] (-537.661) (-539.260) * [-537.780] (-536.167) (-541.833) (-543.265) -- 0:00:03
Average standard deviation of split frequencies: 0.006942
950500 -- (-539.188) (-537.219) (-536.930) [-535.860] * (-534.706) (-535.296) [-537.535] (-537.590) -- 0:00:03
951000 -- (-540.617) (-535.743) (-537.590) [-535.002] * (-536.003) (-540.231) [-538.362] (-536.438) -- 0:00:03
951500 -- (-534.782) (-539.965) (-537.643) [-535.811] * [-534.945] (-538.522) (-538.789) (-535.095) -- 0:00:03
952000 -- (-534.903) [-534.946] (-535.830) (-536.697) * [-539.882] (-544.038) (-537.326) (-541.424) -- 0:00:02
952500 -- [-535.570] (-537.393) (-536.544) (-538.620) * [-535.802] (-539.517) (-537.153) (-540.660) -- 0:00:02
953000 -- [-535.253] (-534.893) (-536.684) (-541.941) * (-543.084) [-534.789] (-536.170) (-537.209) -- 0:00:02
953500 -- (-536.153) [-534.334] (-537.194) (-538.338) * (-538.916) (-536.026) [-537.179] (-537.533) -- 0:00:02
954000 -- (-538.554) (-535.614) [-538.712] (-536.216) * [-539.578] (-535.756) (-541.160) (-536.020) -- 0:00:02
954500 -- (-539.249) (-537.561) [-538.670] (-536.428) * (-534.054) (-538.802) [-541.042] (-538.761) -- 0:00:02
955000 -- [-539.091] (-535.764) (-535.914) (-538.361) * (-534.714) [-535.847] (-537.507) (-536.413) -- 0:00:02
Average standard deviation of split frequencies: 0.006934
955500 -- (-537.853) (-537.469) [-536.215] (-537.480) * [-534.602] (-539.247) (-539.154) (-534.795) -- 0:00:02
956000 -- (-540.582) [-535.297] (-534.865) (-535.002) * [-535.470] (-536.451) (-537.862) (-535.550) -- 0:00:02
956500 -- (-538.598) (-535.901) [-535.831] (-535.040) * (-535.143) (-536.836) (-537.187) [-534.378] -- 0:00:02
957000 -- (-534.572) (-536.961) (-534.658) [-539.021] * (-535.144) (-534.538) [-535.768] (-536.741) -- 0:00:02
957500 -- (-534.732) (-535.516) [-534.495] (-539.082) * (-535.972) (-535.952) (-536.219) [-534.066] -- 0:00:02
958000 -- (-535.781) [-535.714] (-534.400) (-543.098) * (-536.806) (-537.922) [-536.881] (-534.551) -- 0:00:02
958500 -- (-537.415) (-535.101) [-535.926] (-539.254) * [-536.902] (-539.542) (-534.949) (-534.798) -- 0:00:02
959000 -- (-535.063) (-535.233) [-536.177] (-538.500) * (-536.354) (-535.756) (-537.231) [-539.891] -- 0:00:02
959500 -- (-537.654) [-537.817] (-539.588) (-541.569) * (-541.810) [-537.037] (-540.407) (-539.227) -- 0:00:02
960000 -- (-535.543) (-538.986) [-539.210] (-539.526) * (-536.985) [-541.625] (-538.669) (-537.654) -- 0:00:02
Average standard deviation of split frequencies: 0.007262
960500 -- (-536.498) (-536.682) (-534.726) [-538.898] * (-536.126) [-537.131] (-537.154) (-537.441) -- 0:00:02
961000 -- [-536.619] (-537.351) (-535.570) (-537.758) * (-542.489) (-538.288) [-534.997] (-535.558) -- 0:00:02
961500 -- (-534.710) (-535.051) (-535.924) [-536.105] * (-535.901) (-540.758) (-535.578) [-535.745] -- 0:00:02
962000 -- (-536.236) (-538.228) [-536.347] (-538.551) * [-535.435] (-535.754) (-535.582) (-535.124) -- 0:00:02
962500 -- (-536.060) [-538.341] (-546.218) (-535.515) * [-535.061] (-535.087) (-539.745) (-537.191) -- 0:00:02
963000 -- (-539.820) (-536.591) [-537.817] (-539.771) * [-536.182] (-535.631) (-538.320) (-534.444) -- 0:00:02
963500 -- (-534.880) [-537.228] (-535.439) (-537.549) * (-538.383) (-541.270) (-536.803) [-536.270] -- 0:00:02
964000 -- [-535.273] (-535.880) (-534.608) (-536.197) * [-535.791] (-539.417) (-539.045) (-538.185) -- 0:00:02
964500 -- (-536.102) (-535.824) [-537.489] (-536.519) * [-535.969] (-536.702) (-535.979) (-543.417) -- 0:00:02
965000 -- (-542.032) [-537.000] (-537.807) (-538.835) * [-536.048] (-535.430) (-536.445) (-537.074) -- 0:00:02
Average standard deviation of split frequencies: 0.007157
965500 -- (-535.864) (-535.701) (-535.116) [-537.150] * (-539.512) (-540.016) (-537.496) [-534.730] -- 0:00:02
966000 -- [-534.963] (-535.846) (-536.922) (-537.075) * (-537.419) (-537.795) [-539.491] (-536.906) -- 0:00:02
966500 -- [-536.731] (-534.857) (-536.658) (-535.920) * (-539.805) (-535.312) (-537.149) [-536.755] -- 0:00:02
967000 -- (-534.791) [-535.982] (-535.932) (-536.046) * [-537.938] (-539.714) (-536.972) (-535.514) -- 0:00:02
967500 -- [-535.483] (-539.352) (-536.616) (-534.606) * (-536.761) [-536.838] (-537.835) (-537.316) -- 0:00:02
968000 -- (-536.416) [-535.260] (-536.633) (-534.239) * (-535.058) [-535.172] (-537.419) (-538.045) -- 0:00:02
968500 -- (-537.198) (-534.948) (-538.085) [-536.465] * [-535.509] (-534.822) (-538.289) (-536.281) -- 0:00:01
969000 -- (-536.278) (-536.081) (-536.830) [-536.058] * [-537.647] (-535.482) (-537.543) (-537.394) -- 0:00:01
969500 -- (-537.488) [-535.728] (-541.697) (-536.782) * (-535.784) (-536.290) (-535.121) [-535.008] -- 0:00:01
970000 -- (-536.466) [-535.087] (-536.030) (-535.241) * (-536.674) (-535.729) [-534.580] (-535.124) -- 0:00:01
Average standard deviation of split frequencies: 0.007058
970500 -- (-537.391) [-534.737] (-536.219) (-534.883) * [-535.514] (-540.199) (-535.331) (-535.260) -- 0:00:01
971000 -- [-534.549] (-534.748) (-537.959) (-534.730) * (-536.852) (-534.580) (-535.994) [-535.025] -- 0:00:01
