--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:20:27 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2478/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -535.67          -538.64
2       -535.72          -539.24
--------------------------------------
TOTAL     -535.69          -538.98
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.896053    0.090552    0.360335    1.494300    0.868409   1314.29   1351.17    1.000
r(A<->C){all}   0.171040    0.019947    0.000065    0.447475    0.135613    233.67    239.26    1.003
r(A<->G){all}   0.151108    0.018243    0.000028    0.423418    0.111958    226.43    241.93    1.000
r(A<->T){all}   0.164610    0.021035    0.000061    0.465483    0.122809     83.05    113.25    1.000
r(C<->G){all}   0.158471    0.018340    0.000028    0.429427    0.122048    210.92    223.81    1.000
r(C<->T){all}   0.175166    0.021789    0.000053    0.475493    0.136174    121.03    178.51    1.002
r(G<->T){all}   0.179605    0.021261    0.000134    0.463568    0.143437    258.87    264.92    1.000
pi(A){all}      0.215210    0.000427    0.176581    0.257239    0.214547   1328.56   1389.42    1.000
pi(C){all}      0.245441    0.000450    0.205448    0.287506    0.245150   1178.53   1248.03    1.000
pi(G){all}      0.294122    0.000508    0.250492    0.337087    0.294359   1291.12   1347.33    1.000
pi(T){all}      0.245228    0.000457    0.204650    0.288040    0.244372   1343.10   1422.05    1.000
alpha{1,2}      0.406881    0.230279    0.000144    1.347226    0.237153   1382.28   1385.80    1.000
alpha{3}        0.457618    0.243732    0.000427    1.447678    0.297757   1320.51   1362.93    1.000
pinvar{all}     0.996003    0.000021    0.987317    0.999997    0.997468   1349.99   1425.49    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-521.373234
Model 2: PositiveSelection	-521.373234
Model 0: one-ratio	-521.373335
Model 7: beta	-521.373234
Model 8: beta&w>1	-521.373234


Model 0 vs 1	2.0199999994474638E-4

Model 2 vs 1	0.0

Model 8 vs 7	0.0
>C1
LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
>C2
LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
>C3
LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
>C4
LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
>C5
LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
>C6
LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=129 

C1              LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
C2              LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
C3              LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
C4              LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
C5              LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
C6              LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
                **************************************************

C1              ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
C2              ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
C3              ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
C4              ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
C5              ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
C6              ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
                **************************************************

C1              VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
C2              VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
C3              VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
C4              VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
C5              VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
C6              VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
                *****************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  129 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  129 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3870]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [3870]--->[3870]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.461 Mb, Max= 30.659 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
C2              LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
C3              LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
C4              LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
C5              LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
C6              LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
                **************************************************

C1              ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
C2              ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
C3              ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
C4              ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
C5              ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
C6              ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
                **************************************************

C1              VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
C2              VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
C3              VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
C4              VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
C5              VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
C6              VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
                *****************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG
C2              TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG
C3              TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG
C4              TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG
C5              TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG
C6              TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG
                **************************************************

C1              CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC
C2              CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC
C3              CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC
C4              CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC
C5              CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC
C6              CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC
                **************************************************

C1              GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA
C2              GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA
C3              GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA
C4              GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA
C5              GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA
C6              GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA
                **************************************************

C1              GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA
C2              GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA
C3              GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA
C4              GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA
C5              GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA
C6              GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA
                **************************************************

C1              GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA
C2              GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA
C3              GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA
C4              GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA
C5              GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA
C6              GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA
                **************************************************

C1              CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA
C2              CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA
C3              CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA
C4              CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA
C5              CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA
C6              CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA
                **************************************************

C1              GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT
C2              GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT
C3              GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT
C4              GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT
C5              GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT
C6              GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT
                **************************************************

C1              AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT
C2              AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT
C3              AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT
C4              AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT
C5              AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT
C6              AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT
                *************************************



>C1
TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG
CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC
GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA
GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA
GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA
CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA
GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT
AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT
>C2
TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG
CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC
GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA
GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA
GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA
CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA
GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT
AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT
>C3
TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG
CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC
GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA
GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA
GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA
CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA
GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT
AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT
>C4
TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG
CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC
GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA
GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA
GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA
CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA
GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT
AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT
>C5
TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG
CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC
GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA
GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA
GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA
CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA
GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT
AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT
>C6
TTGTGGTACGAAAACAGCGGCGGGCTAAGCGCTGACGAGCTCGCCTATCG
CTACCACGAACAGCTGAGAGAAGACACAAGACTTGCTGCTAGCCGACCCC
GGACCACACTATATAGACCATATGTGTGTGTTGGACAACCGCGTTTACAA
GCGCGGCGCGTTGACTTTGCACGCGCTTCGTGGTGTGTTGTCGGTGCCGA
GAAATTCTTTGCTCTGATTAGGAATTGGTTGACCTGGTATCGCCATGCCA
CGGTCGTCACCGACGATTTCACCGGTCTGGTCGCCAACTATTCCGAAAAA
GTTGTTGCGGCTATTGTGGGATACGTGGCTGTATTCGACGGAAGTGCTGT
AACTGACACACGGTGGGTGGTCGTCGGCGTTACAAGT
>C1
LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
>C2
LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
>C3
LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
>C4
LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
>C5
LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
VVAAIVGYVAVFDGSAVTDTRWVVVGVTS
>C6
LWYENSGGLSADELAYRYHEQLREDTRLAASRPRTTLYRPYVCVGQPRLQ
ARRVDFARASWCVVGAEKFFALIRNWLTWYRHATVVTDDFTGLVANYSEK
VVAAIVGYVAVFDGSAVTDTRWVVVGVTS


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 387 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579857550
      Setting output file names to "/data/9res/ML2478/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 2128768710
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5707461345
      Seed = 1934302262
      Swapseed = 1579857550
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -866.124551 -- -24.965149
         Chain 2 -- -866.124551 -- -24.965149
         Chain 3 -- -866.124551 -- -24.965149
         Chain 4 -- -866.124551 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -866.124551 -- -24.965149
         Chain 2 -- -866.124501 -- -24.965149
         Chain 3 -- -866.124551 -- -24.965149
         Chain 4 -- -866.124551 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-866.125] (-866.125) (-866.125) (-866.125) * [-866.125] (-866.125) (-866.125) (-866.125) 
        500 -- [-549.883] (-549.316) (-544.809) (-540.723) * (-556.408) [-552.530] (-549.462) (-543.797) -- 0:00:00
       1000 -- (-549.982) (-544.813) (-545.840) [-538.140] * (-542.941) [-545.199] (-548.272) (-552.879) -- 0:00:00
       1500 -- (-547.057) (-544.162) (-543.832) [-546.086] * (-546.278) (-545.995) [-539.405] (-545.019) -- 0:00:00
       2000 -- (-543.590) (-551.191) (-543.476) [-536.959] * (-548.258) [-543.829] (-548.217) (-555.642) -- 0:00:00
       2500 -- (-550.739) (-542.992) [-544.340] (-548.440) * [-551.527] (-545.706) (-546.565) (-542.834) -- 0:00:00
       3000 -- (-543.022) [-544.841] (-547.887) (-553.164) * (-545.674) (-552.535) [-541.679] (-545.308) -- 0:00:00
       3500 -- (-547.830) (-549.140) (-546.990) [-544.310] * (-542.671) [-551.443] (-546.665) (-552.190) -- 0:00:00
       4000 -- (-546.459) [-542.005] (-545.573) (-550.575) * (-547.626) [-548.644] (-541.857) (-542.333) -- 0:00:00
       4500 -- [-542.749] (-544.385) (-545.164) (-551.525) * (-552.241) (-544.809) (-546.367) [-543.845] -- 0:00:00
       5000 -- (-546.556) (-550.365) [-547.027] (-553.641) * (-539.705) [-539.453] (-547.559) (-546.732) -- 0:00:00

      Average standard deviation of split frequencies: 0.065473

       5500 -- (-542.368) [-546.414] (-547.104) (-546.077) * [-544.768] (-544.579) (-546.041) (-549.833) -- 0:03:00
       6000 -- (-543.966) (-547.987) [-547.451] (-544.893) * (-551.960) [-548.418] (-542.630) (-547.010) -- 0:02:45
       6500 -- (-547.007) (-546.786) [-543.518] (-554.920) * [-541.659] (-543.914) (-545.146) (-550.471) -- 0:02:32
       7000 -- (-551.728) (-547.353) (-548.105) [-544.363] * (-544.919) (-550.203) [-544.974] (-545.000) -- 0:02:21
       7500 -- (-551.952) (-543.803) (-543.868) [-542.834] * (-543.994) [-542.978] (-543.057) (-553.510) -- 0:02:12
       8000 -- (-546.699) [-545.227] (-541.911) (-550.066) * (-551.991) (-551.175) [-541.999] (-549.134) -- 0:02:04
       8500 -- (-537.750) (-558.311) (-543.165) [-550.329] * (-550.897) (-547.924) (-544.853) [-544.615] -- 0:01:56
       9000 -- (-539.730) (-541.664) (-536.135) [-547.340] * (-543.361) [-552.238] (-547.231) (-539.960) -- 0:01:50
       9500 -- (-535.753) (-551.779) [-536.383] (-545.839) * [-556.755] (-544.543) (-549.087) (-542.841) -- 0:01:44
      10000 -- (-535.874) (-546.481) [-538.462] (-550.454) * [-550.144] (-541.745) (-546.868) (-542.615) -- 0:01:39

      Average standard deviation of split frequencies: 0.094702

      10500 -- (-543.934) (-537.270) [-536.572] (-558.160) * (-552.784) (-544.293) [-544.124] (-546.890) -- 0:01:34
      11000 -- [-538.119] (-536.660) (-536.869) (-543.201) * [-541.234] (-545.267) (-541.265) (-555.819) -- 0:01:29
      11500 -- (-537.099) [-539.081] (-538.121) (-545.858) * (-545.379) [-544.112] (-544.314) (-556.598) -- 0:01:25
      12000 -- (-536.603) (-534.522) [-537.847] (-549.710) * (-544.159) [-544.023] (-545.934) (-549.258) -- 0:01:22
      12500 -- (-536.211) (-534.828) (-535.662) [-541.062] * [-549.304] (-556.522) (-550.147) (-547.132) -- 0:01:19
      13000 -- (-535.953) (-535.168) (-536.121) [-538.345] * (-545.389) [-539.840] (-544.491) (-550.640) -- 0:01:15
      13500 -- (-537.383) (-538.909) (-539.686) [-546.377] * (-547.208) (-545.181) (-540.624) [-550.575] -- 0:01:13
      14000 -- (-534.338) (-540.022) [-534.955] (-549.271) * (-548.382) (-546.485) (-549.438) [-549.150] -- 0:01:10
      14500 -- (-540.230) (-535.964) [-535.293] (-548.595) * [-542.640] (-548.260) (-539.989) (-544.058) -- 0:01:07
      15000 -- (-534.642) [-536.790] (-534.694) (-553.551) * (-546.144) (-545.261) (-540.235) [-546.411] -- 0:01:05

      Average standard deviation of split frequencies: 0.072882

      15500 -- (-535.978) (-535.872) [-537.509] (-548.300) * (-544.350) (-545.787) [-536.260] (-545.820) -- 0:01:03
      16000 -- (-538.891) [-535.909] (-535.461) (-542.673) * (-546.599) (-541.507) (-535.697) [-540.480] -- 0:01:01
      16500 -- (-541.394) (-534.843) (-536.672) [-549.756] * (-544.451) (-544.706) [-539.785] (-540.313) -- 0:00:59
      17000 -- (-542.769) (-536.626) (-538.682) [-549.553] * (-547.940) (-543.950) (-546.078) [-542.037] -- 0:00:57
      17500 -- [-535.391] (-536.445) (-540.118) (-542.000) * (-549.154) (-553.011) (-537.212) [-540.723] -- 0:00:56
      18000 -- (-534.788) (-535.644) (-543.756) [-548.212] * (-545.215) (-548.581) (-534.768) [-542.626] -- 0:00:54
      18500 -- [-535.205] (-534.802) (-535.598) (-551.826) * (-556.362) (-547.966) (-536.091) [-541.011] -- 0:00:53
      19000 -- (-537.200) (-535.260) [-536.701] (-544.804) * (-541.753) (-550.121) [-537.173] (-548.961) -- 0:00:51
      19500 -- [-536.367] (-534.235) (-534.160) (-545.615) * (-547.746) (-552.848) [-535.763] (-542.695) -- 0:00:50
      20000 -- (-535.988) (-535.174) [-536.345] (-541.532) * (-548.858) [-542.258] (-535.735) (-541.231) -- 0:00:49

      Average standard deviation of split frequencies: 0.051956

      20500 -- (-536.352) [-536.016] (-537.990) (-544.388) * (-544.374) [-542.927] (-536.322) (-544.061) -- 0:00:47
      21000 -- (-534.749) (-536.662) (-536.367) [-543.513] * (-545.003) [-547.054] (-535.014) (-552.204) -- 0:00:46
      21500 -- [-537.588] (-535.505) (-536.730) (-542.146) * (-549.116) [-541.937] (-537.213) (-543.799) -- 0:00:45
      22000 -- (-535.682) (-539.261) [-535.312] (-542.685) * (-561.298) [-541.644] (-535.687) (-547.570) -- 0:01:28
      22500 -- (-537.520) [-536.091] (-536.221) (-543.534) * (-543.469) (-545.252) [-537.564] (-548.034) -- 0:01:26
      23000 -- (-541.112) (-535.336) [-538.662] (-549.979) * (-541.534) [-545.068] (-536.358) (-549.742) -- 0:01:24
      23500 -- (-537.887) (-536.848) [-535.646] (-546.596) * (-546.119) (-551.118) (-536.795) [-544.053] -- 0:01:23
      24000 -- [-537.134] (-541.014) (-536.804) (-539.755) * (-539.816) [-545.858] (-538.411) (-547.278) -- 0:01:21
      24500 -- (-537.753) (-535.444) [-535.720] (-548.432) * (-548.777) [-543.602] (-538.711) (-556.771) -- 0:01:19
      25000 -- (-537.197) (-535.769) (-535.414) [-542.184] * (-547.237) [-540.840] (-538.893) (-545.168) -- 0:01:18

      Average standard deviation of split frequencies: 0.037125

      25500 -- [-537.412] (-535.494) (-537.105) (-541.118) * (-545.146) [-542.221] (-534.745) (-542.090) -- 0:01:16
      26000 -- [-535.955] (-544.498) (-537.998) (-548.870) * (-551.678) [-554.780] (-534.840) (-547.781) -- 0:01:14
      26500 -- [-536.201] (-535.047) (-536.020) (-548.160) * [-545.554] (-541.682) (-535.051) (-546.646) -- 0:01:13
      27000 -- (-536.338) [-534.523] (-536.198) (-541.250) * (-542.275) [-548.464] (-534.846) (-547.479) -- 0:01:12
      27500 -- (-537.585) (-537.308) [-534.848] (-554.039) * (-555.700) [-547.380] (-535.246) (-544.147) -- 0:01:10
      28000 -- (-541.387) (-535.854) [-535.932] (-550.425) * (-549.406) (-546.550) [-537.521] (-545.984) -- 0:01:09
      28500 -- (-535.056) (-538.570) (-536.621) [-544.216] * (-552.544) [-544.153] (-535.487) (-547.337) -- 0:01:08
      29000 -- [-537.675] (-539.738) (-535.944) (-541.624) * (-550.062) (-541.368) [-534.548] (-548.680) -- 0:01:06
      29500 -- [-535.074] (-538.700) (-536.992) (-552.422) * (-537.925) (-542.167) (-537.795) [-543.402] -- 0:01:05
      30000 -- (-535.407) (-536.353) [-534.196] (-546.155) * (-536.174) [-546.884] (-534.836) (-547.236) -- 0:01:04

      Average standard deviation of split frequencies: 0.033306

      30500 -- [-539.147] (-536.280) (-535.212) (-542.980) * (-537.212) [-542.337] (-536.150) (-547.111) -- 0:01:03
      31000 -- (-539.112) (-537.562) (-538.900) [-542.759] * (-535.527) [-549.816] (-534.985) (-545.826) -- 0:01:02
      31500 -- (-536.389) [-536.938] (-540.220) (-543.557) * [-534.826] (-548.717) (-534.706) (-542.690) -- 0:01:01
      32000 -- [-534.726] (-535.530) (-535.599) (-549.491) * [-537.026] (-543.598) (-536.742) (-548.893) -- 0:01:00
      32500 -- (-542.279) (-536.063) (-535.883) [-546.357] * (-535.051) (-543.530) (-535.420) [-550.020] -- 0:00:59
      33000 -- (-535.137) (-535.385) [-534.743] (-554.239) * (-535.869) (-547.279) [-535.397] (-557.176) -- 0:00:58
      33500 -- (-536.216) [-538.373] (-537.200) (-556.731) * (-536.547) (-543.020) [-535.372] (-545.701) -- 0:00:57
      34000 -- (-536.729) (-535.879) [-536.370] (-537.447) * (-539.039) (-542.805) (-538.942) [-544.873] -- 0:00:56
      34500 -- [-534.375] (-536.805) (-538.866) (-539.590) * (-536.085) [-541.379] (-536.208) (-551.797) -- 0:00:55
      35000 -- (-536.902) [-536.871] (-540.530) (-536.129) * (-535.390) (-547.783) (-538.952) [-551.308] -- 0:00:55

      Average standard deviation of split frequencies: 0.035149

      35500 -- (-534.404) (-537.080) [-534.905] (-538.620) * (-539.150) (-546.345) (-538.328) [-543.744] -- 0:00:54
      36000 -- (-536.767) (-535.566) [-537.718] (-535.351) * (-536.289) (-543.054) (-538.849) [-548.077] -- 0:00:53
      36500 -- (-535.467) (-537.750) (-534.831) [-535.857] * (-536.072) (-547.999) [-535.325] (-550.392) -- 0:00:52
      37000 -- (-536.032) (-539.138) [-536.965] (-542.106) * (-536.235) (-546.560) (-539.686) [-546.976] -- 0:00:52
      37500 -- [-535.127] (-539.124) (-536.496) (-538.491) * (-534.961) (-546.234) (-535.566) [-548.375] -- 0:00:51
      38000 -- [-535.040] (-537.415) (-538.143) (-535.362) * (-539.052) [-548.145] (-539.793) (-550.177) -- 0:00:50
      38500 -- [-537.079] (-537.898) (-535.207) (-535.733) * (-536.618) (-541.909) [-538.039] (-548.327) -- 0:00:49
      39000 -- (-537.092) (-538.579) [-536.048] (-536.023) * (-536.567) (-553.546) [-534.695] (-552.590) -- 0:00:49
      39500 -- (-536.554) [-535.913] (-539.267) (-536.340) * (-536.557) [-538.754] (-536.835) (-543.935) -- 0:01:12
      40000 -- [-536.445] (-536.491) (-535.434) (-537.319) * (-537.915) (-543.556) (-534.996) [-544.356] -- 0:01:12

      Average standard deviation of split frequencies: 0.037826

      40500 -- (-534.554) [-538.920] (-534.690) (-536.670) * [-537.854] (-548.852) (-535.338) (-543.791) -- 0:01:11
      41000 -- (-538.366) (-538.854) (-535.860) [-538.790] * [-538.066] (-547.524) (-536.444) (-549.035) -- 0:01:10
      41500 -- (-537.059) [-535.712] (-540.873) (-536.191) * (-535.109) [-543.435] (-538.876) (-545.667) -- 0:01:09
      42000 -- (-538.024) [-537.454] (-538.359) (-536.761) * [-534.972] (-544.891) (-536.588) (-564.639) -- 0:01:08
      42500 -- [-536.112] (-537.049) (-540.137) (-535.642) * (-535.967) (-541.100) (-536.815) [-545.359] -- 0:01:07
      43000 -- [-541.050] (-537.462) (-537.739) (-538.239) * [-538.565] (-542.805) (-535.898) (-548.984) -- 0:01:06
      43500 -- [-535.457] (-536.563) (-536.736) (-540.402) * (-543.626) [-541.157] (-536.969) (-544.009) -- 0:01:05
      44000 -- [-536.641] (-535.120) (-536.916) (-534.810) * (-537.391) (-552.824) (-536.436) [-541.171] -- 0:01:05
      44500 -- (-536.560) [-535.361] (-537.705) (-536.661) * (-539.025) (-547.534) (-536.393) [-544.285] -- 0:01:04
      45000 -- (-535.014) (-540.131) (-535.591) [-535.677] * (-540.350) (-542.214) (-539.143) [-543.743] -- 0:01:03

      Average standard deviation of split frequencies: 0.035355

      45500 -- [-537.805] (-537.954) (-536.881) (-538.484) * [-535.983] (-553.134) (-535.078) (-543.298) -- 0:01:02
      46000 -- (-537.617) [-540.600] (-536.927) (-539.437) * [-537.494] (-546.449) (-535.699) (-552.307) -- 0:01:02
      46500 -- (-536.979) (-540.128) (-537.561) [-535.424] * [-541.192] (-544.098) (-534.963) (-557.136) -- 0:01:01
      47000 -- [-535.384] (-536.803) (-537.284) (-534.860) * (-536.459) (-543.257) [-537.050] (-545.471) -- 0:01:00
      47500 -- (-537.541) (-535.362) (-537.869) [-534.685] * (-540.391) (-543.245) [-537.902] (-543.842) -- 0:01:00
      48000 -- (-538.342) (-535.177) [-534.424] (-538.671) * (-536.280) (-547.726) (-536.945) [-547.189] -- 0:00:59
      48500 -- (-540.313) (-534.625) (-535.766) [-534.759] * (-537.483) (-552.716) [-536.180] (-551.161) -- 0:00:58
      49000 -- (-535.971) [-536.831] (-536.097) (-536.359) * (-537.773) (-550.371) [-534.734] (-540.750) -- 0:00:58
      49500 -- [-534.878] (-535.584) (-535.821) (-536.728) * (-537.809) [-540.840] (-534.531) (-543.522) -- 0:00:57
      50000 -- (-536.987) (-537.100) [-536.915] (-535.049) * (-536.129) (-539.086) [-537.366] (-546.861) -- 0:00:57

      Average standard deviation of split frequencies: 0.036751

      50500 -- (-535.873) (-535.153) (-541.868) [-537.227] * [-535.661] (-541.721) (-539.000) (-545.110) -- 0:00:56
      51000 -- [-534.952] (-539.406) (-535.937) (-535.919) * [-535.346] (-546.030) (-535.096) (-540.990) -- 0:00:55
      51500 -- (-537.970) (-535.841) [-537.476] (-538.557) * (-536.281) (-548.050) (-537.558) [-544.734] -- 0:00:55
      52000 -- (-537.521) [-535.786] (-540.391) (-538.469) * (-538.013) (-545.451) [-535.680] (-544.554) -- 0:00:54
      52500 -- [-534.104] (-534.822) (-536.265) (-534.963) * (-535.322) (-540.237) (-537.556) [-544.821] -- 0:00:54
      53000 -- (-535.651) (-535.933) (-535.459) [-536.164] * (-536.563) [-539.902] (-537.679) (-543.737) -- 0:00:53
      53500 -- (-536.687) [-537.036] (-542.386) (-534.573) * (-535.728) (-545.794) (-537.388) [-554.620] -- 0:00:53
      54000 -- [-539.980] (-535.652) (-541.249) (-538.446) * (-537.996) (-546.314) (-536.656) [-547.660] -- 0:00:52
      54500 -- [-537.097] (-536.666) (-538.025) (-535.462) * [-536.298] (-546.300) (-537.171) (-543.541) -- 0:00:52
      55000 -- (-536.203) [-538.500] (-539.330) (-535.423) * [-536.025] (-562.021) (-534.419) (-544.319) -- 0:00:51

      Average standard deviation of split frequencies: 0.035355

      55500 -- [-535.487] (-537.088) (-535.300) (-535.756) * (-538.437) (-551.197) [-534.747] (-539.320) -- 0:00:51
      56000 -- [-536.074] (-537.121) (-541.916) (-536.701) * [-538.217] (-539.629) (-541.747) (-540.930) -- 0:00:50
      56500 -- (-536.710) (-538.483) (-535.679) [-536.164] * [-534.824] (-537.075) (-538.994) (-541.962) -- 0:01:06
      57000 -- (-538.192) (-540.257) (-535.408) [-535.736] * [-534.801] (-540.757) (-538.076) (-546.953) -- 0:01:06
      57500 -- (-536.056) (-542.373) (-536.524) [-536.789] * (-535.843) (-537.401) (-535.512) [-544.162] -- 0:01:05
      58000 -- (-538.072) [-534.766] (-539.601) (-540.976) * (-536.348) (-536.646) [-535.414] (-542.838) -- 0:01:04
      58500 -- (-535.166) (-535.027) (-536.744) [-539.324] * (-534.868) (-537.660) (-537.097) [-541.218] -- 0:01:04
      59000 -- (-534.826) (-534.507) (-538.275) [-536.030] * (-536.703) (-537.063) [-535.684] (-548.297) -- 0:01:03
      59500 -- [-535.796] (-536.446) (-536.169) (-535.249) * (-537.003) (-535.512) [-536.062] (-542.072) -- 0:01:03
      60000 -- [-535.494] (-536.846) (-534.614) (-536.961) * (-538.670) [-535.303] (-536.885) (-540.126) -- 0:01:02

      Average standard deviation of split frequencies: 0.033413

      60500 -- [-535.532] (-535.735) (-537.101) (-536.404) * (-535.793) (-536.715) (-537.779) [-544.364] -- 0:01:02
      61000 -- (-536.494) (-536.065) (-535.598) [-535.230] * (-537.208) (-535.661) (-535.355) [-542.006] -- 0:01:01
      61500 -- (-534.489) (-535.010) (-536.944) [-535.258] * (-537.942) (-535.373) (-535.553) [-546.500] -- 0:01:01
      62000 -- (-535.789) (-536.043) [-536.339] (-537.160) * (-536.401) [-535.095] (-537.031) (-547.239) -- 0:01:00
      62500 -- (-535.307) (-539.678) (-535.803) [-536.923] * [-537.401] (-534.911) (-537.557) (-543.535) -- 0:01:00
      63000 -- [-535.950] (-540.237) (-537.568) (-535.884) * [-535.145] (-535.291) (-535.373) (-544.103) -- 0:00:59
      63500 -- [-535.686] (-536.665) (-538.486) (-536.595) * (-536.978) (-535.673) (-535.931) [-543.754] -- 0:00:58
      64000 -- (-535.150) (-535.206) (-540.288) [-537.338] * [-535.926] (-534.699) (-535.836) (-540.474) -- 0:00:58
      64500 -- (-534.543) (-538.068) (-534.817) [-535.942] * (-539.650) (-537.688) (-536.531) [-545.886] -- 0:00:58
      65000 -- [-536.272] (-536.077) (-537.439) (-535.829) * (-543.176) (-535.575) [-536.262] (-548.781) -- 0:00:57

      Average standard deviation of split frequencies: 0.024999

      65500 -- (-537.301) (-537.013) [-536.240] (-534.827) * (-540.988) [-538.643] (-536.664) (-548.745) -- 0:00:57
      66000 -- (-539.098) (-537.370) [-537.295] (-535.687) * (-539.532) (-535.556) [-536.809] (-546.619) -- 0:00:56
      66500 -- (-539.247) [-537.422] (-539.855) (-535.450) * (-536.001) (-537.412) (-539.260) [-545.645] -- 0:00:56
      67000 -- [-535.183] (-536.630) (-535.636) (-535.416) * (-539.490) [-538.251] (-537.089) (-547.862) -- 0:00:55
      67500 -- (-535.198) (-538.354) (-534.841) [-535.740] * (-537.654) [-539.758] (-538.331) (-543.049) -- 0:00:55
      68000 -- (-535.663) [-535.652] (-535.921) (-534.681) * [-534.425] (-538.654) (-536.221) (-549.143) -- 0:00:54
      68500 -- (-535.397) (-536.538) [-535.322] (-536.614) * [-536.047] (-535.447) (-540.430) (-557.963) -- 0:00:54
      69000 -- (-538.812) (-536.189) [-536.269] (-537.734) * (-536.793) [-536.369] (-537.666) (-541.898) -- 0:00:53
      69500 -- [-537.469] (-535.987) (-535.860) (-535.913) * (-534.756) [-536.960] (-538.145) (-546.431) -- 0:00:53
      70000 -- (-534.735) (-542.069) [-534.721] (-538.662) * [-536.767] (-535.441) (-538.002) (-541.125) -- 0:00:53

      Average standard deviation of split frequencies: 0.028685

      70500 -- (-536.440) (-536.235) [-535.585] (-535.020) * (-538.789) (-535.124) (-537.620) [-542.533] -- 0:00:52
      71000 -- [-540.115] (-534.960) (-535.628) (-536.557) * (-538.512) (-537.248) (-537.441) [-544.761] -- 0:00:52
      71500 -- (-536.705) [-534.927] (-538.725) (-536.110) * (-537.541) (-536.529) [-536.915] (-548.270) -- 0:00:51
      72000 -- [-539.621] (-535.178) (-537.993) (-534.825) * (-536.134) (-537.433) [-536.755] (-549.705) -- 0:00:51
      72500 -- (-535.615) [-535.461] (-535.152) (-534.894) * [-537.732] (-537.283) (-535.665) (-544.864) -- 0:00:51
      73000 -- (-538.363) (-537.074) (-536.085) [-536.955] * (-535.302) (-537.682) [-535.648] (-538.477) -- 0:01:03
      73500 -- (-536.663) (-537.592) [-538.532] (-537.200) * (-536.493) (-536.921) [-535.560] (-549.455) -- 0:01:03
      74000 -- (-540.966) (-537.517) (-541.111) [-538.956] * [-534.712] (-544.351) (-535.727) (-547.666) -- 0:01:02
      74500 -- [-536.374] (-535.484) (-535.389) (-536.266) * (-537.462) (-537.945) [-534.757] (-543.844) -- 0:01:02
      75000 -- [-534.751] (-539.586) (-535.051) (-535.378) * (-537.676) [-537.359] (-536.488) (-544.878) -- 0:01:01

      Average standard deviation of split frequencies: 0.028946

      75500 -- (-538.999) (-537.789) [-534.324] (-536.672) * (-537.017) [-538.962] (-536.726) (-549.221) -- 0:01:01
      76000 -- (-538.283) (-536.225) [-534.942] (-538.632) * [-536.480] (-539.247) (-534.828) (-547.807) -- 0:01:00
      76500 -- (-536.075) [-536.009] (-542.189) (-535.784) * [-535.077] (-538.135) (-534.813) (-551.975) -- 0:01:00
      77000 -- (-534.899) (-535.390) (-536.775) [-534.073] * (-535.964) [-535.670] (-536.958) (-559.122) -- 0:00:59
      77500 -- (-539.365) (-537.622) [-536.699] (-534.397) * (-539.318) (-537.650) [-536.558] (-543.083) -- 0:00:59
      78000 -- (-534.959) [-536.891] (-534.526) (-535.434) * (-537.360) [-536.817] (-536.142) (-545.204) -- 0:00:59
      78500 -- (-534.601) [-537.683] (-535.885) (-535.266) * (-538.348) (-537.586) (-541.135) [-540.659] -- 0:00:58
      79000 -- [-535.524] (-535.054) (-535.168) (-535.653) * (-538.658) (-539.258) (-537.990) [-546.500] -- 0:00:58
      79500 -- (-536.579) (-539.386) (-538.381) [-535.360] * (-536.647) (-535.473) [-537.920] (-546.217) -- 0:00:57
      80000 -- [-536.057] (-538.074) (-534.943) (-539.423) * (-536.107) [-535.206] (-536.658) (-545.334) -- 0:00:57

      Average standard deviation of split frequencies: 0.028106

      80500 -- [-535.083] (-538.241) (-535.321) (-542.701) * [-535.096] (-538.089) (-536.532) (-541.146) -- 0:00:57
      81000 -- (-538.795) [-536.619] (-536.458) (-536.054) * [-534.289] (-537.454) (-538.261) (-544.374) -- 0:00:56
      81500 -- [-536.262] (-536.537) (-536.879) (-537.392) * (-538.262) [-541.086] (-535.120) (-545.707) -- 0:00:56
      82000 -- (-535.840) [-536.563] (-536.201) (-536.396) * (-539.213) (-538.430) [-538.281] (-550.203) -- 0:00:55
      82500 -- [-536.858] (-538.225) (-534.474) (-535.275) * (-539.747) [-535.958] (-537.780) (-554.024) -- 0:00:55
      83000 -- (-538.661) [-535.397] (-534.485) (-539.810) * (-536.164) [-536.903] (-537.176) (-546.296) -- 0:00:55
      83500 -- (-538.471) [-535.042] (-539.190) (-534.302) * (-537.220) (-535.692) [-536.045] (-546.628) -- 0:00:54
      84000 -- (-538.996) (-538.338) [-536.185] (-539.600) * (-535.678) [-537.346] (-534.812) (-544.959) -- 0:00:54
      84500 -- (-538.765) [-538.094] (-536.091) (-535.620) * (-536.052) (-535.478) [-538.075] (-542.682) -- 0:00:54
      85000 -- [-537.136] (-536.444) (-538.408) (-536.648) * (-536.469) (-535.449) [-536.821] (-541.988) -- 0:00:53

      Average standard deviation of split frequencies: 0.026660

      85500 -- (-539.356) [-535.603] (-535.483) (-536.135) * (-536.204) [-538.735] (-535.539) (-545.372) -- 0:00:53
      86000 -- [-535.805] (-535.275) (-540.128) (-535.975) * (-535.401) [-537.445] (-540.397) (-549.525) -- 0:00:53
      86500 -- (-534.806) [-534.885] (-535.979) (-535.189) * [-536.206] (-536.768) (-536.237) (-542.985) -- 0:00:52
      87000 -- (-536.462) (-535.448) [-535.780] (-536.541) * [-535.152] (-534.433) (-536.254) (-541.839) -- 0:00:52
      87500 -- [-534.896] (-536.012) (-535.927) (-537.223) * (-535.444) (-534.709) [-540.730] (-546.887) -- 0:00:52
      88000 -- (-538.538) (-536.538) [-535.326] (-536.095) * (-536.447) (-536.848) (-539.971) [-542.708] -- 0:00:51
      88500 -- (-536.234) [-534.239] (-536.438) (-537.942) * (-537.897) (-535.561) [-535.279] (-546.345) -- 0:00:51
      89000 -- (-540.892) (-535.978) (-536.844) [-534.154] * [-536.666] (-537.990) (-538.840) (-545.303) -- 0:00:51
      89500 -- [-536.898] (-540.036) (-535.811) (-536.210) * (-536.644) (-540.219) (-535.471) [-544.291] -- 0:00:50
      90000 -- (-536.818) (-535.662) [-540.154] (-538.832) * (-536.620) (-538.210) [-536.706] (-543.925) -- 0:01:00

      Average standard deviation of split frequencies: 0.025217

      90500 -- [-535.449] (-536.072) (-537.664) (-537.138) * (-539.062) [-536.288] (-536.637) (-547.955) -- 0:01:00
      91000 -- (-536.427) [-535.962] (-538.777) (-538.220) * [-535.828] (-535.226) (-539.762) (-546.014) -- 0:00:59
      91500 -- (-535.581) (-535.035) (-537.542) [-541.135] * [-534.479] (-534.385) (-539.762) (-547.814) -- 0:00:59
      92000 -- (-535.034) (-536.229) [-535.865] (-541.938) * (-536.263) [-534.540] (-534.367) (-545.959) -- 0:00:59
      92500 -- (-537.614) (-536.435) [-537.077] (-538.264) * (-535.127) (-534.981) (-535.184) [-542.524] -- 0:00:58
      93000 -- (-537.144) [-534.534] (-538.346) (-537.003) * (-537.017) (-534.837) [-536.430] (-545.465) -- 0:00:58
      93500 -- [-535.938] (-534.610) (-536.332) (-534.768) * (-540.246) [-536.332] (-536.170) (-552.078) -- 0:00:58
      94000 -- (-535.639) (-537.969) (-534.369) [-535.332] * (-540.083) [-536.537] (-537.300) (-549.897) -- 0:00:57
      94500 -- (-540.212) (-539.220) [-536.652] (-535.678) * [-537.398] (-537.328) (-537.499) (-558.415) -- 0:00:57
      95000 -- (-536.899) (-547.009) [-535.098] (-535.816) * (-539.584) [-536.464] (-536.518) (-547.474) -- 0:00:57

      Average standard deviation of split frequencies: 0.027124

      95500 -- (-538.958) [-538.112] (-537.585) (-535.638) * (-537.553) (-535.050) (-536.508) [-537.434] -- 0:00:56
      96000 -- (-535.926) (-536.831) [-538.462] (-536.642) * (-536.453) (-542.420) (-534.803) [-536.960] -- 0:00:56
      96500 -- (-535.924) [-535.928] (-537.006) (-535.534) * [-535.980] (-538.343) (-536.197) (-537.903) -- 0:00:56
      97000 -- (-535.738) (-534.498) [-535.063] (-534.590) * [-536.217] (-537.789) (-539.045) (-537.510) -- 0:00:55
      97500 -- (-535.899) [-536.323] (-535.081) (-537.317) * [-538.451] (-537.607) (-535.618) (-537.685) -- 0:00:55
      98000 -- (-536.271) (-537.588) [-536.516] (-535.884) * (-539.446) (-540.700) (-536.684) [-535.713] -- 0:00:55
      98500 -- (-537.602) (-535.907) (-536.144) [-536.054] * [-539.947] (-540.447) (-539.906) (-535.417) -- 0:00:54
      99000 -- (-534.618) (-538.879) (-534.523) [-538.109] * [-534.832] (-538.614) (-539.190) (-536.385) -- 0:00:54
      99500 -- (-534.289) (-539.195) [-536.266] (-538.435) * (-538.459) (-535.916) (-537.306) [-536.046] -- 0:00:54
      100000 -- [-536.203] (-539.533) (-536.284) (-537.332) * (-537.552) (-537.044) (-540.744) [-537.048] -- 0:00:54

      Average standard deviation of split frequencies: 0.028097

      100500 -- (-538.036) (-542.338) (-537.319) [-535.236] * [-536.256] (-539.115) (-535.825) (-536.611) -- 0:00:53
      101000 -- (-542.365) (-537.727) [-538.458] (-539.096) * (-534.673) [-536.321] (-535.789) (-534.777) -- 0:00:53
      101500 -- (-538.879) [-534.841] (-535.836) (-537.402) * (-535.074) (-535.527) (-535.861) [-538.463] -- 0:00:53
      102000 -- (-536.603) [-534.829] (-538.365) (-537.055) * (-535.385) [-536.011] (-536.703) (-541.402) -- 0:00:52
      102500 -- [-536.579] (-535.708) (-536.259) (-537.437) * (-535.688) (-535.433) [-535.515] (-541.178) -- 0:00:52
      103000 -- (-535.434) (-534.825) (-537.158) [-536.055] * (-541.003) [-534.549] (-535.630) (-538.786) -- 0:00:52
      103500 -- [-534.768] (-535.038) (-541.034) (-536.050) * [-537.337] (-536.091) (-536.037) (-541.210) -- 0:00:51
      104000 -- [-534.044] (-534.743) (-539.785) (-538.460) * (-535.361) [-535.398] (-536.513) (-537.550) -- 0:00:51
      104500 -- (-535.458) [-535.656] (-539.309) (-539.585) * [-536.267] (-535.404) (-539.064) (-536.586) -- 0:00:51
      105000 -- (-542.212) (-534.931) [-538.710] (-538.029) * [-534.849] (-537.118) (-534.961) (-537.957) -- 0:00:51

      Average standard deviation of split frequencies: 0.025268

      105500 -- (-537.146) (-537.025) (-538.556) [-536.518] * (-535.277) (-538.596) (-534.749) [-536.033] -- 0:00:50
      106000 -- [-535.027] (-538.490) (-537.077) (-536.842) * [-535.382] (-534.745) (-536.560) (-535.020) -- 0:00:50
      106500 -- (-536.485) (-536.736) (-542.427) [-535.676] * (-534.885) (-535.671) [-537.653] (-535.455) -- 0:00:50
      107000 -- (-537.702) [-538.449] (-539.148) (-537.301) * (-536.173) [-534.456] (-535.880) (-536.262) -- 0:00:58
      107500 -- [-539.268] (-540.024) (-537.572) (-538.108) * (-538.697) (-536.516) [-535.625] (-536.390) -- 0:00:58
      108000 -- [-536.379] (-535.020) (-535.757) (-537.129) * [-538.436] (-539.683) (-536.306) (-537.037) -- 0:00:57
      108500 -- (-535.906) [-534.299] (-545.227) (-537.769) * (-537.801) (-535.853) (-537.903) [-535.680] -- 0:00:57
      109000 -- (-536.584) (-541.108) (-541.405) [-535.896] * (-536.936) (-539.162) (-540.297) [-534.879] -- 0:00:57
      109500 -- (-535.993) [-534.850] (-536.897) (-539.420) * (-536.284) (-537.264) [-536.103] (-536.875) -- 0:00:56
      110000 -- (-540.371) (-534.693) (-538.196) [-536.063] * (-535.145) (-542.161) (-536.114) [-536.649] -- 0:00:56

      Average standard deviation of split frequencies: 0.024977

      110500 -- [-534.165] (-535.614) (-541.445) (-535.218) * [-535.587] (-536.285) (-536.550) (-535.401) -- 0:00:56
      111000 -- [-535.675] (-534.799) (-537.836) (-537.902) * [-535.158] (-538.413) (-537.605) (-534.357) -- 0:00:56
      111500 -- (-537.438) (-537.569) [-538.746] (-536.472) * [-535.943] (-537.495) (-538.927) (-534.350) -- 0:00:55
      112000 -- [-537.246] (-535.986) (-542.255) (-535.056) * [-535.690] (-535.929) (-535.539) (-536.815) -- 0:00:55
      112500 -- [-538.926] (-535.093) (-538.122) (-538.789) * [-536.692] (-535.199) (-535.472) (-539.057) -- 0:00:55
      113000 -- (-542.021) (-537.807) (-536.082) [-537.018] * (-539.459) (-536.040) [-536.187] (-536.554) -- 0:00:54
      113500 -- (-537.631) [-536.886] (-535.031) (-539.204) * (-536.591) (-535.732) (-536.159) [-534.632] -- 0:00:54
      114000 -- (-537.337) (-535.780) (-535.528) [-536.061] * (-538.211) (-537.714) [-535.769] (-535.688) -- 0:00:54
      114500 -- [-536.837] (-539.557) (-537.028) (-534.873) * (-538.979) [-537.978] (-535.668) (-536.093) -- 0:00:54
      115000 -- (-535.064) (-536.615) [-536.787] (-536.589) * (-536.421) (-536.434) (-535.442) [-537.015] -- 0:00:53