971500 -- (-534.276) (-535.976) [-534.467] (-534.700) * (-536.433) (-536.300) [-534.806] (-538.875) -- 0:00:01
972000 -- (-537.177) [-538.027] (-536.394) (-535.384) * (-538.136) [-535.793] (-536.157) (-541.795) -- 0:00:01
972500 -- (-535.127) (-535.981) (-535.972) [-536.439] * (-537.160) [-535.285] (-538.475) (-535.436) -- 0:00:01
973000 -- [-535.507] (-534.769) (-534.736) (-538.876) * (-537.293) (-534.838) [-536.481] (-537.398) -- 0:00:01
973500 -- (-536.150) (-534.455) [-537.806] (-541.073) * (-534.361) (-535.495) (-537.838) [-536.885] -- 0:00:01
974000 -- [-536.354] (-538.614) (-534.774) (-541.135) * (-537.347) (-534.535) [-535.566] (-535.976) -- 0:00:01
974500 -- (-539.080) (-538.539) [-537.752] (-535.607) * (-538.973) [-535.205] (-537.945) (-535.580) -- 0:00:01
975000 -- (-537.174) (-535.583) (-537.699) [-535.642] * (-539.381) (-539.090) [-536.165] (-536.435) -- 0:00:01
Average standard deviation of split frequencies: 0.006923
975500 -- (-536.272) (-534.751) [-535.277] (-536.643) * (-537.745) [-536.546] (-537.090) (-536.023) -- 0:00:01
976000 -- (-535.413) (-539.235) [-535.545] (-536.560) * (-537.000) (-540.527) (-537.016) [-537.734] -- 0:00:01
976500 -- (-535.810) (-537.438) [-536.448] (-537.895) * (-536.794) (-547.210) [-536.982] (-535.106) -- 0:00:01
977000 -- (-535.940) [-537.582] (-536.148) (-540.134) * (-535.979) (-536.346) (-538.279) [-537.364] -- 0:00:01
977500 -- [-535.028] (-535.526) (-536.692) (-536.200) * (-534.679) [-536.133] (-536.280) (-535.356) -- 0:00:01
978000 -- (-535.724) (-536.140) [-536.761] (-537.084) * [-534.500] (-536.493) (-535.746) (-538.448) -- 0:00:01
978500 -- [-538.527] (-538.941) (-536.082) (-538.829) * (-534.813) (-535.085) [-535.870] (-536.421) -- 0:00:01
979000 -- [-534.584] (-539.244) (-535.073) (-537.346) * (-536.536) (-535.480) [-536.498] (-535.584) -- 0:00:01
979500 -- (-534.706) (-535.331) [-537.031] (-536.957) * (-536.526) (-540.439) [-534.951] (-536.211) -- 0:00:01
980000 -- (-536.244) (-537.373) [-535.933] (-535.371) * (-535.162) (-537.355) [-536.626] (-538.756) -- 0:00:01
Average standard deviation of split frequencies: 0.006602
980500 -- (-535.408) (-535.604) (-537.501) [-534.741] * [-534.450] (-536.467) (-539.615) (-535.986) -- 0:00:01
981000 -- [-535.431] (-535.757) (-536.643) (-536.209) * (-536.203) (-536.568) (-541.328) [-536.644] -- 0:00:01
981500 -- (-536.366) (-535.788) [-537.612] (-536.055) * [-536.520] (-535.690) (-539.160) (-535.103) -- 0:00:01
982000 -- (-539.411) (-535.763) [-535.226] (-537.107) * (-536.471) [-536.382] (-535.618) (-535.188) -- 0:00:01
982500 -- (-538.013) [-535.310] (-538.399) (-538.204) * (-536.067) [-535.919] (-534.479) (-535.036) -- 0:00:01
983000 -- (-535.891) (-536.434) (-535.206) [-536.280] * (-536.981) (-535.734) [-536.497] (-538.967) -- 0:00:01
983500 -- [-534.453] (-538.010) (-540.103) (-538.741) * (-536.369) (-535.912) [-536.623] (-540.022) -- 0:00:01
984000 -- (-537.810) [-534.706] (-538.797) (-536.017) * (-535.594) [-535.295] (-534.208) (-537.973) -- 0:00:01
984500 -- (-536.634) (-538.072) [-537.546] (-535.391) * (-535.215) [-534.536] (-535.433) (-535.971) -- 0:00:00
985000 -- (-537.170) [-536.929] (-535.155) (-535.282) * [-535.598] (-537.999) (-538.493) (-534.569) -- 0:00:00
Average standard deviation of split frequencies: 0.006725
985500 -- (-541.542) (-535.478) (-536.655) [-535.146] * (-537.169) [-538.406] (-536.585) (-535.638) -- 0:00:00
986000 -- (-538.498) [-535.306] (-535.885) (-535.668) * (-537.269) (-537.968) [-536.779] (-535.929) -- 0:00:00
986500 -- (-535.930) (-534.619) [-534.450] (-536.142) * [-538.725] (-540.664) (-536.434) (-535.401) -- 0:00:00
987000 -- [-535.113] (-535.901) (-534.299) (-537.688) * [-541.825] (-541.405) (-536.792) (-538.724) -- 0:00:00
987500 -- (-536.717) (-535.569) [-538.099] (-535.249) * (-536.498) [-539.672] (-535.859) (-539.754) -- 0:00:00
988000 -- (-538.692) [-534.577] (-536.474) (-535.178) * (-535.273) (-539.165) [-536.007] (-537.913) -- 0:00:00
988500 -- (-535.204) [-537.253] (-541.354) (-535.977) * [-536.362] (-534.841) (-538.309) (-536.529) -- 0:00:00
989000 -- (-536.769) (-538.311) [-534.211] (-535.917) * (-535.776) [-535.030] (-536.037) (-537.348) -- 0:00:00
989500 -- [-535.160] (-541.427) (-534.272) (-536.505) * [-535.458] (-535.205) (-535.009) (-536.450) -- 0:00:00
990000 -- (-535.764) (-541.427) [-534.267] (-539.003) * [-537.136] (-538.484) (-535.105) (-535.423) -- 0:00:00
Average standard deviation of split frequencies: 0.007078
990500 -- (-537.124) (-537.129) (-536.484) [-536.541] * [-537.215] (-541.018) (-535.624) (-535.559) -- 0:00:00
991000 -- (-535.308) (-539.827) (-536.151) [-535.455] * (-536.308) [-536.569] (-540.009) (-535.119) -- 0:00:00
991500 -- [-536.092] (-539.079) (-536.106) (-537.466) * (-534.926) (-535.113) [-536.532] (-537.732) -- 0:00:00
992000 -- [-535.723] (-535.235) (-541.097) (-537.378) * (-539.167) [-535.413] (-536.549) (-536.634) -- 0:00:00
992500 -- [-537.663] (-537.192) (-535.310) (-537.271) * (-539.018) (-538.270) [-535.444] (-539.495) -- 0:00:00