      Average standard deviation of split frequencies: 0.026125

      115500 -- (-538.811) (-535.789) [-538.743] (-535.697) * (-536.439) [-536.647] (-537.769) (-537.224) -- 0:00:53
      116000 -- (-535.010) [-540.734] (-537.087) (-535.759) * [-535.505] (-535.038) (-536.251) (-536.132) -- 0:00:53
      116500 -- (-535.798) [-540.763] (-536.591) (-535.424) * (-539.916) (-534.623) (-537.140) [-537.325] -- 0:00:53
      117000 -- (-534.637) (-538.998) (-534.960) [-534.725] * (-534.702) (-534.401) (-535.607) [-536.400] -- 0:00:52
      117500 -- [-535.544] (-538.412) (-535.904) (-534.573) * (-534.881) (-536.060) (-538.275) [-534.805] -- 0:00:52
      118000 -- (-534.576) (-538.127) [-537.174] (-535.786) * (-535.894) (-537.264) (-536.008) [-539.405] -- 0:00:52
      118500 -- (-540.833) (-537.333) [-538.271] (-541.158) * (-536.492) (-535.990) [-537.013] (-540.780) -- 0:00:52
      119000 -- (-535.751) (-537.488) (-536.332) [-535.832] * [-538.436] (-535.188) (-535.439) (-536.820) -- 0:00:51
      119500 -- (-535.588) [-535.327] (-537.472) (-539.157) * [-537.648] (-534.371) (-535.484) (-534.528) -- 0:00:51
      120000 -- (-536.622) [-535.668] (-535.919) (-536.471) * (-535.662) [-534.414] (-535.125) (-535.052) -- 0:00:51

      Average standard deviation of split frequencies: 0.026975

      120500 -- [-535.788] (-536.269) (-538.713) (-535.949) * (-535.257) (-537.298) (-535.782) [-537.492] -- 0:00:51
      121000 -- (-536.145) (-537.108) [-535.652] (-538.010) * (-537.372) (-534.396) [-534.502] (-536.331) -- 0:00:50
      121500 -- (-535.987) (-534.899) [-537.970] (-541.095) * (-538.038) (-538.989) (-534.887) [-535.441] -- 0:00:50
      122000 -- (-538.571) (-536.493) (-538.125) [-535.560] * (-535.659) [-536.607] (-534.292) (-537.755) -- 0:00:50
      122500 -- (-540.288) (-536.754) [-539.999] (-535.291) * (-542.171) (-540.559) (-535.900) [-536.665] -- 0:00:50
      123000 -- (-538.605) [-536.588] (-535.423) (-536.645) * (-539.294) (-541.528) [-535.009] (-536.116) -- 0:00:49
      123500 -- (-535.542) [-536.513] (-539.397) (-535.584) * (-541.955) (-537.499) (-536.710) [-538.269] -- 0:00:49
      124000 -- [-535.796] (-536.513) (-538.744) (-536.254) * (-537.234) (-537.239) (-535.927) [-537.130] -- 0:00:49
      124500 -- (-535.959) (-537.853) [-535.302] (-537.178) * (-538.192) [-538.513] (-536.181) (-537.846) -- 0:00:56
      125000 -- (-535.467) (-535.386) (-537.060) [-539.503] * (-537.507) (-536.552) (-535.174) [-536.795] -- 0:00:56

      Average standard deviation of split frequencies: 0.026189

      125500 -- [-534.261] (-537.825) (-537.814) (-535.370) * [-538.971] (-536.089) (-538.482) (-541.495) -- 0:00:55
      126000 -- (-535.037) (-537.135) [-536.923] (-535.116) * (-534.957) (-536.626) (-537.103) [-537.942] -- 0:00:55
      126500 -- (-535.185) (-535.964) (-536.585) [-535.021] * (-534.824) (-537.024) (-535.166) [-539.317] -- 0:00:55
      127000 -- [-535.119] (-535.259) (-541.495) (-537.990) * (-534.569) [-535.223] (-536.765) (-542.328) -- 0:00:54
      127500 -- (-534.452) (-536.705) [-543.359] (-538.659) * (-536.780) [-534.444] (-537.482) (-541.479) -- 0:00:54
      128000 -- [-536.714] (-539.474) (-535.619) (-536.726) * (-537.951) [-534.740] (-536.779) (-536.905) -- 0:00:54
      128500 -- (-536.849) [-537.511] (-534.730) (-537.935) * [-537.080] (-536.218) (-536.631) (-535.033) -- 0:00:54
      129000 -- (-541.821) (-539.236) [-535.421] (-535.361) * (-536.038) (-539.848) (-537.338) [-538.655] -- 0:00:54
      129500 -- (-537.413) (-541.583) (-538.776) [-535.039] * [-535.343] (-535.701) (-536.070) (-538.120) -- 0:00:53
      130000 -- (-535.968) (-541.019) (-537.702) [-538.018] * (-535.285) (-539.654) (-536.114) [-537.382] -- 0:00:53

      Average standard deviation of split frequencies: 0.027058

      130500 -- (-538.505) (-535.510) [-540.403] (-535.076) * (-535.192) (-535.981) [-536.943] (-534.540) -- 0:00:53
      131000 -- (-535.936) [-534.991] (-536.013) (-534.608) * (-535.461) [-536.924] (-537.847) (-534.327) -- 0:00:53
      131500 -- [-535.798] (-536.584) (-535.056) (-536.847) * (-534.937) [-537.775] (-536.441) (-536.541) -- 0:00:52
      132000 -- (-535.268) (-536.134) [-537.134] (-537.070) * (-536.243) [-537.270] (-536.762) (-537.005) -- 0:00:52
      132500 -- [-538.017] (-538.500) (-535.708) (-537.235) * (-538.746) [-536.521] (-535.768) (-541.656) -- 0:00:52
      133000 -- [-538.095] (-536.417) (-536.873) (-535.501) * (-538.056) (-536.507) (-538.287) [-535.022] -- 0:00:52
      133500 -- (-537.072) [-536.453] (-534.239) (-536.052) * (-538.188) (-538.511) [-535.627] (-537.149) -- 0:00:51
      134000 -- (-535.070) (-538.777) [-537.157] (-535.883) * [-540.232] (-536.973) (-535.182) (-536.187) -- 0:00:51
      134500 -- [-534.926] (-535.641) (-539.973) (-535.333) * (-543.048) (-535.593) (-537.386) [-536.180] -- 0:00:51
      135000 -- (-537.185) (-539.885) [-539.610] (-534.496) * (-545.044) (-535.358) (-536.235) [-536.754] -- 0:00:51

      Average standard deviation of split frequencies: 0.026784

      135500 -- (-537.886) (-536.921) (-536.059) [-535.138] * (-538.627) (-536.549) [-536.903] (-535.292) -- 0:00:51
      136000 -- (-535.673) (-535.414) [-536.052] (-538.977) * (-535.130) (-536.381) (-536.080) [-536.376] -- 0:00:50
      136500 -- (-535.119) (-538.916) [-534.182] (-541.566) * (-535.104) (-537.132) (-536.791) [-535.030] -- 0:00:50
      137000 -- (-534.766) (-536.638) [-535.331] (-537.831) * (-536.415) (-536.365) (-538.771) [-534.544] -- 0:00:50
      137500 -- (-537.580) [-534.652] (-534.464) (-536.665) * (-534.206) (-536.759) [-535.967] (-537.025) -- 0:00:50
      138000 -- (-537.291) (-537.851) (-536.994) [-536.334] * (-537.853) (-536.895) (-537.094) [-535.988] -- 0:00:49
      138500 -- (-539.352) (-535.242) [-535.358] (-535.283) * [-536.355] (-536.123) (-534.570) (-538.334) -- 0:00:49
      139000 -- [-536.509] (-536.783) (-535.399) (-535.852) * (-534.662) [-536.204] (-535.447) (-536.820) -- 0:00:49
      139500 -- (-535.961) [-535.487] (-535.160) (-535.490) * (-540.697) [-534.107] (-535.339) (-537.812) -- 0:00:49
      140000 -- (-538.818) (-537.635) [-536.395] (-538.000) * (-538.346) (-535.838) [-536.128] (-536.733) -- 0:00:49

      Average standard deviation of split frequencies: 0.025134

      140500 -- (-537.232) (-536.079) [-538.958] (-537.184) * (-536.639) (-535.152) [-536.613] (-536.251) -- 0:00:48
      141000 -- (-536.823) (-538.163) (-536.307) [-537.273] * [-537.874] (-537.167) (-538.712) (-535.822) -- 0:00:54
      141500 -- [-537.329] (-536.810) (-539.502) (-537.324) * (-536.428) (-541.224) [-537.793] (-537.278) -- 0:00:54
      142000 -- (-536.759) [-535.959] (-537.272) (-537.176) * (-538.994) (-538.280) [-537.664] (-536.341) -- 0:00:54
      142500 -- (-540.424) (-537.781) [-535.476] (-535.868) * (-543.919) (-537.845) [-537.419] (-535.985) -- 0:00:54
      143000 -- [-534.599] (-536.235) (-535.934) (-536.676) * (-535.422) [-534.838] (-538.044) (-535.714) -- 0:00:53
      143500 -- (-536.154) (-537.376) [-538.644] (-536.472) * (-536.610) (-534.633) [-535.379] (-534.892) -- 0:00:53
      144000 -- (-537.837) (-536.094) [-536.028] (-535.038) * (-537.510) (-535.535) (-537.404) [-534.943] -- 0:00:53
      144500 -- [-535.060] (-534.997) (-535.540) (-534.831) * (-538.668) [-535.924] (-541.698) (-535.614) -- 0:00:53
      145000 -- (-536.440) [-535.358] (-536.865) (-536.586) * (-541.136) (-534.820) [-535.350] (-535.677) -- 0:00:53

      Average standard deviation of split frequencies: 0.023482

      145500 -- [-537.096] (-536.042) (-535.590) (-536.226) * [-537.449] (-535.755) (-534.745) (-535.459) -- 0:00:52
      146000 -- [-537.245] (-539.365) (-535.809) (-536.576) * (-535.508) [-536.267] (-534.579) (-538.397) -- 0:00:52
      146500 -- (-536.762) [-536.465] (-535.634) (-535.666) * (-535.798) (-537.520) [-535.685] (-536.155) -- 0:00:52
      147000 -- (-537.355) [-536.815] (-536.695) (-535.917) * [-536.056] (-535.411) (-536.184) (-537.693) -- 0:00:52
      147500 -- (-535.616) (-535.502) (-535.071) [-538.155] * (-537.444) (-536.757) (-535.671) [-536.216] -- 0:00:52
      148000 -- (-536.154) [-534.454] (-535.845) (-538.824) * (-535.367) (-535.286) [-539.627] (-538.400) -- 0:00:51
      148500 -- (-535.275) [-535.721] (-535.425) (-535.398) * [-537.416] (-535.953) (-538.802) (-540.158) -- 0:00:51
      149000 -- [-534.456] (-540.628) (-535.867) (-536.924) * [-537.620] (-535.370) (-534.712) (-536.457) -- 0:00:51
      149500 -- (-537.358) [-535.822] (-536.336) (-535.535) * (-535.980) [-535.280] (-536.037) (-538.784) -- 0:00:51
      150000 -- (-536.057) (-536.018) (-536.873) [-535.883] * [-537.059] (-535.968) (-536.760) (-537.045) -- 0:00:51

      Average standard deviation of split frequencies: 0.023466

      150500 -- (-537.188) (-535.868) [-536.679] (-535.784) * (-537.449) (-542.663) (-536.659) [-537.100] -- 0:00:50
      151000 -- [-536.811] (-535.139) (-535.600) (-537.885) * (-537.078) (-536.577) (-538.647) [-537.975] -- 0:00:50
      151500 -- (-536.474) (-536.084) [-537.302] (-538.258) * (-537.173) (-538.135) (-537.766) [-538.795] -- 0:00:50
      152000 -- [-537.991] (-536.463) (-534.723) (-535.643) * (-541.126) [-534.964] (-536.258) (-537.729) -- 0:00:50
      152500 -- [-536.737] (-537.171) (-541.102) (-535.022) * (-536.636) (-535.789) (-535.014) [-538.663] -- 0:00:50
      153000 -- (-536.844) (-535.940) (-534.660) [-535.023] * (-535.303) [-535.929] (-535.803) (-534.458) -- 0:00:49
      153500 -- (-535.932) (-536.945) (-535.770) [-535.962] * (-535.810) [-535.463] (-535.721) (-534.284) -- 0:00:49
      154000 -- (-535.633) (-535.992) (-538.136) [-535.393] * (-534.658) (-535.260) [-535.359] (-534.740) -- 0:00:49
      154500 -- (-539.713) (-536.939) (-535.164) [-535.826] * [-534.630] (-538.259) (-536.212) (-534.922) -- 0:00:49
      155000 -- [-536.033] (-536.705) (-534.696) (-534.568) * (-538.152) (-540.039) [-536.928] (-536.536) -- 0:00:49

      Average standard deviation of split frequencies: 0.021702

      155500 -- (-538.971) (-535.478) [-535.678] (-537.790) * (-537.115) (-536.117) [-536.631] (-536.998) -- 0:00:48
      156000 -- (-535.298) [-534.917] (-535.148) (-537.612) * (-535.033) (-536.914) (-538.675) [-535.693] -- 0:00:48
      156500 -- [-535.188] (-534.986) (-538.789) (-535.599) * (-535.729) (-536.781) (-536.011) [-534.653] -- 0:00:48
      157000 -- (-534.234) [-534.518] (-536.319) (-535.517) * (-536.607) [-536.094] (-538.223) (-534.689) -- 0:00:48
      157500 -- [-535.642] (-536.074) (-537.502) (-534.572) * (-535.225) (-536.759) (-538.429) [-535.251] -- 0:00:53
      158000 -- (-535.160) (-539.234) (-535.456) [-538.586] * [-534.321] (-535.704) (-538.180) (-536.368) -- 0:00:53
      158500 -- (-537.166) (-537.322) (-537.870) [-534.229] * (-539.604) (-535.001) [-537.028] (-538.139) -- 0:00:53
      159000 -- [-535.979] (-539.920) (-535.472) (-537.831) * (-534.859) (-538.818) [-535.462] (-534.893) -- 0:00:52
      159500 -- [-536.976] (-540.642) (-539.294) (-537.160) * (-535.320) (-536.038) (-535.205) [-535.819] -- 0:00:52
      160000 -- (-541.769) [-538.582] (-537.576) (-536.112) * [-536.918] (-538.123) (-535.759) (-536.044) -- 0:00:52

      Average standard deviation of split frequencies: 0.021377

      160500 -- (-535.755) (-539.578) [-535.916] (-536.048) * (-534.490) (-536.206) [-536.686] (-534.372) -- 0:00:52
      161000 -- (-536.418) (-537.101) [-535.842] (-535.254) * (-535.092) (-539.310) (-537.950) [-534.541] -- 0:00:52
      161500 -- (-536.900) (-535.728) [-534.930] (-536.825) * (-535.797) [-534.480] (-538.770) (-535.584) -- 0:00:51
      162000 -- [-538.551] (-538.172) (-535.449) (-535.741) * [-535.840] (-534.886) (-535.384) (-536.981) -- 0:00:51
      162500 -- (-536.486) [-535.888] (-542.086) (-537.110) * [-536.205] (-535.065) (-544.684) (-537.244) -- 0:00:51
      163000 -- (-534.785) [-537.077] (-536.526) (-536.276) * (-537.270) [-535.051] (-538.649) (-536.174) -- 0:00:51
      163500 -- (-535.449) (-535.048) (-535.973) [-534.752] * (-541.088) (-535.094) (-541.087) [-536.474] -- 0:00:51
      164000 -- (-534.615) [-536.940] (-537.453) (-535.665) * [-539.405] (-536.303) (-541.996) (-536.309) -- 0:00:50
      164500 -- (-535.486) (-535.666) (-534.532) [-535.726] * [-537.148] (-538.417) (-536.525) (-537.693) -- 0:00:50
      165000 -- (-535.352) [-537.555] (-538.908) (-536.169) * (-537.239) (-535.998) (-536.115) [-536.570] -- 0:00:50

      Average standard deviation of split frequencies: 0.021686

      165500 -- (-537.112) [-535.076] (-538.667) (-540.204) * [-536.231] (-537.099) (-535.334) (-536.645) -- 0:00:50
      166000 -- (-536.896) (-536.236) (-534.623) [-535.404] * (-537.057) [-535.965] (-537.043) (-537.588) -- 0:00:50
      166500 -- [-538.103] (-541.766) (-543.838) (-536.457) * (-536.377) [-538.617] (-539.464) (-534.188) -- 0:00:50
      167000 -- [-536.608] (-541.363) (-538.571) (-537.446) * [-538.359] (-538.493) (-538.447) (-534.738) -- 0:00:49
      167500 -- (-536.075) (-537.261) [-535.202] (-535.400) * (-538.823) (-537.527) (-539.960) [-534.644] -- 0:00:49
      168000 -- (-535.637) [-538.206] (-535.523) (-540.369) * (-535.426) (-535.326) [-536.360] (-534.201) -- 0:00:49
      168500 -- (-536.379) (-537.003) (-536.148) [-537.523] * (-539.552) (-535.918) (-535.712) [-535.811] -- 0:00:49
      169000 -- (-535.279) (-534.452) [-537.618] (-535.864) * [-536.091] (-535.293) (-538.093) (-536.733) -- 0:00:49
      169500 -- [-536.058] (-535.506) (-535.647) (-538.259) * (-542.355) (-537.452) (-539.046) [-539.186] -- 0:00:48
      170000 -- [-534.927] (-535.872) (-534.990) (-535.459) * (-535.415) (-536.155) [-539.797] (-538.355) -- 0:00:48

      Average standard deviation of split frequencies: 0.022348

      170500 -- (-536.700) (-540.011) (-534.806) [-537.213] * [-535.906] (-537.023) (-536.278) (-538.274) -- 0:00:48
      171000 -- (-538.815) (-536.546) (-535.501) [-537.643] * (-534.541) (-536.916) (-536.817) [-538.545] -- 0:00:48
      171500 -- (-535.195) (-535.427) (-536.752) [-536.440] * (-535.102) (-538.777) (-537.434) [-535.036] -- 0:00:48
      172000 -- (-534.571) [-536.540] (-537.740) (-534.783) * [-536.909] (-537.660) (-537.708) (-534.938) -- 0:00:48
      172500 -- [-536.004] (-537.022) (-535.163) (-535.482) * (-538.108) [-536.625] (-537.494) (-535.100) -- 0:00:47
      173000 -- [-536.849] (-537.226) (-535.693) (-534.404) * (-535.633) (-538.597) (-537.088) [-534.239] -- 0:00:47
      173500 -- (-538.970) [-534.517] (-536.331) (-536.860) * [-535.536] (-537.193) (-535.711) (-536.885) -- 0:00:47
      174000 -- (-541.256) [-538.931] (-538.642) (-536.051) * (-543.118) [-536.829] (-536.616) (-539.138) -- 0:00:52
      174500 -- (-537.685) (-534.877) [-536.541] (-535.574) * [-535.966] (-539.587) (-538.189) (-537.646) -- 0:00:52
      175000 -- (-538.487) (-537.111) (-535.332) [-535.709] * (-538.902) (-541.142) [-534.702] (-537.367) -- 0:00:51

      Average standard deviation of split frequencies: 0.021427

      175500 -- (-535.640) (-536.383) (-535.933) [-535.120] * (-535.746) (-534.340) (-535.928) [-537.217] -- 0:00:51
      176000 -- (-538.995) (-537.629) (-536.885) [-537.457] * (-537.023) (-534.694) (-535.372) [-536.082] -- 0:00:51
      176500 -- (-535.965) [-538.071] (-536.696) (-534.841) * (-537.162) (-536.020) [-536.378] (-534.436) -- 0:00:51
      177000 -- [-534.891] (-536.003) (-534.280) (-536.527) * [-537.135] (-536.478) (-538.327) (-536.984) -- 0:00:51
      177500 -- (-538.802) [-540.243] (-536.460) (-538.032) * [-534.968] (-535.415) (-538.054) (-536.294) -- 0:00:50
      178000 -- (-537.075) [-538.853] (-535.109) (-537.975) * [-534.583] (-535.840) (-538.121) (-535.597) -- 0:00:50
      178500 -- (-538.008) [-535.294] (-536.054) (-536.191) * (-535.746) (-535.477) (-538.861) [-539.736] -- 0:00:50
      179000 -- (-535.818) [-534.398] (-535.444) (-537.885) * [-534.461] (-535.666) (-534.475) (-535.919) -- 0:00:50
      179500 -- (-535.418) [-535.845] (-538.446) (-536.644) * (-537.785) [-539.503] (-535.518) (-539.155) -- 0:00:50
      180000 -- (-534.458) (-537.670) [-537.629] (-536.229) * [-534.843] (-536.355) (-535.036) (-536.305) -- 0:00:50