993000 -- (-540.225) (-537.592) [-535.481] (-537.775) * (-540.582) (-535.033) [-537.196] (-536.933) -- 0:00:00
993500 -- (-540.263) [-535.020] (-535.641) (-536.499) * (-536.482) [-534.926] (-537.628) (-536.058) -- 0:00:00
994000 -- (-536.289) (-535.125) [-535.187] (-537.233) * (-538.048) (-536.761) (-536.055) [-535.314] -- 0:00:00
994500 -- (-535.882) (-535.768) [-536.029] (-535.123) * [-536.665] (-539.276) (-537.492) (-534.558) -- 0:00:00
995000 -- (-537.845) (-535.843) (-536.178) [-535.346] * (-537.469) (-537.946) (-536.358) [-536.756] -- 0:00:00
Average standard deviation of split frequencies: 0.007543
995500 -- [-537.842] (-534.987) (-538.083) (-534.733) * (-543.465) (-539.835) [-535.859] (-537.673) -- 0:00:00
996000 -- (-539.531) (-535.746) (-534.866) [-536.106] * [-537.431] (-539.309) (-536.657) (-535.597) -- 0:00:00
996500 -- (-538.060) [-536.078] (-534.802) (-539.215) * (-535.855) [-536.424] (-539.085) (-536.573) -- 0:00:00
997000 -- (-539.379) (-534.801) (-536.707) [-536.943] * [-536.154] (-535.407) (-540.031) (-536.109) -- 0:00:00
997500 -- (-537.641) (-537.704) (-535.827) [-536.592] * (-536.865) (-535.282) (-536.725) [-537.807] -- 0:00:00
998000 -- (-536.071) (-537.469) [-535.934] (-537.237) * (-537.439) (-536.446) [-535.127] (-538.262) -- 0:00:00
998500 -- [-536.123] (-538.216) (-539.760) (-536.641) * (-539.682) [-540.494] (-538.246) (-536.660) -- 0:00:00
999000 -- (-535.398) (-537.221) (-536.471) [-536.923] * (-536.763) (-540.607) [-538.970] (-535.235) -- 0:00:00
999500 -- (-534.497) [-535.422] (-536.156) (-537.582) * (-534.960) (-536.327) (-536.147) [-537.097] -- 0:00:00
1000000 -- (-535.862) (-536.345) [-539.090] (-535.826) * [-535.532] (-539.333) (-538.599) (-539.456) -- 0:00:00
Average standard deviation of split frequencies: 0.007479
Analysis completed in 1 mins 3 seconds
Analysis used 61.26 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -534.02
Likelihood of best state for "cold" chain of run 2 was -534.02
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.4 % ( 72 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
34.8 % ( 22 %) Dirichlet(Pi{all})
36.1 % ( 25 %) Slider(Pi{all})
78.2 % ( 62 %) Multiplier(Alpha{1,2})
77.8 % ( 50 %) Multiplier(Alpha{3})
24.6 % ( 31 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.1 % ( 71 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 23 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.4 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.0 % ( 66 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
35.2 % ( 27 %) Dirichlet(Pi{all})
35.2 % ( 26 %) Slider(Pi{all})
78.2 % ( 61 %) Multiplier(Alpha{1,2})
77.9 % ( 56 %) Multiplier(Alpha{3})
25.7 % ( 25 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 68 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 85 %) ParsSPR(Tau{all},V{all})
28.2 % ( 31 %) Multiplier(V{all})
97.6 % ( 97 %) Nodeslider(V{all})
30.5 % ( 29 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167594 0.82 0.67
3 | 166254 166400 0.84
4 | 166284 166534 166934
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166699 0.82 0.67
3 | 166585 166739 0.84
4 | 166897 166585 166495
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -535.48
| 1 |
| |
| 2 2 |
| 2 2 1 1 |
| 2 2 1 2 |
| *1 22 11 1 1 1 2 1|
| 122 1 1 1 11 1 1 1 21 |
| 1 1 * 1 2 1 * 1 2 2 2 12 1 1 |
| 1 2 2 2 1 22 |
| 2 * 2 2 2 1 2 1 2 1 2 |
| 2 1 1 1 2 * 1 2 2 1 1 1 1 2|
|* 2 2 2 12 2 1 2 1 2 22 21 2 |
| 1 21 1 2 2 |
| 1 1 2 |
| 1 2 2 21 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -537.11
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -535.67 -538.64
2 -535.72 -539.24
--------------------------------------
TOTAL -535.69 -538.98
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896053 0.090552 0.360335 1.494300 0.868409 1314.29 1351.17 1.000
r(A<->C){all} 0.171040 0.019947 0.000065 0.447475 0.135613 233.67 239.26 1.003
r(A<->G){all} 0.151108 0.018243 0.000028 0.423418 0.111958 226.43 241.93 1.000
r(A<->T){all} 0.164610 0.021035 0.000061 0.465483 0.122809 83.05 113.25 1.000
r(C<->G){all} 0.158471 0.018340 0.000028 0.429427 0.122048 210.92 223.81 1.000
r(C<->T){all} 0.175166 0.021789 0.000053 0.475493 0.136174 121.03 178.51 1.002
r(G<->T){all} 0.179605 0.021261 0.000134 0.463568 0.143437 258.87 264.92 1.000
pi(A){all} 0.215210 0.000427 0.176581 0.257239 0.214547 1328.56 1389.42 1.000
pi(C){all} 0.245441 0.000450 0.205448 0.287506 0.245150 1178.53 1248.03 1.000
pi(G){all} 0.294122 0.000508 0.250492 0.337087 0.294359 1291.12 1347.33 1.000
pi(T){all} 0.245228 0.000457 0.204650 0.288040 0.244372 1343.10 1422.05 1.000
alpha{1,2} 0.406881 0.230279 0.000144 1.347226 0.237153 1382.28 1385.80 1.000
alpha{3} 0.457618 0.243732 0.000427 1.447678 0.297757 1320.51 1362.93 1.000
pinvar{all} 0.996003 0.000021 0.987317 0.999997 0.997468 1349.99 1425.49 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**...
8 -- ..**..
9 -- .*..*.
10 -- .****.
11 -- ...*.*
12 -- .***.*
13 -- ...**.
14 -- ....**
15 -- .**.**
16 -- .*.***
17 -- ..*..*
18 -- .*...*
19 -- ..*.*.
20 -- .*.*..