      Average standard deviation of split frequencies: 0.019178

      180500 -- (-535.176) [-535.422] (-538.047) (-534.664) * (-536.986) [-536.472] (-534.540) (-536.612) -- 0:00:49
      181000 -- (-537.859) (-534.836) (-538.100) [-534.900] * (-537.112) [-535.114] (-537.978) (-535.750) -- 0:00:49
      181500 -- (-537.599) [-534.906] (-534.610) (-536.694) * (-537.618) (-536.543) (-537.324) [-536.913] -- 0:00:49
      182000 -- (-536.173) (-537.638) (-537.872) [-536.095] * (-535.548) (-536.197) [-536.079] (-535.127) -- 0:00:49
      182500 -- (-534.972) (-538.151) (-538.547) [-535.201] * [-538.280] (-535.020) (-537.324) (-537.752) -- 0:00:49
      183000 -- (-535.032) (-534.743) (-537.693) [-535.915] * (-535.038) (-535.204) [-535.220] (-536.486) -- 0:00:49
      183500 -- (-535.433) [-534.846] (-536.944) (-537.884) * [-535.587] (-535.989) (-536.332) (-535.418) -- 0:00:48
      184000 -- [-535.312] (-536.104) (-536.684) (-538.930) * (-539.089) (-535.588) (-537.612) [-537.985] -- 0:00:48
      184500 -- (-540.416) (-535.712) (-538.397) [-535.224] * (-536.632) (-536.856) (-536.452) [-539.011] -- 0:00:48
      185000 -- (-538.704) (-536.398) [-535.583] (-535.765) * (-535.559) (-535.093) [-535.959] (-538.248) -- 0:00:48

      Average standard deviation of split frequencies: 0.018224

      185500 -- [-536.722] (-536.224) (-542.292) (-538.594) * (-535.544) (-535.914) [-536.117] (-538.812) -- 0:00:48
      186000 -- (-535.840) (-541.712) (-542.524) [-536.637] * (-536.784) [-538.461] (-535.499) (-535.313) -- 0:00:48
      186500 -- (-538.080) [-537.838] (-540.391) (-539.032) * (-534.563) (-537.089) [-536.078] (-537.356) -- 0:00:47
      187000 -- [-537.539] (-537.144) (-536.386) (-536.881) * (-537.761) [-535.235] (-534.815) (-537.203) -- 0:00:47
      187500 -- [-535.941] (-536.468) (-534.992) (-536.486) * (-536.092) (-534.787) (-535.579) [-535.825] -- 0:00:47
      188000 -- (-538.593) (-535.624) (-535.761) [-535.249] * (-535.550) (-535.307) [-538.812] (-536.771) -- 0:00:47
      188500 -- [-539.592] (-540.837) (-536.880) (-536.040) * [-536.101] (-535.010) (-536.408) (-538.087) -- 0:00:47
      189000 -- [-538.045] (-537.159) (-536.174) (-538.457) * (-534.947) (-536.061) [-536.247] (-536.697) -- 0:00:47
      189500 -- (-536.273) (-537.021) (-536.911) [-539.010] * [-536.026] (-535.329) (-537.290) (-538.278) -- 0:00:47
      190000 -- [-536.269] (-540.256) (-538.082) (-538.270) * (-538.552) (-537.203) [-536.295] (-536.476) -- 0:00:46

      Average standard deviation of split frequencies: 0.016247

      190500 -- (-537.355) [-537.438] (-543.383) (-539.291) * [-536.127] (-537.176) (-534.934) (-536.403) -- 0:00:50
      191000 -- (-534.356) [-538.025] (-536.785) (-538.957) * (-536.745) (-541.525) [-536.173] (-537.338) -- 0:00:50
      191500 -- (-535.204) (-538.745) [-535.538] (-535.742) * (-535.447) [-539.249] (-540.182) (-536.703) -- 0:00:50
      192000 -- (-534.365) (-535.160) [-535.541] (-536.917) * [-536.306] (-537.892) (-537.854) (-535.968) -- 0:00:50
      192500 -- (-535.983) (-537.439) (-536.772) [-536.151] * (-534.769) [-536.603] (-536.064) (-536.419) -- 0:00:50
      193000 -- [-537.084] (-534.567) (-536.987) (-537.765) * (-536.609) (-537.072) [-538.357] (-537.567) -- 0:00:50
      193500 -- (-537.742) (-536.272) (-540.196) [-538.022] * (-537.983) [-537.118] (-535.599) (-535.362) -- 0:00:50
      194000 -- (-535.709) [-537.272] (-538.245) (-537.491) * (-538.193) (-536.955) (-536.096) [-536.660] -- 0:00:49
      194500 -- (-538.822) (-536.745) [-535.768] (-536.808) * [-537.404] (-536.866) (-537.070) (-534.318) -- 0:00:49
      195000 -- (-536.355) (-534.997) (-539.099) [-535.643] * (-534.706) (-535.713) [-536.984] (-536.463) -- 0:00:49

      Average standard deviation of split frequencies: 0.015347

      195500 -- (-540.629) (-537.411) [-535.590] (-537.594) * [-536.594] (-534.615) (-538.820) (-537.040) -- 0:00:49
      196000 -- [-534.874] (-538.828) (-537.407) (-537.287) * (-537.748) [-534.084] (-535.464) (-537.302) -- 0:00:49
      196500 -- [-535.869] (-538.988) (-538.098) (-538.223) * (-537.293) [-534.733] (-537.235) (-534.976) -- 0:00:49
      197000 -- (-535.332) (-536.526) (-535.472) [-538.278] * (-538.276) [-535.503] (-541.068) (-537.458) -- 0:00:48
      197500 -- (-537.947) (-536.569) [-539.194] (-543.684) * [-538.647] (-537.120) (-536.012) (-536.915) -- 0:00:48
      198000 -- [-534.564] (-537.038) (-535.354) (-545.438) * [-536.102] (-535.000) (-535.356) (-537.111) -- 0:00:48
      198500 -- [-534.132] (-536.066) (-538.508) (-538.725) * (-534.985) (-535.014) [-540.969] (-538.227) -- 0:00:48
      199000 -- (-536.751) (-537.472) [-536.003] (-536.325) * [-538.908] (-535.462) (-536.870) (-536.770) -- 0:00:48
      199500 -- (-536.738) (-535.812) (-537.148) [-535.377] * [-538.497] (-536.884) (-539.354) (-538.633) -- 0:00:48
      200000 -- (-535.973) [-538.271] (-536.208) (-534.430) * [-536.053] (-536.634) (-535.088) (-542.391) -- 0:00:48

      Average standard deviation of split frequencies: 0.014917

      200500 -- [-536.762] (-536.928) (-536.311) (-534.879) * (-537.177) (-539.810) (-534.157) [-535.703] -- 0:00:47
      201000 -- (-535.261) [-536.363] (-538.241) (-535.732) * [-537.089] (-543.396) (-540.306) (-537.907) -- 0:00:47
      201500 -- (-536.308) (-536.235) (-537.404) [-535.547] * [-537.528] (-542.989) (-537.059) (-537.984) -- 0:00:47
      202000 -- [-534.364] (-536.708) (-536.439) (-536.433) * [-537.563] (-536.439) (-534.772) (-539.179) -- 0:00:47
      202500 -- (-535.187) [-536.167] (-537.997) (-538.008) * (-535.838) (-537.389) (-535.595) [-535.824] -- 0:00:47
      203000 -- (-539.737) (-537.552) [-538.112] (-541.630) * (-538.300) (-536.193) (-539.573) [-535.063] -- 0:00:47
      203500 -- [-538.240] (-537.195) (-535.164) (-539.316) * (-535.574) (-536.127) (-540.182) [-535.619] -- 0:00:46
      204000 -- [-535.131] (-537.892) (-536.264) (-535.659) * (-538.170) (-534.929) (-536.975) [-534.966] -- 0:00:46
      204500 -- (-537.262) (-537.126) [-537.355] (-543.464) * [-536.281] (-534.989) (-535.647) (-537.862) -- 0:00:46
      205000 -- (-534.847) (-540.398) [-536.401] (-539.095) * (-539.519) (-535.051) (-537.115) [-535.960] -- 0:00:46

      Average standard deviation of split frequencies: 0.013730

      205500 -- (-537.875) (-536.860) [-535.217] (-535.242) * [-537.679] (-534.875) (-536.382) (-537.439) -- 0:00:46
      206000 -- (-535.694) [-537.922] (-537.394) (-537.458) * (-542.428) (-536.419) [-536.270] (-536.597) -- 0:00:50
      206500 -- (-537.357) [-538.157] (-534.526) (-544.244) * (-538.892) (-537.430) (-534.588) [-535.660] -- 0:00:49
      207000 -- (-537.437) [-536.356] (-539.970) (-537.631) * (-537.515) (-536.816) (-535.713) [-535.254] -- 0:00:49
      207500 -- [-539.577] (-535.862) (-536.431) (-538.881) * (-534.511) (-535.988) (-542.504) [-534.965] -- 0:00:49
      208000 -- [-535.424] (-534.252) (-537.727) (-538.030) * (-536.555) (-538.959) (-538.900) [-535.188] -- 0:00:49
      208500 -- [-536.779] (-537.712) (-535.453) (-536.702) * (-535.918) [-535.552] (-538.233) (-542.486) -- 0:00:49
      209000 -- (-538.041) [-539.300] (-536.820) (-537.178) * (-536.327) [-535.130] (-537.029) (-536.327) -- 0:00:49
      209500 -- (-538.224) (-540.250) (-537.531) [-537.932] * (-535.675) (-539.948) [-536.855] (-538.613) -- 0:00:49
      210000 -- (-534.888) [-539.612] (-537.672) (-539.659) * [-542.669] (-540.118) (-537.005) (-538.267) -- 0:00:48

      Average standard deviation of split frequencies: 0.014321

      210500 -- (-536.591) (-537.414) [-537.487] (-538.197) * (-540.945) (-537.160) [-537.886] (-535.438) -- 0:00:48
      211000 -- (-545.627) (-536.976) (-538.550) [-537.770] * (-538.506) (-535.993) (-537.734) [-537.334] -- 0:00:48
      211500 -- (-537.301) [-534.618] (-536.169) (-539.969) * (-537.938) (-535.464) (-534.874) [-536.193] -- 0:00:48
      212000 -- (-536.500) [-535.084] (-534.850) (-538.687) * (-539.940) [-535.248] (-535.482) (-537.281) -- 0:00:48
      212500 -- (-534.708) (-535.789) (-534.433) [-536.026] * (-544.317) [-534.449] (-535.926) (-539.132) -- 0:00:48
      213000 -- (-541.442) [-535.568] (-539.217) (-538.978) * [-540.177] (-537.487) (-537.985) (-545.355) -- 0:00:48
      213500 -- (-542.309) (-535.617) [-538.591] (-535.940) * (-538.378) (-537.257) [-534.716] (-539.343) -- 0:00:47
      214000 -- (-538.346) (-536.738) (-536.872) [-535.696] * (-544.816) (-540.549) (-534.805) [-541.186] -- 0:00:47
      214500 -- (-535.512) [-535.294] (-536.734) (-536.517) * (-541.188) [-537.620] (-536.084) (-537.077) -- 0:00:47
      215000 -- (-542.991) (-536.896) (-536.495) [-537.444] * (-534.391) (-537.541) (-537.049) [-536.578] -- 0:00:47

      Average standard deviation of split frequencies: 0.015059

      215500 -- [-537.098] (-539.666) (-538.358) (-534.725) * (-538.885) [-537.051] (-537.117) (-538.905) -- 0:00:47
      216000 -- (-536.240) (-535.827) (-539.313) [-537.104] * [-538.029] (-537.968) (-541.122) (-535.145) -- 0:00:47
      216500 -- (-538.275) (-535.557) (-536.402) [-536.861] * (-535.810) (-535.985) (-540.571) [-535.144] -- 0:00:47
      217000 -- (-535.452) [-537.377] (-537.034) (-536.742) * (-535.779) (-537.069) [-534.555] (-535.568) -- 0:00:46
      217500 -- (-534.734) (-539.162) [-539.728] (-534.750) * (-535.079) (-537.892) [-534.181] (-537.788) -- 0:00:46
      218000 -- (-534.527) (-536.228) [-536.059] (-535.891) * (-535.000) (-538.242) [-535.493] (-538.410) -- 0:00:46
      218500 -- [-536.580] (-535.482) (-537.692) (-539.945) * [-534.802] (-536.070) (-536.056) (-538.200) -- 0:00:46
      219000 -- [-534.837] (-536.150) (-540.887) (-542.255) * (-535.119) [-536.333] (-536.336) (-541.773) -- 0:00:46
      219500 -- [-536.151] (-536.292) (-536.178) (-539.661) * (-537.273) (-535.451) [-538.554] (-538.600) -- 0:00:46
      220000 -- [-537.902] (-540.571) (-535.690) (-537.793) * (-537.068) (-535.608) [-536.365] (-535.122) -- 0:00:46

      Average standard deviation of split frequencies: 0.014167

      220500 -- (-536.734) [-536.132] (-537.492) (-539.076) * (-536.493) [-534.630] (-536.531) (-535.220) -- 0:00:45
      221000 -- [-536.743] (-539.118) (-535.372) (-536.897) * (-537.129) (-534.901) [-537.871] (-535.790) -- 0:00:45
      221500 -- (-536.714) [-536.246] (-536.739) (-537.551) * (-535.997) (-535.580) [-539.152] (-535.727) -- 0:00:45
      222000 -- (-534.927) (-536.592) [-537.386] (-535.692) * (-536.138) (-536.825) (-540.431) [-535.428] -- 0:00:45
      222500 -- (-535.474) (-536.563) (-534.972) [-537.294] * (-535.200) [-536.719] (-536.871) (-535.748) -- 0:00:45
      223000 -- [-538.143] (-536.451) (-542.613) (-539.794) * (-535.575) [-535.221] (-537.630) (-535.239) -- 0:00:48
      223500 -- (-535.474) (-536.362) (-538.785) [-535.368] * (-537.028) (-539.772) [-538.865] (-536.925) -- 0:00:48
      224000 -- (-535.364) [-536.413] (-538.191) (-535.446) * (-535.106) (-538.166) [-539.239] (-535.014) -- 0:00:48
      224500 -- (-534.654) [-536.265] (-536.104) (-534.934) * (-536.914) [-535.638] (-536.978) (-537.947) -- 0:00:48
      225000 -- (-537.052) (-536.635) (-535.067) [-536.351] * (-534.860) (-535.366) [-537.082] (-536.318) -- 0:00:48

      Average standard deviation of split frequencies: 0.014705

      225500 -- [-536.648] (-536.603) (-535.789) (-539.175) * (-536.480) (-538.946) [-535.214] (-535.103) -- 0:00:48
      226000 -- [-538.222] (-539.442) (-536.628) (-536.230) * (-535.817) (-542.363) (-537.743) [-535.145] -- 0:00:47
      226500 -- (-536.740) (-535.668) (-537.819) [-537.862] * [-534.632] (-542.591) (-538.370) (-535.333) -- 0:00:47
      227000 -- [-535.903] (-535.947) (-535.069) (-534.926) * [-536.050] (-536.121) (-536.808) (-535.694) -- 0:00:47
      227500 -- (-540.155) (-535.603) [-535.761] (-536.255) * (-538.856) (-539.351) [-537.221] (-536.714) -- 0:00:47
      228000 -- (-534.992) (-536.075) (-536.530) [-535.431] * (-535.914) [-535.775] (-539.059) (-537.359) -- 0:00:47
      228500 -- (-534.115) (-535.155) (-537.675) [-534.653] * [-537.254] (-536.077) (-537.267) (-537.012) -- 0:00:47
      229000 -- (-537.834) (-537.122) (-541.423) [-534.431] * (-539.621) (-539.594) [-537.423] (-540.724) -- 0:00:47
      229500 -- (-542.167) (-535.822) (-536.802) [-537.473] * (-537.670) [-538.623] (-535.966) (-540.869) -- 0:00:47
      230000 -- (-537.242) [-535.465] (-536.778) (-536.941) * (-539.134) (-536.290) (-537.810) [-534.686] -- 0:00:46

      Average standard deviation of split frequencies: 0.014521

      230500 -- [-535.874] (-534.910) (-534.876) (-537.431) * [-539.864] (-536.430) (-537.558) (-536.127) -- 0:00:46
      231000 -- (-538.653) (-535.615) (-537.132) [-534.577] * (-540.606) [-536.317] (-536.792) (-539.081) -- 0:00:46
      231500 -- [-536.169] (-535.717) (-538.367) (-534.853) * (-535.239) (-537.918) (-538.648) [-536.119] -- 0:00:46
      232000 -- (-536.970) (-536.354) [-535.098] (-537.445) * (-535.686) (-537.684) (-535.198) [-535.105] -- 0:00:46
      232500 -- (-536.404) [-534.980] (-539.251) (-534.748) * (-535.672) [-535.459] (-535.908) (-534.923) -- 0:00:46
      233000 -- (-538.701) (-536.381) (-536.674) [-534.899] * (-535.368) [-540.073] (-537.590) (-539.795) -- 0:00:46
      233500 -- (-540.224) (-538.051) [-536.756] (-535.695) * (-536.114) (-536.579) (-536.225) [-535.400] -- 0:00:45
      234000 -- [-539.099] (-535.194) (-535.235) (-539.061) * (-542.287) (-538.057) (-538.075) [-537.084] -- 0:00:45
      234500 -- (-536.711) (-540.492) [-536.098] (-537.363) * (-535.972) [-534.557] (-536.835) (-539.116) -- 0:00:45
      235000 -- (-539.277) [-535.439] (-537.445) (-538.248) * (-536.182) [-538.104] (-539.105) (-543.176) -- 0:00:45

      Average standard deviation of split frequencies: 0.015244

      235500 -- [-535.499] (-537.472) (-536.754) (-537.968) * [-539.072] (-536.273) (-539.493) (-538.119) -- 0:00:45
      236000 -- (-535.810) (-537.006) (-537.585) [-534.926] * [-537.353] (-537.195) (-537.554) (-536.409) -- 0:00:45
      236500 -- (-534.438) [-536.759] (-536.942) (-535.840) * (-535.712) (-537.551) [-536.432] (-539.290) -- 0:00:45
      237000 -- (-541.422) (-539.285) (-537.663) [-538.468] * (-537.774) (-538.029) [-540.149] (-538.008) -- 0:00:45
      237500 -- (-537.912) [-535.878] (-536.025) (-538.208) * (-536.215) [-537.033] (-542.748) (-535.723) -- 0:00:44
      238000 -- (-536.927) [-537.778] (-536.190) (-534.795) * (-536.086) (-537.688) (-536.093) [-540.475] -- 0:00:44
      238500 -- (-540.798) (-536.007) (-535.775) [-534.595] * (-537.779) [-537.661] (-538.884) (-537.484) -- 0:00:44
      239000 -- [-536.715] (-539.180) (-536.370) (-537.666) * (-536.225) [-535.840] (-534.919) (-536.142) -- 0:00:44
      239500 -- (-534.804) (-537.135) (-538.441) [-535.738] * (-537.212) [-536.243] (-535.707) (-535.182) -- 0:00:44
      240000 -- (-536.262) (-535.165) [-535.880] (-538.910) * (-534.440) [-535.050] (-536.883) (-537.651) -- 0:00:47

      Average standard deviation of split frequencies: 0.015876

      240500 -- (-536.450) (-535.585) [-535.913] (-536.420) * (-537.088) [-536.243] (-535.583) (-540.431) -- 0:00:47
      241000 -- (-535.965) [-534.766] (-534.983) (-537.409) * (-536.182) (-536.766) (-534.967) [-536.718] -- 0:00:47
      241500 -- (-538.184) (-537.936) [-537.375] (-536.615) * (-538.729) (-534.805) (-538.350) [-542.985] -- 0:00:47
      242000 -- [-537.226] (-537.307) (-534.854) (-537.835) * [-539.846] (-536.844) (-537.931) (-536.726) -- 0:00:46
      242500 -- (-543.798) (-537.537) [-534.895] (-535.211) * (-536.515) (-539.294) (-534.919) [-535.059] -- 0:00:46
      243000 -- (-538.586) (-535.942) (-538.680) [-538.523] * (-536.894) (-540.007) [-534.584] (-535.880) -- 0:00:46
      243500 -- [-537.801] (-536.803) (-536.323) (-538.000) * [-536.143] (-536.130) (-536.623) (-535.694) -- 0:00:46
      244000 -- (-536.566) (-535.858) [-535.809] (-538.451) * [-535.111] (-534.622) (-539.138) (-536.667) -- 0:00:46
      244500 -- [-536.129] (-543.791) (-537.018) (-541.185) * (-536.107) (-536.402) (-535.909) [-534.720] -- 0:00:46
      245000 -- [-534.284] (-537.570) (-540.418) (-540.451) * (-541.217) (-536.041) [-534.829] (-536.303) -- 0:00:46