21 -- ..****
22 -- .***..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 462 0.153897 0.011306 0.145903 0.161892 2
8 459 0.152898 0.008009 0.147235 0.158561 2
9 453 0.150899 0.011777 0.142572 0.159227 2
10 444 0.147901 0.007537 0.142572 0.153231 2
11 444 0.147901 0.002827 0.145903 0.149900 2
12 430 0.143238 0.005653 0.139241 0.147235 2
13 429 0.142905 0.015546 0.131912 0.153897 2
14 427 0.142239 0.002355 0.140573 0.143904 2
15 421 0.140240 0.010835 0.132578 0.147901 2
16 418 0.139241 0.011306 0.131246 0.147235 2
17 414 0.137908 0.008480 0.131912 0.143904 2
18 411 0.136909 0.007066 0.131912 0.141905 2
19 408 0.135909 0.004711 0.132578 0.139241 2
20 406 0.135243 0.002827 0.133245 0.137242 2
21 393 0.130913 0.003298 0.128581 0.133245 2
22 289 0.096269 0.006124 0.091939 0.100600 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.101319 0.009579 0.000089 0.300843 0.071164 1.000 2
length{all}[2] 0.102009 0.010263 0.000000 0.295704 0.072467 1.000 2
length{all}[3] 0.097422 0.009242 0.000050 0.295699 0.066449 1.000 2
length{all}[4] 0.099659 0.009929 0.000073 0.297424 0.068571 1.000 2
length{all}[5] 0.099495 0.010326 0.000004 0.306232 0.068813 1.000 2
length{all}[6] 0.099930 0.010543 0.000001 0.303262 0.069485 1.000 2
length{all}[7] 0.103537 0.010527 0.000010 0.305252 0.074611 1.001 2
length{all}[8] 0.101064 0.009750 0.000252 0.295245 0.072177 0.999 2
length{all}[9] 0.100579 0.009983 0.000990 0.312742 0.071984 1.001 2
length{all}[10] 0.093219 0.009237 0.000634 0.253360 0.063771 0.998 2
length{all}[11] 0.092542 0.009380 0.000574 0.276457 0.061244 1.009 2
length{all}[12] 0.092659 0.009227 0.000076 0.283030 0.060602 0.998 2
length{all}[13] 0.100003 0.009983 0.000252 0.298640 0.074445 0.999 2
length{all}[14] 0.099939 0.010265 0.000556 0.296184 0.065344 0.998 2
length{all}[15] 0.097346 0.009120 0.000081 0.294841 0.067503 1.000 2
length{all}[16] 0.092705 0.008244 0.000115 0.295936 0.065516 0.998 2
length{all}[17] 0.096323 0.009334 0.000206 0.266338 0.067741 0.998 2
length{all}[18] 0.109010 0.012551 0.000096 0.319626 0.074417 1.001 2
length{all}[19] 0.102606 0.010445 0.000158 0.309825 0.067304 0.998 2
length{all}[20] 0.090606 0.008725 0.000031 0.264586 0.059941 0.998 2
length{all}[21] 0.099814 0.009400 0.000316 0.285795 0.075362 1.002 2
length{all}[22] 0.098853 0.009250 0.000178 0.279660 0.070499 1.007 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007479
Maximum standard deviation of split frequencies = 0.015546
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.009
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------ C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|-------------------------------------------------------------------- C5 (5)
|
\--------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 92 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 387
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 53 patterns at 129 / 129 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 53 patterns at 129 / 129 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
51728 bytes for conP
4664 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.039912 0.078151 0.014024 0.039324 0.067995 0.087227 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -562.779340
Iterating by ming2
Initial: fx= 562.779340
x= 0.03991 0.07815 0.01402 0.03932 0.06800 0.08723 0.30000 1.30000
1 h-m-p 0.0000 0.0001 309.4437 ++ 552.211111 m 0.0001 13 | 1/8
2 h-m-p 0.0016 0.0864 19.6971 -----------.. | 1/8
3 h-m-p 0.0000 0.0002 282.7564 +++ 536.206246 m 0.0002 45 | 2/8
4 h-m-p 0.0028 0.1001 17.9756 ------------.. | 2/8
5 h-m-p 0.0000 0.0000 253.7203 ++ 535.907341 m 0.0000 77 | 3/8
6 h-m-p 0.0002 0.1225 15.6681 ----------.. | 3/8
7 h-m-p 0.0000 0.0002 219.4036 +++ 525.156857 m 0.0002 108 | 4/8
8 h-m-p 0.0031 0.1608 12.7267 ------------.. | 4/8
9 h-m-p 0.0000 0.0001 179.8313 ++ 522.544582 m 0.0001 140 | 5/8
10 h-m-p 0.0010 0.2314 9.8717 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 127.2782 ++ 521.373335 m 0.0001 171 | 6/8
12 h-m-p 0.5065 8.0000 0.0000 ++ 521.373335 m 8.0000 182 | 6/8
13 h-m-p 0.1946 8.0000 0.0000 +++ 521.373335 m 8.0000 196 | 6/8
14 h-m-p 0.0001 0.0610 7.5654 --------Y 521.373335 0 0.0000 217 | 6/8
15 h-m-p 0.2346 8.0000 0.0000 N 521.373335 0 0.1173 228 | 6/8
16 h-m-p 0.2769 8.0000 0.0000 ---------C 521.373335 0 0.0000 250
Out..
lnL = -521.373335
251 lfun, 251 eigenQcodon, 1506 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.029444 0.094199 0.033880 0.079884 0.034608 0.090593 0.300238 0.850303 0.427815
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 13.058475
np = 9
lnL0 = -566.521284
Iterating by ming2
Initial: fx= 566.521284
x= 0.02944 0.09420 0.03388 0.07988 0.03461 0.09059 0.30024 0.85030 0.42781
1 h-m-p 0.0000 0.0002 300.6143 +++ 544.811046 m 0.0002 15 | 1/9
2 h-m-p 0.0000 0.0001 213.3731 ++ 542.025052 m 0.0001 27 | 2/9
3 h-m-p 0.0000 0.0000 494.9434 ++ 541.703075 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 14869.5880 ++ 524.984722 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0001 814.7062 ++ 521.899899 m 0.0001 63 | 5/9
6 h-m-p 0.0000 0.0002 272.2092 ++ 521.373312 m 0.0002 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0002 ++ 521.373312 m 8.0000 87 | 6/9
8 h-m-p 0.0004 0.0561 4.0024 ++++ 521.373304 m 0.0561 104 | 7/9
9 h-m-p 0.4453 2.3559 0.1368 ++ 521.373268 m 2.3559 116 | 8/9
10 h-m-p 0.4297 2.1487 0.1785 ++ 521.373234 m 2.1487 130 | 9/9
11 h-m-p 0.0160 8.0000 0.0000 Y 521.373234 0 0.0160 143 | 9/9
12 h-m-p 0.0160 8.0000 0.0000 Y 521.373234 0 0.0160 155
Out..
lnL = -521.373234
156 lfun, 468 eigenQcodon, 1872 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.079581 0.096692 0.056541 0.076958 0.017228 0.057472 0.000100 1.558405 0.238662 0.270803 1.304834
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 14.654376
np = 11
lnL0 = -567.402658
Iterating by ming2
Initial: fx= 567.402658
x= 0.07958 0.09669 0.05654 0.07696 0.01723 0.05747 0.00011 1.55841 0.23866 0.27080 1.30483
1 h-m-p 0.0000 0.0000 278.4458 ++ 567.087439 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0004 217.1143 +++ 554.973242 m 0.0004 31 | 2/11
3 h-m-p 0.0002 0.0011 83.3918 ++ 533.984000 m 0.0011 45 | 3/11
4 h-m-p 0.0002 0.0012 21.7419 ++ 532.770300 m 0.0012 59 | 4/11
5 h-m-p 0.0000 0.0000 8881.2693 ++ 522.837803 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0000 705.1382 ++ 522.579377 m 0.0000 87 | 6/11
7 h-m-p 0.0000 0.0001 11.7535 --------.. | 6/11
8 h-m-p 0.0000 0.0000 176.6369 ++ 522.426450 m 0.0000 121 | 7/11
9 h-m-p 0.0029 1.4649 1.6398 ------------.. | 7/11
10 h-m-p 0.0000 0.0001 124.8001 ++ 521.373301 m 0.0001 159 | 8/11
11 h-m-p 0.1169 8.0000 0.0000 ++++ 521.373301 m 8.0000 175 | 8/11
12 h-m-p 0.0385 8.0000 0.0014 ++++ 521.373301 m 8.0000 194 | 8/11
13 h-m-p 0.0160 8.0000 1.7498 ---------N 521.373301 0 0.0000 220 | 8/11
14 h-m-p 0.0160 8.0000 0.0001 +++++ 521.373301 m 8.0000 237 | 8/11
15 h-m-p 0.0006 0.2402 0.9231 +++++ 521.373299 m 0.2402 257 | 9/11
16 h-m-p 0.1043 8.0000 0.9049 ++++ 521.373255 m 8.0000 276 | 9/11
17 h-m-p 1.6000 8.0000 1.3675 ++ 521.373239 m 8.0000 292 | 9/11
18 h-m-p 1.6000 8.0000 4.3552 ++ 521.373234 m 8.0000 306 | 9/11
19 h-m-p 1.6000 8.0000 0.1710 ++ 521.373234 m 8.0000 320 | 9/11
20 h-m-p 0.0044 0.1471 312.9361 +++ 521.373234 m 0.1471 337 | 9/11
21 h-m-p 1.6000 8.0000 0.0000 N 521.373234 0 1.6000 351 | 9/11
22 h-m-p 0.0160 8.0000 0.0000 N 521.373234 0 0.0160 367
Out..
lnL = -521.373234
368 lfun, 1472 eigenQcodon, 6624 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -521.398663 S = -521.373745 -0.009568
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:02
did 20 / 53 patterns 0:02
did 30 / 53 patterns 0:03
did 40 / 53 patterns 0:03
did 50 / 53 patterns 0:03
did 53 / 53 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.094995 0.028579 0.027582 0.091373 0.056226 0.012554 0.000100 0.908935 1.402601
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 17.983734
np = 9
lnL0 = -559.323731
Iterating by ming2
Initial: fx= 559.323731
x= 0.09499 0.02858 0.02758 0.09137 0.05623 0.01255 0.00011 0.90893 1.40260
1 h-m-p 0.0000 0.0000 289.8857 ++ 558.915381 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0297 30.7575 +++++ 548.052339 m 0.0297 29 | 2/9
3 h-m-p 0.0000 0.0000 14141.8961 ++ 545.685308 m 0.0000 41 | 3/9
4 h-m-p 0.0014 0.0084 20.7434 -----------.. | 3/9
5 h-m-p 0.0000 0.0001 264.9548 ++ 538.072903 m 0.0001 74 | 4/9
6 h-m-p 0.0160 8.0000 2.5871 -------------.. | 4/9
7 h-m-p 0.0000 0.0000 238.3485 ++ 537.662587 m 0.0000 109 | 5/9
8 h-m-p 0.0160 8.0000 1.9611 -------------.. | 5/9
9 h-m-p 0.0000 0.0002 204.2390 +++ 529.211093 m 0.0002 145 | 6/9
10 h-m-p 0.0231 8.0000 1.4327 -------------.. | 6/9
11 h-m-p 0.0000 0.0003 168.8840 +++ 521.771705 m 0.0003 181 | 7/9
12 h-m-p 0.0296 8.0000 1.0333 --------------.. | 7/9
13 h-m-p 0.0000 0.0000 122.8755 ++ 521.373234 m 0.0000 217 | 8/9
14 h-m-p 1.6000 8.0000 0.0000 -Y 521.373234 0 0.1000 230 | 8/9
15 h-m-p 1.6000 8.0000 0.0000 Y 521.373234 0 1.6000 243
Out..