      Average standard deviation of split frequencies: 0.016863

      245500 -- (-536.163) [-536.031] (-535.665) (-536.384) * [-535.013] (-535.000) (-539.043) (-537.586) -- 0:00:46
      246000 -- (-534.657) [-536.171] (-534.488) (-537.877) * (-535.845) (-535.412) [-537.419] (-536.464) -- 0:00:45
      246500 -- (-536.334) [-535.271] (-535.466) (-537.167) * [-537.087] (-535.792) (-537.176) (-536.917) -- 0:00:45
      247000 -- [-535.800] (-535.729) (-535.340) (-535.140) * (-539.094) [-535.063] (-536.818) (-538.464) -- 0:00:45
      247500 -- (-537.442) (-537.140) (-538.795) [-535.898] * (-535.156) [-536.713] (-535.149) (-534.928) -- 0:00:45
      248000 -- [-535.199] (-534.332) (-536.957) (-535.183) * (-535.701) [-538.137] (-535.875) (-535.637) -- 0:00:45
      248500 -- (-535.814) (-537.522) (-536.279) [-534.791] * (-536.312) (-537.047) (-534.985) [-535.442] -- 0:00:45
      249000 -- (-536.742) (-536.087) [-543.188] (-536.825) * (-538.371) [-536.159] (-535.022) (-535.638) -- 0:00:45
      249500 -- (-537.199) [-538.597] (-537.227) (-535.815) * [-535.554] (-537.566) (-536.541) (-536.595) -- 0:00:45
      250000 -- (-536.528) (-535.533) (-536.820) [-535.511] * [-534.519] (-538.584) (-538.762) (-535.555) -- 0:00:45

      Average standard deviation of split frequencies: 0.017019

      250500 -- [-536.188] (-535.579) (-540.595) (-536.250) * (-534.662) [-537.096] (-536.064) (-536.782) -- 0:00:44
      251000 -- (-538.255) (-536.158) [-537.848] (-538.062) * (-534.591) (-536.620) [-534.923] (-534.853) -- 0:00:44
      251500 -- (-535.882) [-534.981] (-537.065) (-539.596) * [-535.555] (-538.384) (-538.780) (-537.640) -- 0:00:44
      252000 -- (-536.484) (-534.768) [-537.034] (-535.412) * (-536.148) [-534.979] (-536.802) (-537.149) -- 0:00:44
      252500 -- (-536.055) (-541.068) [-538.024] (-535.893) * (-536.121) [-538.634] (-535.913) (-537.206) -- 0:00:44
      253000 -- (-537.603) (-535.723) [-534.997] (-538.814) * [-535.336] (-535.900) (-534.729) (-534.282) -- 0:00:44
      253500 -- [-537.130] (-534.622) (-537.080) (-537.687) * [-535.523] (-535.368) (-535.815) (-536.891) -- 0:00:44
      254000 -- [-535.504] (-538.811) (-539.312) (-538.094) * (-537.118) (-535.540) [-535.520] (-539.317) -- 0:00:44
      254500 -- (-538.081) [-536.015] (-535.088) (-535.427) * (-541.325) [-535.903] (-534.216) (-536.241) -- 0:00:43
      255000 -- (-538.599) (-536.718) (-534.261) [-534.814] * (-536.142) [-535.393] (-542.246) (-536.116) -- 0:00:46

      Average standard deviation of split frequencies: 0.015652

      255500 -- (-534.575) (-535.848) [-537.375] (-537.600) * (-535.696) (-535.890) [-541.244] (-536.831) -- 0:00:46
      256000 -- (-538.453) [-538.307] (-538.615) (-539.772) * (-536.400) (-538.218) [-536.668] (-536.739) -- 0:00:46
      256500 -- (-538.893) (-536.133) [-535.428] (-535.287) * (-535.694) (-536.642) (-541.767) [-535.894] -- 0:00:46
      257000 -- (-535.361) (-537.314) [-535.744] (-535.469) * (-538.760) [-534.301] (-537.126) (-537.916) -- 0:00:46
      257500 -- [-534.888] (-541.284) (-535.519) (-536.365) * (-540.498) (-538.788) [-536.408] (-539.611) -- 0:00:46
      258000 -- (-539.179) [-537.865] (-536.193) (-537.836) * (-536.046) (-535.449) (-536.656) [-538.715] -- 0:00:46
      258500 -- (-536.209) (-538.101) [-535.312] (-535.183) * (-536.801) (-534.282) [-537.378] (-540.057) -- 0:00:45
      259000 -- (-535.972) (-537.744) [-538.368] (-536.757) * (-536.039) [-534.641] (-536.752) (-538.195) -- 0:00:45
      259500 -- (-536.007) (-536.346) (-537.196) [-537.298] * (-542.634) (-535.754) [-539.903] (-537.054) -- 0:00:45
      260000 -- (-535.982) (-536.431) [-536.637] (-542.467) * (-537.687) (-536.605) [-538.167] (-537.413) -- 0:00:45

      Average standard deviation of split frequencies: 0.014563

      260500 -- (-541.655) (-535.456) [-536.443] (-539.852) * (-538.256) (-536.772) (-543.347) [-537.094] -- 0:00:45
      261000 -- [-539.462] (-535.932) (-535.507) (-536.904) * (-538.084) (-535.668) [-536.388] (-538.638) -- 0:00:45
      261500 -- (-534.796) (-538.127) (-535.615) [-538.333] * (-535.128) [-537.245] (-536.820) (-535.700) -- 0:00:45
      262000 -- (-535.142) [-537.764] (-534.375) (-538.026) * (-537.256) (-537.169) [-539.643] (-536.580) -- 0:00:45
      262500 -- (-537.992) [-539.108] (-537.141) (-537.631) * [-537.197] (-535.086) (-534.688) (-536.151) -- 0:00:44
      263000 -- (-539.727) (-536.688) (-539.007) [-538.194] * (-538.925) (-534.358) (-534.788) [-542.032] -- 0:00:44
      263500 -- (-535.971) (-534.842) [-536.845] (-536.004) * (-541.607) [-537.798] (-534.572) (-535.140) -- 0:00:44
      264000 -- (-535.416) (-536.852) (-536.648) [-535.832] * (-538.242) (-535.996) (-535.646) [-540.087] -- 0:00:44
      264500 -- (-536.946) (-536.648) [-536.058] (-538.448) * [-535.667] (-535.649) (-534.377) (-539.166) -- 0:00:44
      265000 -- (-535.972) (-536.816) [-535.726] (-536.965) * (-535.689) (-535.649) [-535.367] (-536.590) -- 0:00:44

      Average standard deviation of split frequencies: 0.014644

      265500 -- (-541.595) (-536.605) [-535.987] (-536.940) * (-535.752) (-543.360) [-536.001] (-539.643) -- 0:00:44
      266000 -- (-544.097) (-538.874) [-535.505] (-538.050) * [-535.420] (-536.162) (-538.116) (-537.239) -- 0:00:44
      266500 -- (-535.697) (-535.879) (-537.312) [-535.508] * (-536.062) [-537.336] (-540.724) (-537.091) -- 0:00:44
      267000 -- [-536.701] (-535.248) (-538.548) (-537.936) * (-537.424) (-537.598) (-537.050) [-534.394] -- 0:00:43
      267500 -- (-537.050) [-536.142] (-534.787) (-537.500) * (-537.330) [-536.026] (-535.130) (-535.947) -- 0:00:43
      268000 -- (-537.012) (-538.335) (-535.985) [-535.509] * [-535.432] (-534.369) (-536.522) (-535.924) -- 0:00:43
      268500 -- [-535.664] (-543.010) (-535.347) (-538.688) * [-534.436] (-534.537) (-537.267) (-536.066) -- 0:00:43
      269000 -- (-536.312) (-537.449) (-540.537) [-535.006] * (-537.845) (-535.426) (-535.717) [-538.367] -- 0:00:43
      269500 -- (-537.385) (-538.623) (-537.767) [-535.702] * (-536.593) (-535.415) (-537.147) [-534.454] -- 0:00:43
      270000 -- [-536.641] (-535.578) (-539.814) (-536.344) * (-542.673) (-535.268) [-534.979] (-534.209) -- 0:00:43

      Average standard deviation of split frequencies: 0.015125

      270500 -- [-535.689] (-535.383) (-534.651) (-536.485) * [-538.344] (-536.101) (-534.555) (-542.703) -- 0:00:43
      271000 -- (-535.255) [-537.577] (-535.332) (-536.010) * (-542.553) (-536.272) (-537.782) [-536.125] -- 0:00:43
      271500 -- (-536.944) (-536.382) [-534.674] (-534.936) * (-540.350) (-536.182) [-536.893] (-534.809) -- 0:00:42
      272000 -- (-535.485) (-536.602) [-536.632] (-535.318) * (-538.511) (-534.377) (-537.398) [-534.942] -- 0:00:45
      272500 -- (-535.781) [-536.135] (-537.256) (-536.966) * [-537.389] (-535.640) (-534.960) (-534.917) -- 0:00:45
      273000 -- [-536.702] (-539.654) (-536.711) (-534.558) * [-534.787] (-535.711) (-537.948) (-535.657) -- 0:00:45
      273500 -- [-536.370] (-535.599) (-537.945) (-536.625) * (-535.703) (-535.507) (-540.536) [-536.348] -- 0:00:45
      274000 -- [-537.211] (-537.366) (-537.696) (-534.647) * [-536.691] (-535.064) (-534.978) (-536.890) -- 0:00:45
      274500 -- (-537.405) (-535.448) [-540.103] (-538.894) * [-536.318] (-538.893) (-536.296) (-537.222) -- 0:00:44
      275000 -- [-537.498] (-535.460) (-536.985) (-535.330) * (-537.228) (-540.093) [-535.541] (-536.448) -- 0:00:44

      Average standard deviation of split frequencies: 0.014518

      275500 -- (-536.905) (-535.553) (-536.484) [-538.623] * (-534.340) (-536.017) [-539.283] (-538.090) -- 0:00:44
      276000 -- (-535.077) (-534.411) [-537.077] (-536.254) * (-538.118) [-539.913] (-537.467) (-540.061) -- 0:00:44
      276500 -- (-535.037) (-536.576) (-535.081) [-536.623] * [-538.602] (-536.171) (-539.428) (-538.286) -- 0:00:44
      277000 -- [-535.029] (-541.645) (-536.619) (-536.000) * (-535.987) [-535.926] (-535.838) (-538.095) -- 0:00:44
      277500 -- [-536.016] (-535.191) (-536.439) (-536.677) * [-535.078] (-535.227) (-537.355) (-536.523) -- 0:00:44
      278000 -- (-535.737) [-534.838] (-536.556) (-541.313) * (-536.325) (-534.686) [-535.965] (-537.587) -- 0:00:44
      278500 -- (-534.898) [-534.844] (-539.160) (-536.212) * (-537.366) [-534.643] (-539.161) (-534.990) -- 0:00:44
      279000 -- (-536.482) [-536.837] (-535.824) (-536.338) * (-538.558) [-535.016] (-539.092) (-536.499) -- 0:00:43
      279500 -- (-537.068) [-536.818] (-537.593) (-539.292) * (-535.900) [-537.408] (-538.104) (-535.348) -- 0:00:43
      280000 -- (-534.257) (-536.125) [-534.833] (-536.316) * (-534.723) [-534.939] (-535.739) (-536.308) -- 0:00:43

      Average standard deviation of split frequencies: 0.015558

      280500 -- (-536.101) [-535.592] (-535.036) (-536.498) * (-534.949) (-534.762) (-538.239) [-538.874] -- 0:00:43
      281000 -- (-534.651) [-536.883] (-534.452) (-536.873) * (-535.398) (-539.227) (-541.290) [-536.556] -- 0:00:43
      281500 -- (-538.167) (-537.984) [-534.388] (-535.762) * (-535.404) (-535.204) (-537.400) [-535.102] -- 0:00:43
      282000 -- (-536.040) [-536.531] (-534.927) (-537.958) * [-537.116] (-534.718) (-535.411) (-537.360) -- 0:00:43
      282500 -- (-540.068) (-534.832) (-538.323) [-534.883] * (-535.194) (-535.629) [-536.755] (-534.914) -- 0:00:43
      283000 -- (-535.522) (-536.200) (-535.436) [-540.857] * (-536.214) (-536.641) [-537.087] (-538.710) -- 0:00:43
      283500 -- [-534.531] (-537.150) (-539.843) (-536.131) * [-535.901] (-536.925) (-537.317) (-538.539) -- 0:00:42
      284000 -- (-538.617) (-535.176) (-535.421) [-536.089] * [-536.747] (-534.754) (-535.880) (-535.784) -- 0:00:42
      284500 -- (-535.452) [-535.852] (-536.278) (-538.126) * [-534.901] (-540.970) (-535.972) (-539.621) -- 0:00:42
      285000 -- (-537.654) (-536.495) (-536.834) [-537.157] * (-535.975) [-536.649] (-534.863) (-542.437) -- 0:00:42

      Average standard deviation of split frequencies: 0.015329

      285500 -- (-535.820) [-535.767] (-536.062) (-535.680) * (-539.790) [-539.831] (-536.298) (-536.602) -- 0:00:42
      286000 -- [-537.813] (-536.180) (-538.799) (-536.652) * (-535.504) [-535.116] (-538.566) (-542.649) -- 0:00:42
      286500 -- (-536.266) (-534.907) [-534.756] (-535.149) * (-538.229) [-536.348] (-539.181) (-535.876) -- 0:00:42
      287000 -- (-536.888) [-537.605] (-538.733) (-539.274) * (-537.310) [-537.244] (-537.545) (-541.135) -- 0:00:42
      287500 -- (-539.215) (-534.358) [-538.695] (-537.705) * (-535.788) [-535.143] (-535.774) (-538.070) -- 0:00:42
      288000 -- (-538.124) [-535.798] (-536.748) (-544.743) * (-535.115) (-536.076) (-536.029) [-536.199] -- 0:00:44
      288500 -- (-539.610) [-537.326] (-536.106) (-535.417) * (-536.093) (-536.399) (-535.127) [-536.429] -- 0:00:44
      289000 -- (-536.977) (-537.093) [-534.699] (-536.487) * (-538.570) (-538.685) (-536.372) [-537.606] -- 0:00:44
      289500 -- (-536.379) [-535.869] (-537.046) (-535.883) * (-536.490) (-537.609) [-538.062] (-535.657) -- 0:00:44
      290000 -- (-535.344) [-535.419] (-535.313) (-535.307) * (-534.811) (-534.634) [-540.743] (-534.629) -- 0:00:44

      Average standard deviation of split frequencies: 0.015621

      290500 -- (-535.399) (-535.719) (-536.444) [-537.015] * (-534.421) (-538.948) (-538.170) [-534.458] -- 0:00:43
      291000 -- [-534.761] (-535.622) (-535.417) (-537.214) * (-535.916) (-535.869) (-536.649) [-535.532] -- 0:00:43
      291500 -- [-535.963] (-534.878) (-545.756) (-535.467) * (-535.470) [-535.743] (-538.213) (-534.832) -- 0:00:43
      292000 -- [-537.025] (-536.631) (-535.282) (-535.709) * (-536.865) [-536.016] (-536.591) (-538.472) -- 0:00:43
      292500 -- (-537.151) [-534.420] (-536.491) (-537.442) * (-541.496) (-536.222) (-536.319) [-537.220] -- 0:00:43
      293000 -- (-537.442) (-535.709) (-535.114) [-538.294] * (-539.224) (-535.830) (-536.006) [-535.408] -- 0:00:43
      293500 -- (-539.634) [-535.219] (-536.391) (-535.924) * [-536.960] (-534.624) (-536.951) (-534.555) -- 0:00:43
      294000 -- (-537.372) [-536.125] (-538.034) (-535.271) * (-539.313) (-539.985) (-534.957) [-534.534] -- 0:00:43
      294500 -- (-534.482) (-536.046) (-540.996) [-535.057] * (-535.868) (-540.255) [-537.264] (-535.087) -- 0:00:43
      295000 -- (-535.288) (-535.319) [-538.418] (-534.551) * (-538.154) (-537.465) (-537.596) [-535.201] -- 0:00:43

      Average standard deviation of split frequencies: 0.015687

      295500 -- [-535.730] (-537.155) (-537.460) (-534.799) * [-539.807] (-536.963) (-540.793) (-534.943) -- 0:00:42
      296000 -- (-535.407) (-536.800) (-537.675) [-537.677] * (-535.688) [-536.138] (-536.961) (-535.405) -- 0:00:42
      296500 -- [-534.445] (-536.834) (-539.083) (-535.607) * (-539.366) [-536.553] (-538.858) (-538.592) -- 0:00:42
      297000 -- [-537.035] (-539.856) (-536.195) (-538.049) * (-539.949) [-538.232] (-534.570) (-538.085) -- 0:00:42
      297500 -- [-536.742] (-535.815) (-536.138) (-534.554) * (-535.662) [-536.706] (-537.743) (-534.949) -- 0:00:42
      298000 -- [-534.447] (-539.017) (-535.649) (-534.926) * [-539.381] (-535.364) (-536.851) (-537.197) -- 0:00:42
      298500 -- (-534.427) (-535.510) [-535.055] (-535.343) * (-534.917) (-536.459) (-535.912) [-537.432] -- 0:00:42
      299000 -- (-536.540) [-537.926] (-536.103) (-535.412) * (-537.125) [-534.460] (-536.582) (-537.363) -- 0:00:42
      299500 -- (-536.305) (-536.900) [-536.066] (-535.456) * (-537.180) (-535.086) (-538.329) [-536.134] -- 0:00:42
      300000 -- (-538.106) [-537.176] (-537.710) (-534.499) * (-537.433) (-539.205) [-535.358] (-536.848) -- 0:00:42

      Average standard deviation of split frequencies: 0.015914

      300500 -- (-538.454) (-537.077) [-536.597] (-538.037) * (-536.168) (-540.589) (-535.294) [-534.867] -- 0:00:41
      301000 -- (-537.470) [-538.110] (-535.238) (-539.877) * (-536.312) (-538.479) [-536.661] (-534.429) -- 0:00:41
      301500 -- (-536.329) (-535.499) [-534.685] (-543.651) * [-535.771] (-537.647) (-536.657) (-535.653) -- 0:00:41
      302000 -- (-538.888) (-536.001) (-536.198) [-536.829] * (-537.569) [-538.232] (-536.542) (-536.683) -- 0:00:41
      302500 -- (-541.576) (-536.508) (-537.227) [-535.744] * (-536.121) (-535.865) (-537.692) [-535.216] -- 0:00:41
      303000 -- (-540.173) (-543.371) (-538.462) [-538.710] * (-536.547) (-537.812) (-536.126) [-536.107] -- 0:00:41
      303500 -- [-535.684] (-540.568) (-536.953) (-536.662) * [-536.111] (-537.437) (-537.749) (-536.315) -- 0:00:41
      304000 -- [-537.520] (-535.455) (-535.980) (-536.696) * (-535.277) (-539.714) [-536.765] (-535.747) -- 0:00:41
      304500 -- [-535.667] (-534.584) (-535.411) (-539.318) * (-536.554) (-538.198) (-535.593) [-535.794] -- 0:00:43
      305000 -- (-535.296) (-537.063) [-535.433] (-536.923) * [-537.397] (-537.267) (-537.009) (-537.180) -- 0:00:43

      Average standard deviation of split frequencies: 0.015636

      305500 -- [-539.047] (-538.309) (-537.096) (-541.990) * (-536.400) [-537.291] (-535.261) (-539.212) -- 0:00:43
      306000 -- (-537.056) (-536.580) [-537.943] (-538.756) * (-540.183) (-535.205) [-536.296] (-538.534) -- 0:00:43
      306500 -- [-535.636] (-535.539) (-539.949) (-536.439) * [-535.577] (-535.557) (-535.079) (-537.970) -- 0:00:42
      307000 -- (-538.577) [-537.112] (-537.602) (-538.868) * (-538.783) [-535.224] (-535.699) (-534.994) -- 0:00:42
      307500 -- (-538.694) [-535.996] (-537.136) (-535.949) * [-534.623] (-536.847) (-534.965) (-538.479) -- 0:00:42
      308000 -- (-535.775) (-536.519) (-534.933) [-534.502] * (-539.778) (-535.293) (-536.908) [-535.601] -- 0:00:42
      308500 -- [-536.254] (-535.284) (-537.493) (-538.082) * [-537.640] (-535.765) (-536.989) (-537.816) -- 0:00:42
      309000 -- (-536.839) (-534.996) (-538.476) [-538.153] * (-534.684) (-535.111) (-539.435) [-536.645] -- 0:00:42
      309500 -- (-541.066) (-536.166) [-537.213] (-538.415) * (-535.635) (-535.641) [-536.510] (-536.525) -- 0:00:42
      310000 -- [-538.544] (-536.302) (-537.096) (-538.043) * (-538.058) [-536.680] (-536.337) (-536.057) -- 0:00:42

      Average standard deviation of split frequencies: 0.015334

      310500 -- (-536.388) (-535.475) [-535.108] (-535.664) * (-534.944) (-535.607) [-536.707] (-537.579) -- 0:00:42
      311000 -- (-535.343) (-536.813) [-534.129] (-537.541) * (-534.584) [-534.492] (-536.861) (-534.894) -- 0:00:42
      311500 -- (-538.261) (-536.530) [-538.165] (-537.436) * (-536.561) (-534.546) (-536.202) [-534.972] -- 0:00:41
      312000 -- [-536.893] (-537.732) (-537.691) (-537.906) * (-534.438) (-534.480) [-537.718] (-534.860) -- 0:00:41
      312500 -- (-535.246) (-537.548) [-536.152] (-536.116) * (-536.361) [-536.610] (-534.929) (-537.103) -- 0:00:41
      313000 -- [-536.332] (-534.895) (-540.405) (-535.519) * (-536.616) (-535.561) (-535.207) [-536.913] -- 0:00:41
      313500 -- (-535.677) (-537.719) (-535.956) [-535.665] * [-537.654] (-536.725) (-535.753) (-539.301) -- 0:00:41
      314000 -- (-540.928) (-536.408) [-537.158] (-538.018) * [-535.542] (-535.389) (-535.070) (-536.683) -- 0:00:41
      314500 -- (-537.452) (-535.948) [-538.189] (-538.644) * (-534.125) (-537.614) [-536.554] (-535.840) -- 0:00:41
      315000 -- (-538.992) (-540.291) [-535.097] (-537.312) * (-537.423) (-535.194) [-536.428] (-534.715) -- 0:00:41

      Average standard deviation of split frequencies: 0.015153

      315500 -- [-541.103] (-541.952) (-539.558) (-535.070) * (-535.905) [-535.446] (-536.870) (-538.100) -- 0:00:41
      316000 -- (-537.032) (-537.642) (-536.414) [-535.230] * (-536.984) (-534.648) [-536.041] (-535.631) -- 0:00:41
      316500 -- [-536.552] (-535.265) (-537.259) (-535.989) * (-536.368) [-535.521] (-536.554) (-535.218) -- 0:00:41
      317000 -- (-536.883) [-536.029] (-537.841) (-536.942) * (-535.299) [-536.215] (-535.958) (-536.595) -- 0:00:40
      317500 -- (-539.630) (-539.504) [-538.263] (-536.416) * (-536.891) [-535.812] (-535.901) (-537.061) -- 0:00:40
      318000 -- [-536.337] (-537.130) (-535.064) (-540.483) * (-537.140) [-535.700] (-536.446) (-538.845) -- 0:00:40
      318500 -- [-538.848] (-536.100) (-537.075) (-540.136) * [-536.357] (-536.343) (-537.623) (-536.360) -- 0:00:40
      319000 -- [-536.514] (-534.731) (-534.592) (-537.265) * (-535.587) [-535.556] (-538.173) (-536.862) -- 0:00:40
      319500 -- (-537.783) [-536.033] (-534.470) (-537.164) * [-538.764] (-534.648) (-540.588) (-538.052) -- 0:00:40
      320000 -- (-535.398) [-539.392] (-535.254) (-538.213) * (-535.032) [-534.431] (-539.303) (-537.188) -- 0:00:40

      Average standard deviation of split frequencies: 0.014933

      320500 -- (-537.538) [-537.011] (-536.475) (-537.881) * [-535.424] (-534.922) (-535.205) (-536.240) -- 0:00:40
      321000 -- (-536.059) (-535.986) (-537.456) [-535.129] * (-536.663) [-534.614] (-541.371) (-538.199) -- 0:00:42
      321500 -- (-534.856) (-538.038) (-537.416) [-536.762] * (-539.982) (-539.434) (-547.645) [-537.334] -- 0:00:42
      322000 -- (-536.078) (-536.180) [-534.326] (-536.409) * [-537.713] (-536.926) (-535.320) (-536.347) -- 0:00:42
      322500 -- (-540.565) (-537.408) (-535.540) [-536.075] * (-537.640) (-538.672) (-535.655) [-536.053] -- 0:00:42
      323000 -- [-535.337] (-538.448) (-535.522) (-534.485) * [-535.363] (-536.873) (-535.272) (-536.304) -- 0:00:41
      323500 -- [-538.204] (-539.039) (-539.734) (-534.447) * (-534.434) (-535.073) [-534.957] (-538.319) -- 0:00:41
      324000 -- [-540.866] (-537.480) (-539.930) (-536.401) * (-536.706) (-535.453) (-537.086) [-535.632] -- 0:00:41
      324500 -- [-534.749] (-538.941) (-536.099) (-538.725) * [-536.861] (-536.753) (-534.769) (-535.562) -- 0:00:41
      325000 -- (-534.864) (-534.771) (-535.506) [-536.408] * [-535.267] (-538.570) (-536.331) (-534.805) -- 0:00:41

      Average standard deviation of split frequencies: 0.015450

      325500 -- [-535.125] (-537.152) (-536.969) (-536.270) * (-538.260) (-539.740) [-535.144] (-535.647) -- 0:00:41
      326000 -- (-536.662) [-535.694] (-535.726) (-536.498) * (-535.299) (-539.018) [-537.043] (-537.548) -- 0:00:41
      326500 -- (-536.113) [-536.331] (-534.537) (-534.379) * (-536.433) (-539.687) (-535.568) [-536.168] -- 0:00:41
      327000 -- (-534.929) (-538.272) [-534.889] (-536.179) * (-535.233) [-537.686] (-535.903) (-538.937) -- 0:00:41
      327500 -- [-535.734] (-535.524) (-535.863) (-534.401) * (-535.844) (-534.643) (-535.501) [-536.273] -- 0:00:41
      328000 -- [-539.512] (-535.377) (-535.516) (-534.547) * (-539.676) [-536.523] (-535.058) (-539.364) -- 0:00:40
      328500 -- (-536.093) [-534.998] (-536.202) (-534.452) * (-535.968) (-535.594) (-539.924) [-536.829] -- 0:00:40
      329000 -- (-536.497) (-536.810) (-536.159) [-540.150] * [-535.793] (-536.072) (-540.398) (-537.286) -- 0:00:40
      329500 -- (-540.637) (-544.014) [-538.515] (-535.567) * [-535.657] (-535.915) (-534.877) (-536.121) -- 0:00:40
      330000 -- [-538.896] (-536.337) (-536.785) (-534.994) * (-536.015) [-536.035] (-536.366) (-535.129) -- 0:00:40

      Average standard deviation of split frequencies: 0.014811

      330500 -- [-543.242] (-534.763) (-535.856) (-536.138) * [-535.285] (-535.003) (-538.288) (-536.181) -- 0:00:40
      331000 -- (-535.241) (-536.598) (-536.294) [-535.577] * [-536.076] (-537.641) (-537.541) (-537.521) -- 0:00:40
      331500 -- (-535.176) (-534.595) (-536.032) [-536.737] * [-536.417] (-537.375) (-535.881) (-536.364) -- 0:00:40
      332000 -- [-534.911] (-535.623) (-536.575) (-537.699) * [-536.008] (-535.214) (-540.280) (-536.678) -- 0:00:40
      332500 -- (-534.470) [-535.073] (-538.972) (-537.617) * (-534.746) (-538.133) [-534.430] (-537.225) -- 0:00:40
      333000 -- (-536.069) (-535.249) [-534.704] (-539.241) * (-534.959) (-535.613) [-534.560] (-536.629) -- 0:00:40
      333500 -- (-536.476) (-536.682) [-536.430] (-538.419) * [-539.142] (-535.912) (-535.161) (-536.335) -- 0:00:39
      334000 -- [-534.380] (-536.342) (-537.161) (-534.633) * (-539.227) (-535.918) (-536.492) [-536.781] -- 0:00:39
      334500 -- (-537.896) [-536.446] (-535.520) (-539.297) * [-536.060] (-536.039) (-536.165) (-535.475) -- 0:00:39
      335000 -- (-534.888) (-537.141) (-536.596) [-538.973] * [-539.425] (-534.210) (-540.633) (-536.274) -- 0:00:39

      Average standard deviation of split frequencies: 0.014547

      335500 -- (-537.807) (-536.604) [-534.856] (-537.666) * [-535.159] (-537.536) (-537.084) (-535.378) -- 0:00:39
      336000 -- (-538.055) (-535.467) [-536.037] (-534.941) * (-536.659) (-540.881) (-535.457) [-537.116] -- 0:00:39
      336500 -- [-536.034] (-536.736) (-535.264) (-537.556) * (-538.700) (-536.660) (-534.781) [-537.227] -- 0:00:39
      337000 -- [-534.533] (-539.774) (-535.726) (-535.124) * (-538.580) (-541.001) [-538.784] (-535.116) -- 0:00:39
      337500 -- [-535.071] (-537.314) (-543.481) (-535.235) * [-536.796] (-535.513) (-537.538) (-537.289) -- 0:00:39
      338000 -- [-536.997] (-539.266) (-542.452) (-540.395) * (-536.496) (-537.542) [-538.023] (-535.283) -- 0:00:41
      338500 -- (-535.959) (-536.484) [-535.572] (-535.347) * (-540.710) (-538.514) [-534.491] (-536.338) -- 0:00:41
      339000 -- [-536.525] (-537.856) (-534.824) (-535.396) * (-536.446) (-536.256) [-537.480] (-535.613) -- 0:00:40
      339500 -- (-536.195) (-536.555) (-534.343) [-535.612] * [-535.042] (-536.260) (-537.799) (-538.454) -- 0:00:40
      340000 -- [-535.499] (-537.123) (-535.149) (-535.621) * (-536.151) (-537.399) (-537.796) [-539.066] -- 0:00:40

      Average standard deviation of split frequencies: 0.013300

      340500 -- (-540.872) [-536.623] (-534.310) (-535.505) * (-536.789) (-538.798) [-536.658] (-537.200) -- 0:00:40
      341000 -- [-539.211] (-535.361) (-535.123) (-536.896) * [-535.620] (-535.081) (-536.550) (-537.553) -- 0:00:40
      341500 -- (-536.236) (-534.751) (-534.746) [-536.014] * (-535.107) (-536.640) (-535.365) [-537.215] -- 0:00:40
      342000 -- [-538.937] (-538.242) (-539.629) (-536.441) * (-537.664) [-536.112] (-536.869) (-538.772) -- 0:00:40
      342500 -- (-538.687) [-535.082] (-539.130) (-536.471) * (-536.820) (-535.715) (-536.432) [-537.451] -- 0:00:40
      343000 -- (-535.440) [-536.962] (-538.031) (-536.035) * (-537.923) (-534.562) (-535.988) [-536.523] -- 0:00:40
      343500 -- (-535.820) [-537.163] (-535.339) (-536.945) * (-540.314) (-536.685) [-534.645] (-535.621) -- 0:00:40
      344000 -- (-534.469) (-537.432) [-539.124] (-538.443) * (-538.532) (-536.128) [-535.472] (-535.102) -- 0:00:40
      344500 -- (-536.392) (-535.762) [-536.214] (-536.477) * [-536.811] (-538.627) (-535.124) (-534.452) -- 0:00:39
      345000 -- [-538.691] (-538.235) (-535.162) (-535.852) * (-534.986) [-536.300] (-535.200) (-537.292) -- 0:00:39

      Average standard deviation of split frequencies: 0.012565

      345500 -- (-538.700) (-538.937) [-536.207] (-536.449) * [-535.956] (-535.873) (-536.397) (-538.263) -- 0:00:39
      346000 -- (-543.381) [-535.411] (-536.992) (-535.542) * (-536.786) (-540.639) [-536.456] (-535.846) -- 0:00:39
      346500 -- (-540.875) (-539.462) (-535.836) [-535.610] * (-537.354) (-536.573) (-534.317) [-536.079] -- 0:00:39
      347000 -- (-535.779) (-540.147) [-536.104] (-535.420) * (-535.597) (-536.610) [-536.319] (-536.534) -- 0:00:39
      347500 -- (-535.104) (-536.320) (-535.914) [-535.236] * (-536.921) (-537.655) [-536.387] (-536.132) -- 0:00:39
      348000 -- [-535.977] (-537.164) (-537.150) (-535.280) * (-536.016) (-535.888) (-535.417) [-537.076] -- 0:00:39
      348500 -- (-536.990) (-536.049) [-536.623] (-535.049) * (-539.571) [-537.409] (-535.253) (-538.138) -- 0:00:39
      349000 -- [-537.993] (-535.868) (-536.703) (-536.306) * (-538.952) (-538.722) [-536.944] (-541.727) -- 0:00:39
      349500 -- (-538.352) [-534.688] (-535.093) (-535.452) * [-536.041] (-541.705) (-536.155) (-537.964) -- 0:00:39
      350000 -- (-537.593) [-538.672] (-537.428) (-539.783) * [-536.389] (-538.489) (-537.371) (-539.556) -- 0:00:39

      Average standard deviation of split frequencies: 0.011964

      350500 -- (-535.256) (-536.235) (-535.508) [-536.838] * (-536.620) (-535.032) (-535.861) [-535.353] -- 0:00:38
      351000 -- [-535.432] (-534.526) (-538.058) (-539.289) * (-537.715) [-536.715] (-537.138) (-539.254) -- 0:00:38
      351500 -- [-535.937] (-534.753) (-534.714) (-537.454) * (-538.192) (-537.075) (-539.096) [-536.153] -- 0:00:38
      352000 -- (-535.673) (-536.414) [-535.105] (-539.457) * [-535.595] (-537.260) (-537.703) (-536.208) -- 0:00:38
      352500 -- (-535.530) (-538.735) (-536.421) [-537.362] * (-534.460) [-539.678] (-535.308) (-538.426) -- 0:00:38
      353000 -- (-534.940) (-535.777) (-536.119) [-536.503] * (-535.439) (-536.223) [-534.437] (-536.393) -- 0:00:40
      353500 -- [-537.997] (-535.139) (-535.465) (-537.724) * (-536.670) [-538.016] (-537.439) (-536.235) -- 0:00:40
      354000 -- [-535.827] (-534.511) (-535.164) (-539.999) * (-536.981) (-538.699) [-535.247] (-540.854) -- 0:00:40
      354500 -- (-535.485) [-536.129] (-534.865) (-538.558) * [-536.282] (-538.190) (-537.832) (-538.495) -- 0:00:40
      355000 -- (-535.609) (-535.255) (-537.145) [-535.045] * [-536.115] (-536.415) (-537.719) (-537.473) -- 0:00:39

      Average standard deviation of split frequencies: 0.012580

      355500 -- (-536.620) [-534.946] (-537.202) (-537.020) * (-535.782) (-536.173) (-534.554) [-538.142] -- 0:00:39
      356000 -- (-536.409) (-535.879) (-539.076) [-534.699] * (-539.806) [-536.180] (-534.592) (-540.292) -- 0:00:39
      356500 -- [-534.820] (-538.981) (-534.907) (-536.126) * [-537.046] (-536.081) (-534.392) (-535.872) -- 0:00:39
      357000 -- (-536.840) (-537.737) (-535.805) [-534.118] * (-537.119) (-535.517) (-536.488) [-538.599] -- 0:00:39
      357500 -- [-535.790] (-536.120) (-536.438) (-534.696) * [-538.054] (-535.394) (-536.454) (-534.398) -- 0:00:39
      358000 -- (-537.640) [-535.815] (-536.352) (-541.625) * [-535.340] (-536.837) (-536.411) (-535.607) -- 0:00:39
      358500 -- (-536.134) (-534.686) (-541.559) [-538.449] * (-538.030) (-536.278) (-538.065) [-535.868] -- 0:00:39
      359000 -- (-536.180) [-536.768] (-535.677) (-534.634) * [-536.148] (-535.756) (-535.723) (-535.503) -- 0:00:39
      359500 -- (-536.176) (-534.702) (-535.653) [-535.759] * (-535.691) (-543.628) [-536.020] (-540.250) -- 0:00:39
      360000 -- (-541.496) (-534.299) [-534.645] (-536.530) * (-537.343) (-538.840) (-535.718) [-537.593] -- 0:00:39

      Average standard deviation of split frequencies: 0.012199

      360500 -- (-538.445) (-536.580) [-535.659] (-539.197) * [-536.088] (-537.420) (-534.358) (-538.168) -- 0:00:39
      361000 -- (-536.437) [-537.230] (-536.741) (-534.801) * (-535.046) (-538.757) [-534.170] (-535.458) -- 0:00:38
      361500 -- (-537.835) [-537.215] (-535.854) (-535.283) * (-536.488) (-540.175) (-537.321) [-540.574] -- 0:00:38
      362000 -- [-537.013] (-536.463) (-535.387) (-534.757) * [-537.718] (-538.707) (-536.949) (-535.919) -- 0:00:38
      362500 -- (-535.557) [-541.898] (-538.177) (-535.480) * (-537.119) (-539.199) (-537.808) [-535.034] -- 0:00:38
      363000 -- [-534.894] (-535.432) (-540.533) (-536.613) * [-535.079] (-535.800) (-537.370) (-536.723) -- 0:00:38
      363500 -- [-534.422] (-535.025) (-539.264) (-538.597) * [-535.829] (-538.530) (-535.636) (-535.997) -- 0:00:38
      364000 -- (-535.991) [-534.501] (-537.040) (-537.652) * (-540.506) (-536.312) [-535.674] (-537.081) -- 0:00:38
      364500 -- (-537.756) (-534.370) (-535.152) [-535.559] * (-538.185) [-536.657] (-534.937) (-539.576) -- 0:00:38
      365000 -- (-540.377) [-537.564] (-536.364) (-538.428) * (-538.353) (-537.122) (-534.964) [-535.009] -- 0:00:38

      Average standard deviation of split frequencies: 0.011377

      365500 -- (-538.854) [-535.928] (-535.434) (-534.977) * (-539.984) (-534.757) (-537.645) [-534.926] -- 0:00:38
      366000 -- (-538.397) (-538.065) [-534.373] (-534.924) * [-535.428] (-537.234) (-535.370) (-537.478) -- 0:00:38
      366500 -- (-538.327) (-537.076) [-534.682] (-535.545) * (-535.721) (-538.039) (-541.237) [-534.749] -- 0:00:38
      367000 -- (-538.155) (-539.077) (-536.344) [-541.287] * (-542.150) (-539.814) (-537.373) [-537.143] -- 0:00:37
      367500 -- (-539.649) [-534.868] (-537.028) (-536.416) * (-536.133) [-536.409] (-537.187) (-535.008) -- 0:00:37
      368000 -- [-535.756] (-537.163) (-535.165) (-535.975) * (-535.929) [-535.732] (-539.987) (-535.853) -- 0:00:37
      368500 -- (-538.159) (-534.995) [-534.396] (-537.802) * (-538.643) [-534.708] (-534.619) (-536.675) -- 0:00:37
      369000 -- [-537.714] (-535.057) (-535.354) (-536.489) * [-535.643] (-535.033) (-536.551) (-535.721) -- 0:00:37
      369500 -- [-538.027] (-535.677) (-535.288) (-534.728) * [-535.745] (-535.870) (-535.438) (-537.948) -- 0:00:37
      370000 -- (-535.520) (-535.685) [-534.483] (-536.371) * (-535.601) [-536.052] (-536.136) (-535.698) -- 0:00:39

      Average standard deviation of split frequencies: 0.010739

      370500 -- (-534.952) (-535.184) (-535.910) [-539.584] * [-536.623] (-537.681) (-536.398) (-538.046) -- 0:00:39
      371000 -- [-536.512] (-535.645) (-536.884) (-537.149) * [-535.791] (-536.012) (-538.869) (-538.349) -- 0:00:38
      371500 -- [-534.338] (-536.469) (-535.211) (-540.484) * (-536.736) (-535.022) [-534.896] (-535.047) -- 0:00:38
      372000 -- [-535.611] (-536.188) (-535.726) (-538.293) * (-538.037) (-539.846) [-534.639] (-535.975) -- 0:00:38
      372500 -- (-535.505) [-537.585] (-534.347) (-534.535) * (-535.711) [-535.321] (-536.605) (-538.040) -- 0:00:38
      373000 -- (-535.419) (-535.340) [-537.644] (-538.767) * (-537.443) (-538.223) [-535.059] (-539.039) -- 0:00:38
      373500 -- [-537.022] (-536.988) (-535.666) (-538.367) * (-534.573) [-540.384] (-535.581) (-539.550) -- 0:00:38
      374000 -- [-539.875] (-537.110) (-536.183) (-540.398) * [-534.866] (-537.426) (-536.479) (-537.977) -- 0:00:38
      374500 -- (-534.770) [-536.447] (-537.173) (-538.470) * (-535.097) [-535.503] (-539.492) (-537.580) -- 0:00:38
      375000 -- (-535.538) [-538.107] (-538.048) (-534.979) * (-537.720) [-536.431] (-540.790) (-536.066) -- 0:00:38