lnL = -521.373234
244 lfun, 2684 eigenQcodon, 14640 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.033771 0.015628 0.104141 0.047948 0.018955 0.053390 0.000100 0.900000 0.925952 1.748576 1.300192
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 16.820861
np = 11
lnL0 = -554.469876
Iterating by ming2
Initial: fx= 554.469876
x= 0.03377 0.01563 0.10414 0.04795 0.01896 0.05339 0.00011 0.90000 0.92595 1.74858 1.30019
1 h-m-p 0.0000 0.0000 284.9472 ++ 554.022314 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0025 73.2663 ++++ 542.670857 m 0.0025 32 | 2/11
3 h-m-p 0.0000 0.0001 267.2882 ++ 540.599213 m 0.0001 46 | 3/11
4 h-m-p 0.0004 0.0057 43.9930 ++ 535.942057 m 0.0057 60 | 4/11
5 h-m-p 0.0001 0.0003 272.4354 ++ 531.565539 m 0.0003 74 | 5/11
6 h-m-p 0.0001 0.0004 264.7930 ++ 530.622644 m 0.0004 88 | 6/11
7 h-m-p 0.0002 0.0011 110.3604 ++ 521.373325 m 0.0011 102 | 7/11
8 h-m-p 1.6000 8.0000 0.0001 ++ 521.373325 m 8.0000 116 | 7/11
9 h-m-p 0.0160 8.0000 0.0668 +++++ 521.373312 m 8.0000 137 | 7/11
10 h-m-p 0.0165 0.0823 4.5017 ++ 521.373305 m 0.0823 155 | 8/11
11 h-m-p 0.6784 3.3921 0.4805 ++ 521.373234 m 3.3921 169 | 9/11
12 h-m-p 1.6000 8.0000 0.0023 ++ 521.373234 m 8.0000 186 | 9/11
13 h-m-p 0.0936 6.7047 0.1963 ++++ 521.373234 m 6.7047 204 | 10/11
14 h-m-p 1.3104 8.0000 0.2341
QuantileBeta(0.15, 0.00500, 2.95859) = 8.317928e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.60447) = 6.604986e-161 2000 rounds
+ 521.373234 m 8.0000 220
QuantileBeta(0.15, 0.00500, 3.60447) = 6.604986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.60447) = 6.604986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.60447) = 6.604986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.60447) = 6.604986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.60447) = 6.604986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.60447) = 6.604986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.60447) = 6.604986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.60447) = 6.604986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.60447) = 6.835563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.60462) = 6.604658e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.60431) = 6.605314e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.60447) = 6.604986e-161 2000 rounds
| 10/11
15 h-m-p 1.6000 8.0000 0.5752
QuantileBeta(0.15, 0.00500, 4.52471) = 5.104373e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.28544) = 3.033343e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 8.20568) = 2.671745e-161 2000 rounds
+ 521.373234 m 8.0000 235
QuantileBeta(0.15, 0.00500, 8.20568) = 2.671745e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.20568) = 2.671745e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.20568) = 2.671745e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.20568) = 2.671745e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.20568) = 2.671745e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.20568) = 2.671745e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.20568) = 2.671745e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.20568) = 2.671745e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.20568) = 2.765015e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.20593) = 2.671660e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.20543) = 2.671831e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.20568) = 2.671745e-161 2000 rounds
| 10/11
16 h-m-p 0.9235 4.6174 1.7761
QuantileBeta(0.15, 0.00500, 6.56554) = 3.392444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79565) = 2.821625e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.10317) = 2.707703e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.18005) = 2.680645e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.19927) = 2.673965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.19180) = 2.676557e-161 2000 rounds
Y 521.373234 0 0.0036 253
QuantileBeta(0.15, 0.00500, 8.19927) = 2.673965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.19927) = 2.673965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.19927) = 2.673965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.19927) = 2.673965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.19927) = 2.673965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.19927) = 2.673965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.19927) = 2.673965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.19927) = 2.673965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.19927) = 2.767312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.19928) = 2.673963e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.19927) = 2.673965e-161 2000 rounds
| 10/11
17 h-m-p 1.0084 8.0000 0.0064
QuantileBeta(0.15, 0.00500, 8.20568) = 2.671745e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.22490) = 2.665109e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 8.25010) = 2.656457e-161 2000 rounds
+ 521.373234 m 8.0000 267
QuantileBeta(0.15, 0.00500, 8.25010) = 2.656457e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.25010) = 2.656457e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.25010) = 2.656457e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.25010) = 2.656457e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.25010) = 2.656457e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.25010) = 2.656457e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.25010) = 2.656457e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.25010) = 2.656457e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.25010) = 2.749193e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.25035) = 2.656372e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.24985) = 2.656542e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.25010) = 2.656457e-161 2000 rounds
| 10/11
18 h-m-p 1.6000 8.0000 0.0004
QuantileBeta(0.15, 0.00500, 8.24943) = 2.656687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.24993) = 2.656515e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.25006) = 2.656472e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 8.25009) = 2.656461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.25010) = 2.656459e-161 2000 rounds
N 521.373234 0 0.0250 284
QuantileBeta(0.15, 0.00500, 8.25009) = 2.656461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.25009) = 2.656461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.25009) = 2.656461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.25009) = 2.656461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.25009) = 2.656461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.25009) = 2.656461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.25009) = 2.656461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.25009) = 2.656461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.25009) = 2.749197e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.25034) = 2.656376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.24984) = 2.656546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.25009) = 2.656461e-161 2000 rounds
| 10/11
19 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 8.25009) = 2.656461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.25009) = 2.656461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.25009) = 2.656461e-161 2000 rounds
N 521.373234 0 1.6000 299
QuantileBeta(0.15, 0.00500, 8.25009) = 2.656461e-161 2000 rounds
Out..
lnL = -521.373234
300 lfun, 3600 eigenQcodon, 19800 P(t)