      Average standard deviation of split frequencies: 0.009891

      375500 -- (-539.282) [-534.936] (-536.444) (-540.171) * (-540.029) (-535.499) (-542.197) [-534.326] -- 0:00:38
      376000 -- (-534.692) (-538.268) [-536.214] (-537.581) * (-537.882) (-535.641) (-537.808) [-535.831] -- 0:00:38
      376500 -- [-538.037] (-535.812) (-537.673) (-535.451) * [-535.093] (-539.012) (-540.508) (-535.975) -- 0:00:38
      377000 -- (-537.499) [-538.854] (-537.812) (-540.348) * (-536.040) (-537.122) (-537.898) [-535.497] -- 0:00:38
      377500 -- [-535.440] (-537.867) (-536.298) (-536.345) * [-535.449] (-535.764) (-536.636) (-537.726) -- 0:00:37
      378000 -- (-535.414) [-534.888] (-535.457) (-535.959) * (-535.353) [-537.019] (-536.478) (-537.968) -- 0:00:37
      378500 -- (-536.849) [-534.818] (-540.853) (-535.593) * (-535.328) [-535.707] (-534.607) (-540.966) -- 0:00:37
      379000 -- [-537.073] (-534.959) (-537.374) (-537.385) * (-539.979) (-535.626) [-535.164] (-540.537) -- 0:00:37
      379500 -- (-545.610) (-536.085) [-536.494] (-542.864) * [-535.911] (-535.568) (-538.519) (-540.470) -- 0:00:37
      380000 -- (-537.861) [-539.021] (-535.251) (-538.576) * (-537.305) (-536.936) [-535.062] (-534.877) -- 0:00:37

      Average standard deviation of split frequencies: 0.009632

      380500 -- (-535.658) [-538.461] (-534.097) (-535.720) * (-535.663) [-536.244] (-539.043) (-539.343) -- 0:00:37
      381000 -- (-535.178) (-538.367) [-534.802] (-537.516) * (-536.784) [-536.946] (-536.531) (-536.200) -- 0:00:37
      381500 -- (-536.931) (-537.253) [-534.581] (-535.768) * (-537.215) (-534.270) [-535.486] (-537.050) -- 0:00:37
      382000 -- (-538.113) (-535.970) [-535.053] (-536.035) * [-534.808] (-536.189) (-535.049) (-540.391) -- 0:00:37
      382500 -- (-536.058) (-536.824) [-535.278] (-536.137) * [-534.500] (-537.123) (-536.554) (-539.888) -- 0:00:37
      383000 -- (-536.229) (-538.215) [-535.097] (-535.536) * [-537.664] (-540.142) (-537.060) (-540.007) -- 0:00:37
      383500 -- (-538.514) (-540.179) [-535.123] (-536.047) * (-544.160) (-535.063) (-537.065) [-539.294] -- 0:00:36
      384000 -- [-537.676] (-542.078) (-537.282) (-537.360) * (-542.399) (-537.305) [-537.088] (-541.033) -- 0:00:36
      384500 -- [-536.735] (-534.280) (-535.334) (-534.611) * (-539.191) (-536.034) [-535.807] (-536.002) -- 0:00:36
      385000 -- (-535.019) (-535.782) [-536.287] (-537.427) * (-539.624) [-535.715] (-543.213) (-542.152) -- 0:00:36

      Average standard deviation of split frequencies: 0.009384

      385500 -- [-535.942] (-535.806) (-535.715) (-538.000) * (-539.928) (-534.819) (-537.828) [-539.562] -- 0:00:36
      386000 -- (-536.983) (-534.940) [-534.989] (-537.458) * (-536.014) (-537.358) [-536.043] (-540.018) -- 0:00:36
      386500 -- (-537.642) [-534.313] (-537.627) (-541.937) * (-535.682) (-536.808) [-535.761] (-537.200) -- 0:00:36
      387000 -- (-537.932) (-536.745) (-537.410) [-534.978] * [-535.709] (-534.980) (-537.283) (-535.038) -- 0:00:38
      387500 -- [-534.624] (-536.004) (-536.811) (-535.863) * (-539.461) (-536.181) (-537.437) [-538.271] -- 0:00:37
      388000 -- (-534.677) (-537.654) (-536.304) [-536.022] * (-537.443) (-536.532) (-535.518) [-535.100] -- 0:00:37
      388500 -- (-535.268) (-542.727) (-536.728) [-535.140] * (-535.497) (-534.654) (-534.390) [-536.912] -- 0:00:37
      389000 -- (-537.804) [-534.975] (-538.086) (-536.563) * (-535.632) [-536.303] (-534.463) (-543.159) -- 0:00:37
      389500 -- [-534.320] (-536.412) (-537.151) (-539.336) * [-535.472] (-534.730) (-536.155) (-536.827) -- 0:00:37
      390000 -- (-535.633) (-536.896) [-540.391] (-536.808) * [-534.945] (-535.989) (-535.126) (-537.175) -- 0:00:37

      Average standard deviation of split frequencies: 0.009519

      390500 -- (-536.251) [-536.996] (-540.874) (-536.719) * [-537.626] (-535.840) (-535.653) (-535.759) -- 0:00:37
      391000 -- [-536.583] (-536.087) (-538.695) (-536.111) * (-538.519) [-537.275] (-539.019) (-535.865) -- 0:00:37
      391500 -- [-534.671] (-536.381) (-536.644) (-537.249) * [-537.236] (-534.312) (-537.035) (-535.898) -- 0:00:37
      392000 -- (-535.945) (-536.234) [-536.397] (-539.955) * (-537.930) [-535.791] (-536.728) (-535.459) -- 0:00:37
      392500 -- (-535.980) (-538.517) (-540.407) [-537.345] * (-536.196) (-534.690) [-538.287] (-537.681) -- 0:00:37
      393000 -- (-537.709) [-534.199] (-534.300) (-536.336) * [-535.846] (-534.483) (-535.877) (-537.559) -- 0:00:37
      393500 -- (-536.284) (-537.696) [-536.171] (-535.734) * (-535.454) [-539.831] (-534.910) (-534.805) -- 0:00:36
      394000 -- (-538.232) (-537.848) (-536.878) [-535.987] * (-538.677) (-537.218) (-537.327) [-535.231] -- 0:00:36
      394500 -- (-539.179) (-535.604) (-538.035) [-537.157] * [-538.967] (-540.328) (-534.753) (-537.829) -- 0:00:36
      395000 -- [-538.919] (-535.468) (-536.229) (-536.273) * [-536.074] (-540.071) (-536.185) (-536.020) -- 0:00:36

      Average standard deviation of split frequencies: 0.009589

      395500 -- (-535.507) (-535.972) [-535.992] (-535.830) * (-538.660) (-539.195) [-536.237] (-536.536) -- 0:00:36
      396000 -- (-535.351) (-537.312) (-537.284) [-538.662] * (-536.108) (-536.329) [-536.343] (-537.265) -- 0:00:36
      396500 -- (-536.976) (-534.783) (-536.414) [-535.884] * (-541.160) (-537.663) (-537.611) [-535.172] -- 0:00:36
      397000 -- (-536.132) [-534.375] (-535.614) (-538.231) * (-535.614) [-537.092] (-536.019) (-536.196) -- 0:00:36
      397500 -- (-536.210) [-536.916] (-535.498) (-537.036) * (-535.142) [-535.816] (-539.033) (-534.958) -- 0:00:36
      398000 -- (-536.571) [-534.477] (-534.886) (-539.913) * (-534.970) [-535.164] (-536.541) (-543.539) -- 0:00:36
      398500 -- [-536.619] (-536.433) (-536.974) (-542.463) * [-538.681] (-538.342) (-539.931) (-538.688) -- 0:00:36
      399000 -- (-536.670) [-535.296] (-537.212) (-540.572) * (-538.655) (-537.326) [-537.764] (-536.530) -- 0:00:36
      399500 -- (-536.801) [-534.439] (-541.572) (-538.728) * (-535.962) [-536.548] (-534.697) (-536.227) -- 0:00:36
      400000 -- (-536.974) (-535.872) (-535.215) [-534.818] * (-535.490) [-534.972] (-536.240) (-539.408) -- 0:00:36

      Average standard deviation of split frequencies: 0.010104

      400500 -- [-537.435] (-535.848) (-539.516) (-536.469) * (-538.754) [-534.794] (-540.562) (-535.775) -- 0:00:35
      401000 -- (-536.257) (-536.417) (-541.530) [-535.516] * (-540.384) (-535.690) [-535.578] (-539.595) -- 0:00:35
      401500 -- (-538.172) (-535.712) [-537.431] (-537.682) * (-537.154) (-535.271) (-536.725) [-537.671] -- 0:00:35
      402000 -- (-536.594) (-538.200) [-536.153] (-535.466) * (-538.921) [-537.921] (-538.251) (-540.766) -- 0:00:35
      402500 -- [-535.054] (-536.531) (-534.767) (-534.524) * (-540.691) [-536.724] (-538.157) (-537.955) -- 0:00:35
      403000 -- (-534.678) (-536.293) (-534.597) [-536.462] * (-538.465) [-536.042] (-541.998) (-538.257) -- 0:00:35
      403500 -- [-534.544] (-536.160) (-536.129) (-535.411) * (-535.447) (-535.051) (-536.627) [-538.126] -- 0:00:35
      404000 -- (-535.133) [-535.929] (-536.088) (-536.792) * (-534.617) (-538.173) [-535.489] (-537.068) -- 0:00:36
      404500 -- [-536.846] (-535.543) (-537.948) (-538.575) * (-537.845) [-534.950] (-537.323) (-536.753) -- 0:00:36
      405000 -- [-536.825] (-539.629) (-535.573) (-536.701) * (-535.309) [-535.916] (-535.341) (-535.871) -- 0:00:36

      Average standard deviation of split frequencies: 0.010586

      405500 -- [-537.520] (-543.585) (-536.875) (-536.759) * (-537.964) [-535.162] (-536.401) (-535.233) -- 0:00:36
      406000 -- (-535.425) (-540.324) [-538.333] (-535.578) * (-536.330) (-536.992) (-535.497) [-534.583] -- 0:00:36
      406500 -- (-535.351) (-536.932) [-535.523] (-536.570) * (-537.715) [-535.175] (-539.458) (-537.331) -- 0:00:36
      407000 -- (-534.685) (-538.827) [-535.553] (-537.652) * (-535.454) (-535.291) (-535.871) [-535.849] -- 0:00:36
      407500 -- [-535.731] (-537.831) (-540.883) (-535.503) * (-535.897) [-534.046] (-538.394) (-535.536) -- 0:00:36
      408000 -- (-534.231) (-536.019) (-540.042) [-535.372] * (-536.721) [-538.589] (-536.874) (-537.241) -- 0:00:36
      408500 -- [-535.365] (-541.746) (-536.242) (-535.732) * (-535.743) (-536.790) (-537.442) [-535.708] -- 0:00:36
      409000 -- [-537.974] (-537.973) (-535.593) (-535.018) * (-538.384) (-537.244) [-545.727] (-534.932) -- 0:00:36
      409500 -- (-540.945) [-535.579] (-536.281) (-537.636) * (-538.759) (-539.100) (-540.048) [-536.931] -- 0:00:36
      410000 -- (-543.931) [-534.333] (-536.898) (-534.816) * (-541.663) [-536.903] (-538.122) (-537.795) -- 0:00:35

      Average standard deviation of split frequencies: 0.010534

      410500 -- (-535.538) (-537.229) (-537.073) [-535.830] * [-534.659] (-537.679) (-535.298) (-536.030) -- 0:00:35
      411000 -- (-539.558) [-536.533] (-537.692) (-535.094) * (-537.579) (-535.588) [-536.956] (-536.279) -- 0:00:35
      411500 -- (-540.457) [-537.100] (-534.988) (-535.593) * (-535.838) (-535.725) (-536.805) [-535.595] -- 0:00:35
      412000 -- (-536.185) (-537.771) (-537.848) [-537.699] * (-536.126) [-540.022] (-535.671) (-534.673) -- 0:00:35
      412500 -- (-537.417) [-538.334] (-534.877) (-536.770) * (-535.986) (-538.913) [-534.943] (-536.111) -- 0:00:35
      413000 -- (-536.634) (-539.715) [-538.649] (-538.017) * [-535.976] (-536.346) (-535.546) (-535.528) -- 0:00:35
      413500 -- (-536.538) [-536.002] (-534.856) (-536.256) * (-536.707) (-535.484) [-535.000] (-536.341) -- 0:00:35
      414000 -- (-535.785) [-535.540] (-539.335) (-537.708) * (-537.225) (-535.989) (-536.535) [-538.688] -- 0:00:35
      414500 -- (-536.003) (-536.130) (-535.763) [-537.645] * (-537.191) (-537.993) [-536.315] (-538.360) -- 0:00:35
      415000 -- (-538.232) (-535.711) (-537.535) [-535.126] * (-536.448) (-541.162) [-535.987] (-537.380) -- 0:00:35

      Average standard deviation of split frequencies: 0.010269

      415500 -- (-534.543) (-535.558) [-535.185] (-536.785) * (-536.793) (-535.815) (-534.885) [-534.142] -- 0:00:35
      416000 -- (-535.842) [-535.429] (-535.706) (-534.967) * (-537.239) (-537.928) [-536.340] (-534.070) -- 0:00:35
      416500 -- [-538.465] (-538.045) (-537.296) (-536.958) * (-535.801) (-535.914) (-535.561) [-535.032] -- 0:00:35
      417000 -- [-535.311] (-543.449) (-538.107) (-537.194) * (-535.689) (-539.270) (-538.057) [-535.779] -- 0:00:34
      417500 -- [-536.433] (-534.541) (-537.641) (-537.983) * (-535.302) [-535.026] (-537.391) (-536.442) -- 0:00:34
      418000 -- [-537.348] (-534.321) (-539.472) (-542.404) * [-538.298] (-535.740) (-536.735) (-535.239) -- 0:00:34
      418500 -- (-535.216) (-537.213) [-535.887] (-539.698) * (-539.876) (-535.487) [-537.759] (-535.728) -- 0:00:34
      419000 -- (-534.585) [-535.903] (-536.496) (-535.903) * (-537.077) (-536.447) (-538.239) [-536.852] -- 0:00:34
      419500 -- (-536.194) (-536.348) [-535.875] (-536.130) * (-535.554) (-537.534) [-537.439] (-535.584) -- 0:00:34
      420000 -- (-540.781) (-534.884) (-536.020) [-535.236] * (-535.053) (-537.261) [-538.960] (-539.176) -- 0:00:34

      Average standard deviation of split frequencies: 0.010226

      420500 -- (-535.344) [-534.093] (-536.142) (-537.016) * (-537.848) (-543.711) (-536.434) [-535.924] -- 0:00:34
      421000 -- (-535.094) (-536.580) (-535.592) [-536.907] * (-538.146) (-537.176) (-535.798) [-536.350] -- 0:00:35
      421500 -- [-538.464] (-535.361) (-534.617) (-538.173) * (-536.047) [-536.684] (-541.968) (-535.441) -- 0:00:35
      422000 -- [-536.941] (-534.524) (-534.701) (-536.111) * (-536.492) [-534.953] (-535.562) (-535.890) -- 0:00:35
      422500 -- (-539.443) [-535.597] (-539.278) (-536.621) * (-538.870) (-536.263) (-535.726) [-535.141] -- 0:00:35
      423000 -- (-534.503) (-535.790) (-535.738) [-535.146] * [-535.596] (-535.427) (-537.028) (-535.470) -- 0:00:35
      423500 -- (-536.561) (-534.292) [-536.257] (-535.035) * (-536.842) [-534.818] (-538.458) (-537.057) -- 0:00:35
      424000 -- [-535.655] (-536.253) (-538.491) (-539.243) * (-540.178) [-534.762] (-540.375) (-540.481) -- 0:00:35
      424500 -- (-537.186) (-536.215) (-537.853) [-536.497] * (-536.207) (-539.463) [-534.913] (-543.297) -- 0:00:35
      425000 -- (-538.565) (-536.942) (-536.034) [-534.754] * (-537.196) (-540.736) [-535.427] (-541.407) -- 0:00:35

      Average standard deviation of split frequencies: 0.009959

      425500 -- (-534.833) (-536.504) (-540.299) [-535.500] * (-535.626) (-538.569) (-535.851) [-535.266] -- 0:00:35
      426000 -- [-535.203] (-536.961) (-538.813) (-536.067) * (-537.072) (-537.538) (-539.306) [-534.385] -- 0:00:35
      426500 -- (-535.745) [-535.940] (-536.695) (-535.148) * (-537.302) (-534.787) (-534.270) [-538.079] -- 0:00:34
      427000 -- [-537.429] (-546.730) (-537.948) (-536.679) * (-537.550) [-538.937] (-540.259) (-535.109) -- 0:00:34
      427500 -- (-536.310) (-541.656) [-535.656] (-535.780) * (-537.044) [-535.449] (-540.787) (-537.171) -- 0:00:34
      428000 -- [-536.614] (-541.757) (-536.264) (-539.859) * (-535.197) (-536.096) [-539.745] (-535.209) -- 0:00:34
      428500 -- [-535.009] (-535.714) (-539.028) (-536.896) * (-538.100) [-536.038] (-543.183) (-534.305) -- 0:00:34
      429000 -- (-535.854) [-535.754] (-536.916) (-535.724) * (-537.560) (-534.942) (-535.100) [-536.005] -- 0:00:34
      429500 -- (-536.553) (-538.278) [-535.614] (-537.179) * (-535.471) [-534.675] (-535.897) (-537.039) -- 0:00:34
      430000 -- [-536.425] (-537.245) (-535.123) (-537.903) * (-536.916) (-535.238) (-536.237) [-535.755] -- 0:00:34

      Average standard deviation of split frequencies: 0.009594

      430500 -- (-535.747) [-535.422] (-536.494) (-542.058) * (-540.045) [-534.715] (-535.921) (-534.578) -- 0:00:34
      431000 -- (-540.259) (-535.079) (-535.617) [-540.802] * (-538.921) (-537.024) [-535.489] (-536.997) -- 0:00:34
      431500 -- (-535.585) [-535.422] (-536.033) (-539.285) * (-542.416) [-536.223] (-540.390) (-534.929) -- 0:00:34
      432000 -- (-535.408) (-535.367) (-536.643) [-535.342] * (-537.034) (-539.637) [-537.859] (-536.671) -- 0:00:34
      432500 -- (-538.083) (-534.893) [-535.096] (-535.165) * (-535.613) [-535.471] (-539.854) (-535.814) -- 0:00:34
      433000 -- (-534.585) [-534.812] (-537.321) (-534.998) * (-536.522) (-537.194) [-536.062] (-535.492) -- 0:00:34
      433500 -- (-536.827) (-536.529) [-537.016] (-536.838) * (-535.601) (-539.350) [-537.659] (-537.607) -- 0:00:33
      434000 -- (-534.510) (-540.417) (-536.326) [-538.142] * (-540.343) [-535.872] (-539.328) (-536.443) -- 0:00:33
      434500 -- (-539.663) (-540.303) (-535.789) [-535.479] * (-540.245) [-536.831] (-535.956) (-536.337) -- 0:00:33
      435000 -- (-536.520) (-539.275) (-535.860) [-535.759] * (-534.520) (-536.330) [-534.908] (-535.216) -- 0:00:33

      Average standard deviation of split frequencies: 0.008920

      435500 -- (-539.000) (-546.660) (-537.541) [-534.789] * [-534.542] (-535.117) (-537.919) (-534.802) -- 0:00:33
      436000 -- [-535.839] (-542.976) (-535.459) (-535.554) * (-537.787) [-536.739] (-535.271) (-536.726) -- 0:00:33
      436500 -- (-536.880) [-536.793] (-537.717) (-541.191) * (-535.844) (-538.789) [-534.310] (-536.812) -- 0:00:33
      437000 -- (-535.165) (-536.913) (-540.913) [-541.243] * [-536.680] (-538.288) (-535.587) (-534.964) -- 0:00:34
      437500 -- (-535.762) [-537.254] (-538.794) (-546.218) * (-537.493) (-536.053) (-536.890) [-535.343] -- 0:00:34
      438000 -- (-538.511) (-540.894) (-535.994) [-539.250] * (-538.680) (-534.630) (-536.298) [-536.691] -- 0:00:34
      438500 -- (-536.368) (-535.969) [-534.907] (-537.834) * (-536.419) (-538.284) [-537.695] (-534.966) -- 0:00:34
      439000 -- (-535.527) (-535.371) [-534.947] (-537.426) * [-535.485] (-536.278) (-537.421) (-534.538) -- 0:00:34
      439500 -- [-534.978] (-539.295) (-534.952) (-537.222) * (-540.691) (-536.535) (-537.900) [-535.128] -- 0:00:34
      440000 -- (-537.421) [-535.678] (-537.230) (-535.029) * (-540.800) (-538.867) [-534.317] (-539.771) -- 0:00:34