QuantileBeta(0.15, 0.00500, 8.25009) = 2.656461e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -521.406215 S = -521.373745 -0.014326
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:12
did 20 / 53 patterns 0:12
did 30 / 53 patterns 0:12
did 40 / 53 patterns 0:12
did 50 / 53 patterns 0:12
did 53 / 53 patterns 0:12
QuantileBeta(0.15, 0.00500, 8.25009) = 2.656461e-161 2000 rounds
Time used: 0:12
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=129
NC_011896_1_WP_010908923_1_2652_MLBR_RS12610 LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
NC_002677_1_NP_302604_1_1476_ML2478 LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
NZ_LVXE01000081_1_WP_010908923_1_2774_A3216_RS13655 LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
NZ_LYPH01000084_1_WP_010908923_1_2708_A8144_RS13035 LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
NZ_CP029543_1_WP_010908923_1_2682_DIJ64_RS13660 LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
NZ_AP014567_1_WP_010908923_1_2748_JK2ML_RS13990 LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
**************************************************
NC_011896_1_WP_010908923_1_2652_MLBR_RS12610 ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
NC_002677_1_NP_302604_1_1476_ML2478 ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
NZ_LVXE01000081_1_WP_010908923_1_2774_A3216_RS13655 ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
NZ_LYPH01000084_1_WP_010908923_1_2708_A8144_RS13035 ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
NZ_CP029543_1_WP_010908923_1_2682_DIJ64_RS13660 ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
NZ_AP014567_1_WP_010908923_1_2748_JK2ML_RS13990 ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
**************************************************
NC_011896_1_WP_010908923_1_2652_MLBR_RS12610 VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
NC_002677_1_NP_302604_1_1476_ML2478 VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
NZ_LVXE01000081_1_WP_010908923_1_2774_A3216_RS13655 VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
NZ_LYPH01000084_1_WP_010908923_1_2708_A8144_RS13035 VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
NZ_CP029543_1_WP_010908923_1_2682_DIJ64_RS13660 VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
NZ_AP014567_1_WP_010908923_1_2748_JK2ML_RS13990 VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
*****************************
>NC_011896_1_WP_010908923_1_2652_MLBR_RS12610 TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT >NC_002677_1_NP_302604_1_1476_ML2478 TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT >NZ_LVXE01000081_1_WP_010908923_1_2774_A3216_RS13655 TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT >NZ_LYPH01000084_1_WP_010908923_1_2708_A8144_RS13035 TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT >NZ_CP029543_1_WP_010908923_1_2682_DIJ64_RS13660 TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT >NZ_AP014567_1_WP_010908923_1_2748_JK2ML_RS13990 TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT
>NC_011896_1_WP_010908923_1_2652_MLBR_RS12610 LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK VVAAIVGYVAVFDGSAVTDTRWVVVGVTS >NC_002677_1_NP_302604_1_1476_ML2478 LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK VVAAIVGYVAVFDGSAVTDTRWVVVGVTS >NZ_LVXE01000081_1_WP_010908923_1_2774_A3216_RS13655 LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK VVAAIVGYVAVFDGSAVTDTRWVVVGVTS >NZ_LYPH01000084_1_WP_010908923_1_2708_A8144_RS13035 LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK VVAAIVGYVAVFDGSAVTDTRWVVVGVTS >NZ_CP029543_1_WP_010908923_1_2682_DIJ64_RS13660 LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK VVAAIVGYVAVFDGSAVTDTRWVVVGVTS >NZ_AP014567_1_WP_010908923_1_2748_JK2ML_RS13990 LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
#NEXUS
[ID: 5707461345]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908923_1_2652_MLBR_RS12610
NC_002677_1_NP_302604_1_1476_ML2478
NZ_LVXE01000081_1_WP_010908923_1_2774_A3216_RS13655
NZ_LYPH01000084_1_WP_010908923_1_2708_A8144_RS13035
NZ_CP029543_1_WP_010908923_1_2682_DIJ64_RS13660
NZ_AP014567_1_WP_010908923_1_2748_JK2ML_RS13990
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908923_1_2652_MLBR_RS12610,
2 NC_002677_1_NP_302604_1_1476_ML2478,
3 NZ_LVXE01000081_1_WP_010908923_1_2774_A3216_RS13655,
4 NZ_LYPH01000084_1_WP_010908923_1_2708_A8144_RS13035,
5 NZ_CP029543_1_WP_010908923_1_2682_DIJ64_RS13660,
6 NZ_AP014567_1_WP_010908923_1_2748_JK2ML_RS13990
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07116383,2:0.07246707,3:0.06644901,4:0.06857113,5:0.06881325,6:0.06948481);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07116383,2:0.07246707,3:0.06644901,4:0.06857113,5:0.06881325,6:0.06948481);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -535.67 -538.64
2 -535.72 -539.24
--------------------------------------
TOTAL -535.69 -538.98
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896053 0.090552 0.360335 1.494300 0.868409 1314.29 1351.17 1.000
r(A<->C){all} 0.171040 0.019947 0.000065 0.447475 0.135613 233.67 239.26 1.003
r(A<->G){all} 0.151108 0.018243 0.000028 0.423418 0.111958 226.43 241.93 1.000
r(A<->T){all} 0.164610 0.021035 0.000061 0.465483 0.122809 83.05 113.25 1.000
r(C<->G){all} 0.158471 0.018340 0.000028 0.429427 0.122048 210.92 223.81 1.000
r(C<->T){all} 0.175166 0.021789 0.000053 0.475493 0.136174 121.03 178.51 1.002
r(G<->T){all} 0.179605 0.021261 0.000134 0.463568 0.143437 258.87 264.92 1.000
pi(A){all} 0.215210 0.000427 0.176581 0.257239 0.214547 1328.56 1389.42 1.000
pi(C){all} 0.245441 0.000450 0.205448 0.287506 0.245150 1178.53 1248.03 1.000
pi(G){all} 0.294122 0.000508 0.250492 0.337087 0.294359 1291.12 1347.33 1.000
pi(T){all} 0.245228 0.000457 0.204650 0.288040 0.244372 1343.10 1422.05 1.000
alpha{1,2} 0.406881 0.230279 0.000144 1.347226 0.237153 1382.28 1385.80 1.000
alpha{3} 0.457618 0.243732 0.000427 1.447678 0.297757 1320.51 1362.93 1.000
pinvar{all} 0.996003 0.000021 0.987317 0.999997 0.997468 1349.99 1425.49 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2478/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 129
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 5 5 5 5 5 5 | Cys TGT 2 2 2 2 2 2
TTC 3 3 3 3 3 3 | TCC 1 1 1 1 1 1 | TAC 3 3 3 3 3 3 | TGC 0 0 0 0 0 0
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 1 1 1 1 1 1
CTC 1 1 1 1 1 1 | CCC 1 1 1 1 1 1 | CAC 1 1 1 1 1 1 | CGC 4 4 4 4 4 4
CTA 2 2 2 2 2 2 | CCA 1 1 1 1 1 1 | Gln CAA 2 2 2 2 2 2 | CGA 1 1 1 1 1 1
CTG 3 3 3 3 3 3 | CCG 1 1 1 1 1 1 | CAG 1 1 1 1 1 1 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 1 1 1 1 1 1 | Asn AAT 1 1 1 1 1 1 | Ser AGT 2 2 2 2 2 2
ATC 0 0 0 0 0 0 | ACC 4 4 4 4 4 4 | AAC 2 2 2 2 2 2 | AGC 3 3 3 3 3 3
ATA 0 0 0 0 0 0 | ACA 4 4 4 4 4 4 | Lys AAA 2 2 2 2 2 2 | Arg AGA 3 3 3 3 3 3
Met ATG 0 0 0 0 0 0 | ACG 1 1 1 1 1 1 | AAG 0 0 0 0 0 0 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 6 6 6 6 6 6 | Ala GCT 8 8 8 8 8 8 | Asp GAT 1 1 1 1 1 1 | Gly GGT 2 2 2 2 2 2
GTC 6 6 6 6 6 6 | GCC 4 4 4 4 4 4 | GAC 6 6 6 6 6 6 | GGC 2 2 2 2 2 2
GTA 2 2 2 2 2 2 | GCA 1 1 1 1 1 1 | Glu GAA 4 4 4 4 4 4 | GGA 3 3 3 3 3 3
GTG 4 4 4 4 4 4 | GCG 2 2 2 2 2 2 | GAG 2 2 2 2 2 2 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908923_1_2652_MLBR_RS12610
position 1: T:0.19380 C:0.18605 A:0.20155 G:0.41860
position 2: T:0.27132 C:0.23256 A:0.24031 G:0.25581
position 3: T:0.27132 C:0.31783 A:0.20155 G:0.20930
Average T:0.24548 C:0.24548 A:0.21447 G:0.29457
#2: NC_002677_1_NP_302604_1_1476_ML2478
position 1: T:0.19380 C:0.18605 A:0.20155 G:0.41860
position 2: T:0.27132 C:0.23256 A:0.24031 G:0.25581
position 3: T:0.27132 C:0.31783 A:0.20155 G:0.20930
Average T:0.24548 C:0.24548 A:0.21447 G:0.29457
#3: NZ_LVXE01000081_1_WP_010908923_1_2774_A3216_RS13655
position 1: T:0.19380 C:0.18605 A:0.20155 G:0.41860
position 2: T:0.27132 C:0.23256 A:0.24031 G:0.25581
position 3: T:0.27132 C:0.31783 A:0.20155 G:0.20930
Average T:0.24548 C:0.24548 A:0.21447 G:0.29457
#4: NZ_LYPH01000084_1_WP_010908923_1_2708_A8144_RS13035
position 1: T:0.19380 C:0.18605 A:0.20155 G:0.41860
position 2: T:0.27132 C:0.23256 A:0.24031 G:0.25581
position 3: T:0.27132 C:0.31783 A:0.20155 G:0.20930
Average T:0.24548 C:0.24548 A:0.21447 G:0.29457
#5: NZ_CP029543_1_WP_010908923_1_2682_DIJ64_RS13660
position 1: T:0.19380 C:0.18605 A:0.20155 G:0.41860
position 2: T:0.27132 C:0.23256 A:0.24031 G:0.25581
position 3: T:0.27132 C:0.31783 A:0.20155 G:0.20930
Average T:0.24548 C:0.24548 A:0.21447 G:0.29457
#6: NZ_AP014567_1_WP_010908923_1_2748_JK2ML_RS13990
position 1: T:0.19380 C:0.18605 A:0.20155 G:0.41860
position 2: T:0.27132 C:0.23256 A:0.24031 G:0.25581
position 3: T:0.27132 C:0.31783 A:0.20155 G:0.20930
Average T:0.24548 C:0.24548 A:0.21447 G:0.29457
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 0 | Tyr Y TAT 30 | Cys C TGT 12
TTC 18 | TCC 6 | TAC 18 | TGC 0
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 6 | TAG 0 | Trp W TGG 30
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 6
CTC 6 | CCC 6 | CAC 6 | CGC 24
CTA 12 | CCA 6 | Gln Q CAA 12 | CGA 6
CTG 18 | CCG 6 | CAG 6 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 6 | Asn N AAT 6 | Ser S AGT 12
ATC 0 | ACC 24 | AAC 12 | AGC 18
ATA 0 | ACA 24 | Lys K AAA 12 | Arg R AGA 18
Met M ATG 0 | ACG 6 | AAG 0 | AGG 6
------------------------------------------------------------------------------
Val V GTT 36 | Ala A GCT 48 | Asp D GAT 6 | Gly G GGT 12
GTC 36 | GCC 24 | GAC 36 | GGC 12
GTA 12 | GCA 6 | Glu E GAA 24 | GGA 18
GTG 24 | GCG 12 | GAG 12 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.19380 C:0.18605 A:0.20155 G:0.41860
position 2: T:0.27132 C:0.23256 A:0.24031 G:0.25581
position 3: T:0.27132 C:0.31783 A:0.20155 G:0.20930
Average T:0.24548 C:0.24548 A:0.21447 G:0.29457
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -521.373335 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300238 1.300192
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908923_1_2652_MLBR_RS12610: 0.000004, NC_002677_1_NP_302604_1_1476_ML2478: 0.000004, NZ_LVXE01000081_1_WP_010908923_1_2774_A3216_RS13655: 0.000004, NZ_LYPH01000084_1_WP_010908923_1_2708_A8144_RS13035: 0.000004, NZ_CP029543_1_WP_010908923_1_2682_DIJ64_RS13660: 0.000004, NZ_AP014567_1_WP_010908923_1_2748_JK2ML_RS13990: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30024
omega (dN/dS) = 1.30019
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 290.7 96.3 1.3002 0.0000 0.0000 0.0 0.0
7..2 0.000 290.7 96.3 1.3002 0.0000 0.0000 0.0 0.0
7..3 0.000 290.7 96.3 1.3002 0.0000 0.0000 0.0 0.0
7..4 0.000 290.7 96.3 1.3002 0.0000 0.0000 0.0 0.0
7..5 0.000 290.7 96.3 1.3002 0.0000 0.0000 0.0 0.0
7..6 0.000 290.7 96.3 1.3002 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -521.373234 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908923_1_2652_MLBR_RS12610: 0.000004, NC_002677_1_NP_302604_1_1476_ML2478: 0.000004, NZ_LVXE01000081_1_WP_010908923_1_2774_A3216_RS13655: 0.000004, NZ_LYPH01000084_1_WP_010908923_1_2708_A8144_RS13035: 0.000004, NZ_CP029543_1_WP_010908923_1_2682_DIJ64_RS13660: 0.000004, NZ_AP014567_1_WP_010908923_1_2748_JK2ML_RS13990: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 297.3 89.7 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 297.3 89.7 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 297.3 89.7 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 297.3 89.7 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 297.3 89.7 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 297.3 89.7 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -521.373234 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908923_1_2652_MLBR_RS12610: 0.000004, NC_002677_1_NP_302604_1_1476_ML2478: 0.000004, NZ_LVXE01000081_1_WP_010908923_1_2774_A3216_RS13655: 0.000004, NZ_LYPH01000084_1_WP_010908923_1_2708_A8144_RS13035: 0.000004, NZ_CP029543_1_WP_010908923_1_2682_DIJ64_RS13660: 0.000004, NZ_AP014567_1_WP_010908923_1_2748_JK2ML_RS13990: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 297.3 89.7 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 297.3 89.7 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 297.3 89.7 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 297.3 89.7 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 297.3 89.7 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 297.3 89.7 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908923_1_2652_MLBR_RS12610)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.102 0.101 0.101 0.101 0.100 0.100 0.099 0.099 0.099 0.098
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -521.373234 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.548589
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908923_1_2652_MLBR_RS12610: 0.000004, NC_002677_1_NP_302604_1_1476_ML2478: 0.000004, NZ_LVXE01000081_1_WP_010908923_1_2774_A3216_RS13655: 0.000004, NZ_LYPH01000084_1_WP_010908923_1_2708_A8144_RS13035: 0.000004, NZ_CP029543_1_WP_010908923_1_2682_DIJ64_RS13660: 0.000004, NZ_AP014567_1_WP_010908923_1_2748_JK2ML_RS13990: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.54859
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 297.3 89.7 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 297.3 89.7 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 297.3 89.7 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 297.3 89.7 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 297.3 89.7 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 297.3 89.7 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -521.373234 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 8.250091 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908923_1_2652_MLBR_RS12610: 0.000004, NC_002677_1_NP_302604_1_1476_ML2478: 0.000004, NZ_LVXE01000081_1_WP_010908923_1_2774_A3216_RS13655: 0.000004, NZ_LYPH01000084_1_WP_010908923_1_2708_A8144_RS13035: 0.000004, NZ_CP029543_1_WP_010908923_1_2682_DIJ64_RS13660: 0.000004, NZ_AP014567_1_WP_010908923_1_2748_JK2ML_RS13990: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 8.25009
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 297.3 89.7 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 297.3 89.7 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 297.3 89.7 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 297.3 89.7 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 297.3 89.7 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 297.3 89.7 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908923_1_2652_MLBR_RS12610)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.098 0.098 0.099 0.099 0.100 0.100 0.101 0.101 0.102 0.103
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098
Time used: 0:12
Model 1: NearlyNeutral -521.373234 Model 2: PositiveSelection -521.373234 Model 0: one-ratio -521.373335 Model 7: beta -521.373234 Model 8: beta&w>1 -521.373234 Model 0 vs 1 2.0199999994474638E-4 Model 2 vs 1 0.0 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