      Average standard deviation of split frequencies: 0.009227

      440500 -- [-538.646] (-535.009) (-536.391) (-534.955) * [-540.169] (-536.651) (-534.371) (-535.684) -- 0:00:34
      441000 -- (-535.315) (-538.064) (-534.923) [-534.291] * (-538.662) (-541.971) [-536.274] (-535.160) -- 0:00:34
      441500 -- (-536.169) (-536.464) (-534.617) [-534.842] * (-538.455) (-537.975) (-537.386) [-539.442] -- 0:00:34
      442000 -- (-534.884) (-536.032) [-534.681] (-537.835) * (-537.720) (-536.125) (-539.668) [-536.454] -- 0:00:34
      442500 -- [-534.483] (-537.541) (-537.476) (-535.737) * (-539.574) (-535.424) (-549.291) [-537.868] -- 0:00:34
      443000 -- (-535.046) [-535.389] (-536.814) (-539.785) * (-540.756) (-534.462) (-535.332) [-535.557] -- 0:00:33
      443500 -- (-535.885) (-534.961) [-534.788] (-536.997) * (-539.752) [-534.414] (-535.163) (-539.971) -- 0:00:33
      444000 -- (-539.163) [-534.980] (-534.824) (-536.832) * (-543.309) (-534.378) [-535.317] (-534.886) -- 0:00:33
      444500 -- (-535.959) (-535.342) (-536.727) [-540.486] * (-539.899) [-534.356] (-540.483) (-537.272) -- 0:00:33
      445000 -- (-537.800) (-537.158) (-536.309) [-538.960] * (-537.409) [-536.269] (-539.590) (-536.731) -- 0:00:33

      Average standard deviation of split frequencies: 0.009314

      445500 -- (-534.248) (-535.463) (-537.600) [-539.540] * [-535.833] (-534.935) (-537.338) (-537.747) -- 0:00:33
      446000 -- (-538.051) (-534.839) (-539.055) [-536.024] * [-537.436] (-534.263) (-536.433) (-534.845) -- 0:00:33
      446500 -- (-534.518) (-538.315) (-536.686) [-535.108] * [-536.679] (-537.814) (-540.079) (-535.743) -- 0:00:33
      447000 -- (-537.452) [-534.186] (-536.153) (-538.760) * [-535.123] (-536.165) (-545.017) (-535.258) -- 0:00:33
      447500 -- (-536.408) [-534.880] (-536.487) (-535.438) * (-535.344) (-539.482) (-539.953) [-535.125] -- 0:00:33
      448000 -- (-536.549) (-536.185) [-540.819] (-535.459) * (-534.798) (-540.332) (-538.768) [-534.381] -- 0:00:33
      448500 -- (-538.776) [-536.318] (-538.301) (-541.039) * (-538.477) [-538.154] (-541.880) (-537.157) -- 0:00:33
      449000 -- (-535.925) (-535.790) (-538.194) [-536.289] * (-535.524) (-540.644) [-536.008] (-537.270) -- 0:00:33
      449500 -- (-536.021) (-535.301) [-535.959] (-539.935) * (-538.901) (-536.176) (-536.267) [-537.843] -- 0:00:33
      450000 -- (-538.492) [-535.993] (-536.062) (-538.443) * (-539.502) (-534.885) (-539.057) [-534.903] -- 0:00:33

      Average standard deviation of split frequencies: 0.009623

      450500 -- [-537.457] (-536.462) (-535.655) (-535.001) * (-542.627) [-535.552] (-535.562) (-537.134) -- 0:00:32
      451000 -- (-536.859) (-538.673) (-538.142) [-535.444] * (-542.104) (-535.289) [-536.820] (-536.521) -- 0:00:32
      451500 -- (-535.617) [-536.216] (-537.940) (-535.454) * [-536.993] (-535.045) (-536.209) (-535.849) -- 0:00:32
      452000 -- (-539.269) (-536.652) (-536.274) [-537.574] * (-535.000) (-536.581) (-535.024) [-535.812] -- 0:00:32
      452500 -- (-535.621) (-537.904) (-535.567) [-535.722] * (-536.060) (-536.009) (-540.430) [-537.750] -- 0:00:32
      453000 -- (-537.967) [-535.100] (-536.097) (-536.819) * (-536.115) [-536.627] (-538.649) (-536.317) -- 0:00:33
      453500 -- [-537.143] (-536.970) (-535.193) (-535.791) * (-534.502) [-536.279] (-535.510) (-541.506) -- 0:00:33
      454000 -- (-536.056) (-539.748) (-537.057) [-535.690] * (-534.427) (-537.803) (-535.385) [-536.956] -- 0:00:33
      454500 -- (-535.332) (-535.130) [-538.163] (-535.572) * (-534.407) (-536.405) [-537.356] (-536.951) -- 0:00:33
      455000 -- (-537.921) [-534.419] (-537.360) (-538.187) * (-536.440) (-535.173) [-537.189] (-536.566) -- 0:00:33

      Average standard deviation of split frequencies: 0.009562

      455500 -- (-535.491) (-534.510) [-537.000] (-536.056) * [-535.491] (-535.467) (-536.372) (-535.717) -- 0:00:33
      456000 -- [-536.491] (-536.648) (-539.845) (-540.545) * (-535.670) (-534.999) [-534.636] (-540.551) -- 0:00:33
      456500 -- (-536.953) (-538.045) [-537.688] (-539.994) * (-536.005) (-537.404) (-540.909) [-537.366] -- 0:00:33
      457000 -- (-539.074) [-535.089] (-536.537) (-537.380) * (-534.597) (-540.387) [-537.049] (-534.539) -- 0:00:33
      457500 -- (-536.771) (-536.494) [-535.576] (-535.905) * (-535.979) [-537.006] (-538.711) (-535.845) -- 0:00:33
      458000 -- (-535.731) (-537.622) (-535.059) [-535.177] * (-538.116) (-539.090) [-537.113] (-534.920) -- 0:00:33
      458500 -- (-536.856) (-536.711) [-537.560] (-536.967) * [-536.448] (-538.301) (-536.377) (-536.143) -- 0:00:33
      459000 -- [-539.254] (-539.337) (-537.546) (-536.821) * (-536.755) [-536.968] (-537.332) (-536.581) -- 0:00:33
      459500 -- (-535.783) (-538.951) [-535.445] (-540.656) * (-538.470) (-536.252) [-536.291] (-535.957) -- 0:00:32
      460000 -- (-535.581) (-538.923) (-536.422) [-543.586] * (-536.127) (-539.357) [-534.761] (-538.950) -- 0:00:32

      Average standard deviation of split frequencies: 0.009977

      460500 -- (-536.816) [-536.127] (-535.803) (-535.251) * (-540.666) (-538.962) [-536.469] (-538.107) -- 0:00:32
      461000 -- (-536.444) (-535.536) (-536.432) [-537.719] * (-538.548) (-536.752) (-538.714) [-537.448] -- 0:00:32
      461500 -- (-536.744) [-534.514] (-535.581) (-536.811) * (-540.287) [-536.594] (-538.576) (-535.050) -- 0:00:32
      462000 -- (-535.245) (-535.464) [-537.259] (-535.147) * (-539.531) (-535.757) [-537.312] (-536.224) -- 0:00:32
      462500 -- (-536.106) (-537.004) [-536.778] (-535.889) * [-535.666] (-535.224) (-534.502) (-536.589) -- 0:00:32
      463000 -- (-536.515) [-535.880] (-535.074) (-537.009) * (-534.278) (-534.843) (-537.308) [-536.389] -- 0:00:32
      463500 -- (-535.369) [-535.142] (-536.125) (-535.962) * (-536.199) [-534.479] (-537.838) (-536.118) -- 0:00:32
      464000 -- (-535.264) [-534.433] (-536.230) (-536.023) * (-535.567) [-535.508] (-538.974) (-535.159) -- 0:00:32
      464500 -- [-537.438] (-544.350) (-538.227) (-537.319) * [-536.426] (-536.154) (-534.500) (-535.681) -- 0:00:32
      465000 -- (-535.568) (-546.832) (-536.430) [-536.432] * (-537.137) (-535.483) (-535.304) [-536.073] -- 0:00:32

      Average standard deviation of split frequencies: 0.010116

      465500 -- (-538.117) [-536.913] (-535.481) (-536.211) * (-536.799) (-535.152) (-534.297) [-536.092] -- 0:00:32
      466000 -- (-536.513) (-535.393) (-536.348) [-537.370] * (-539.226) (-537.064) [-537.983] (-534.545) -- 0:00:32
      466500 -- [-536.013] (-534.546) (-537.621) (-536.116) * (-537.180) (-538.043) [-536.569] (-537.605) -- 0:00:32
      467000 -- (-535.379) (-536.549) [-535.504] (-534.960) * [-537.631] (-535.742) (-536.811) (-538.097) -- 0:00:31
      467500 -- (-535.674) (-535.331) (-535.541) [-538.347] * (-537.610) (-534.655) (-536.660) [-536.901] -- 0:00:31
      468000 -- (-535.362) [-536.177] (-541.095) (-539.778) * (-536.304) (-536.216) [-535.739] (-534.298) -- 0:00:32
      468500 -- (-536.770) (-541.772) [-538.559] (-535.610) * (-535.173) [-535.611] (-534.799) (-535.295) -- 0:00:32
      469000 -- (-538.616) (-539.453) [-540.930] (-536.862) * (-536.513) (-537.387) [-535.173] (-536.451) -- 0:00:32
      469500 -- (-537.742) (-541.510) [-539.495] (-535.436) * [-537.290] (-537.086) (-538.378) (-536.380) -- 0:00:32
      470000 -- (-537.851) (-539.457) [-540.213] (-534.793) * (-535.960) (-539.985) [-535.858] (-538.815) -- 0:00:32

      Average standard deviation of split frequencies: 0.010078

      470500 -- (-538.023) [-539.700] (-535.364) (-539.160) * (-536.069) (-535.047) [-534.669] (-538.666) -- 0:00:32
      471000 -- [-536.105] (-535.805) (-535.104) (-539.229) * (-536.289) (-534.324) [-537.057] (-537.418) -- 0:00:32
      471500 -- (-535.005) (-538.604) [-535.409] (-534.972) * (-535.676) [-535.910] (-537.820) (-535.386) -- 0:00:32
      472000 -- [-536.569] (-536.363) (-534.692) (-535.339) * (-535.618) (-534.913) [-540.180] (-537.639) -- 0:00:32
      472500 -- [-536.614] (-534.347) (-534.198) (-536.507) * (-534.949) (-536.216) [-537.261] (-534.707) -- 0:00:32
      473000 -- (-538.053) [-534.430] (-539.475) (-534.894) * [-536.914] (-535.951) (-534.501) (-537.206) -- 0:00:32
      473500 -- (-535.142) (-535.606) (-537.459) [-534.883] * [-537.264] (-539.101) (-541.836) (-536.000) -- 0:00:32
      474000 -- (-535.795) (-537.021) [-539.625] (-535.270) * (-534.890) (-539.457) [-537.838] (-537.747) -- 0:00:32
      474500 -- [-536.839] (-541.050) (-536.523) (-535.312) * (-535.859) (-537.657) [-540.902] (-537.974) -- 0:00:32
      475000 -- (-536.015) [-538.047] (-539.617) (-536.556) * (-537.100) (-534.337) (-541.485) [-536.389] -- 0:00:32

      Average standard deviation of split frequencies: 0.010399

      475500 -- (-536.125) (-537.155) [-536.057] (-542.122) * (-535.051) (-536.464) (-534.274) [-538.387] -- 0:00:31
      476000 -- (-537.756) (-536.490) [-536.224] (-534.777) * [-535.422] (-537.476) (-535.652) (-534.336) -- 0:00:31
      476500 -- [-536.142] (-537.830) (-535.965) (-535.487) * (-535.632) (-534.240) (-535.695) [-534.658] -- 0:00:31
      477000 -- [-536.566] (-547.229) (-535.419) (-537.179) * (-535.863) [-541.600] (-535.160) (-536.647) -- 0:00:31
      477500 -- [-539.768] (-543.340) (-535.558) (-538.048) * (-535.026) (-536.050) [-534.742] (-539.141) -- 0:00:31
      478000 -- (-539.132) [-534.785] (-535.655) (-535.598) * [-534.912] (-534.886) (-537.066) (-537.697) -- 0:00:31
      478500 -- (-538.193) (-534.824) [-534.461] (-535.465) * (-534.252) [-534.391] (-538.196) (-536.211) -- 0:00:31
      479000 -- (-543.169) (-534.577) (-537.216) [-536.911] * (-535.929) (-538.357) (-534.736) [-534.889] -- 0:00:31
      479500 -- (-535.089) (-537.650) [-535.952] (-535.134) * [-538.363] (-536.366) (-537.349) (-535.494) -- 0:00:31
      480000 -- (-541.445) (-539.597) (-536.938) [-534.894] * [-537.040] (-536.044) (-534.989) (-539.451) -- 0:00:31

      Average standard deviation of split frequencies: 0.010665

      480500 -- (-536.871) (-536.015) (-536.428) [-536.744] * [-539.323] (-536.161) (-536.271) (-539.218) -- 0:00:31
      481000 -- [-535.873] (-535.547) (-535.466) (-534.101) * (-537.047) (-535.597) (-536.188) [-535.439] -- 0:00:31
      481500 -- (-535.615) [-534.572] (-536.965) (-536.847) * [-537.024] (-535.184) (-536.014) (-535.602) -- 0:00:31
      482000 -- [-535.237] (-537.163) (-539.283) (-535.576) * (-534.973) [-538.066] (-536.935) (-536.922) -- 0:00:31
      482500 -- [-536.666] (-536.620) (-541.180) (-534.884) * (-536.714) (-535.674) [-535.782] (-534.955) -- 0:00:31
      483000 -- (-536.219) [-534.966] (-542.501) (-535.289) * (-539.728) (-534.708) (-536.988) [-534.914] -- 0:00:31
      483500 -- (-534.571) (-536.644) [-535.107] (-536.988) * (-535.453) (-536.428) (-534.774) [-536.953] -- 0:00:30
      484000 -- (-534.744) [-536.560] (-536.496) (-535.059) * [-535.226] (-536.588) (-536.065) (-543.384) -- 0:00:30
      484500 -- (-539.914) (-537.886) (-536.787) [-534.943] * (-535.164) [-537.680] (-535.184) (-537.956) -- 0:00:30
      485000 -- [-536.700] (-535.015) (-538.475) (-538.813) * [-540.613] (-537.203) (-534.981) (-537.791) -- 0:00:31

      Average standard deviation of split frequencies: 0.010852

      485500 -- (-535.354) [-538.602] (-539.179) (-539.176) * (-537.922) [-535.181] (-538.979) (-537.285) -- 0:00:31
      486000 -- (-536.796) [-534.881] (-542.154) (-535.851) * (-536.587) [-538.348] (-535.805) (-536.552) -- 0:00:31
      486500 -- (-537.845) [-537.416] (-537.627) (-535.886) * [-536.263] (-535.513) (-536.194) (-539.534) -- 0:00:31
      487000 -- (-539.735) [-534.482] (-534.071) (-537.933) * (-536.418) [-534.646] (-536.771) (-537.774) -- 0:00:31
      487500 -- (-537.564) (-535.217) (-538.055) [-538.055] * [-535.534] (-537.071) (-537.139) (-536.094) -- 0:00:31
      488000 -- [-536.128] (-538.715) (-538.774) (-534.943) * (-537.679) (-535.409) [-536.093] (-539.408) -- 0:00:31
      488500 -- [-534.880] (-535.619) (-537.038) (-535.674) * [-536.710] (-539.895) (-534.602) (-536.646) -- 0:00:31
      489000 -- (-536.950) (-535.952) [-538.236] (-535.466) * (-536.972) (-535.895) (-536.341) [-535.280] -- 0:00:31
      489500 -- (-534.919) (-536.654) [-534.558] (-535.134) * (-534.946) (-536.310) (-537.127) [-537.347] -- 0:00:31
      490000 -- (-536.156) [-534.237] (-536.042) (-535.606) * [-534.666] (-534.765) (-536.046) (-539.072) -- 0:00:31

      Average standard deviation of split frequencies: 0.010628

      490500 -- (-539.081) [-534.997] (-541.373) (-535.985) * [-534.483] (-536.343) (-538.966) (-537.143) -- 0:00:31
      491000 -- [-535.033] (-539.129) (-540.001) (-536.153) * (-539.764) (-535.174) [-535.865] (-538.518) -- 0:00:31
      491500 -- (-536.552) [-536.087] (-537.044) (-536.676) * (-539.724) [-534.906] (-538.932) (-537.661) -- 0:00:31
      492000 -- (-536.948) (-537.516) (-536.338) [-535.329] * (-535.529) (-536.708) [-536.933] (-537.056) -- 0:00:30
      492500 -- (-537.979) (-536.668) (-536.252) [-535.360] * (-537.959) (-536.509) (-538.110) [-537.405] -- 0:00:30
      493000 -- (-535.171) (-538.971) [-536.622] (-535.772) * (-538.114) (-536.748) (-535.033) [-537.961] -- 0:00:30
      493500 -- [-534.968] (-535.190) (-535.192) (-534.635) * (-537.732) (-536.634) (-537.160) [-534.331] -- 0:00:30
      494000 -- [-536.610] (-536.167) (-535.615) (-534.424) * (-536.800) (-540.696) [-535.715] (-536.781) -- 0:00:30
      494500 -- (-539.973) (-537.274) [-536.399] (-535.723) * (-535.126) (-536.782) (-535.233) [-539.057] -- 0:00:30
      495000 -- (-535.606) (-537.983) (-536.385) [-536.302] * (-537.548) [-536.521] (-536.665) (-537.598) -- 0:00:30

      Average standard deviation of split frequencies: 0.010870

      495500 -- (-534.564) (-537.520) (-537.681) [-536.816] * (-534.880) (-537.880) (-536.039) [-535.516] -- 0:00:30
      496000 -- [-535.316] (-536.178) (-537.864) (-535.352) * [-534.952] (-537.863) (-536.868) (-540.817) -- 0:00:30
      496500 -- (-539.265) (-538.683) (-535.550) [-536.616] * (-534.813) [-535.789] (-535.119) (-542.750) -- 0:00:30
      497000 -- (-537.591) [-535.247] (-537.568) (-535.009) * (-538.752) (-535.789) (-537.392) [-536.969] -- 0:00:30
      497500 -- (-535.170) [-534.525] (-538.055) (-536.008) * (-535.430) (-535.995) [-538.320] (-536.850) -- 0:00:30
      498000 -- (-536.606) [-534.898] (-536.384) (-536.276) * (-536.645) [-539.661] (-537.571) (-536.781) -- 0:00:30
      498500 -- (-535.856) [-535.849] (-537.612) (-535.575) * (-540.653) [-534.355] (-536.320) (-537.761) -- 0:00:30
      499000 -- [-538.967] (-537.004) (-536.202) (-537.043) * (-534.894) [-536.936] (-535.586) (-537.590) -- 0:00:30
      499500 -- [-538.894] (-535.819) (-536.003) (-541.304) * (-538.449) (-537.558) (-535.157) [-539.201] -- 0:00:30
      500000 -- (-534.686) (-536.764) (-536.855) [-538.111] * (-538.480) [-535.305] (-537.214) (-534.997) -- 0:00:30

      Average standard deviation of split frequencies: 0.011240

      500500 -- [-536.096] (-539.077) (-536.037) (-535.871) * (-537.351) (-538.698) [-538.226] (-534.902) -- 0:00:29
      501000 -- [-535.621] (-535.338) (-535.411) (-538.644) * (-535.198) (-536.814) [-537.324] (-538.032) -- 0:00:29
      501500 -- (-535.188) (-540.063) [-535.245] (-536.631) * (-536.151) (-535.016) (-536.387) [-537.812] -- 0:00:29
      502000 -- (-535.107) [-535.244] (-534.941) (-535.694) * (-535.704) [-535.529] (-535.799) (-535.238) -- 0:00:30
      502500 -- (-535.077) (-535.441) (-539.086) [-536.331] * [-534.801] (-536.781) (-538.246) (-537.414) -- 0:00:30
      503000 -- (-536.319) [-535.451] (-540.719) (-534.834) * (-536.090) [-535.923] (-536.361) (-536.536) -- 0:00:30
      503500 -- (-537.295) (-535.753) [-534.898] (-535.041) * (-536.251) (-535.427) (-536.570) [-536.634] -- 0:00:30
      504000 -- (-538.885) (-539.275) [-534.444] (-538.085) * [-538.338] (-535.659) (-534.442) (-536.621) -- 0:00:30
      504500 -- [-536.309] (-540.385) (-536.868) (-536.499) * [-537.764] (-536.496) (-534.614) (-537.607) -- 0:00:30
      505000 -- [-538.218] (-538.485) (-535.209) (-537.156) * [-539.280] (-535.786) (-538.833) (-539.545) -- 0:00:30

      Average standard deviation of split frequencies: 0.011180

      505500 -- (-536.222) [-537.181] (-536.789) (-534.883) * [-539.143] (-536.773) (-537.270) (-534.882) -- 0:00:30
      506000 -- (-538.002) (-535.082) [-534.795] (-537.130) * (-537.912) (-537.028) (-537.964) [-538.201] -- 0:00:30
      506500 -- [-536.697] (-535.662) (-536.247) (-538.216) * (-537.510) [-534.715] (-537.996) (-537.339) -- 0:00:30
      507000 -- (-536.379) [-537.607] (-536.241) (-535.457) * [-535.733] (-535.300) (-537.285) (-534.658) -- 0:00:30
      507500 -- (-535.255) (-536.430) [-538.516] (-536.585) * [-540.489] (-539.246) (-535.779) (-535.642) -- 0:00:30
      508000 -- [-535.079] (-538.573) (-539.060) (-535.002) * (-536.709) (-537.159) [-534.905] (-538.480) -- 0:00:30
      508500 -- [-536.355] (-535.513) (-536.662) (-542.964) * (-535.203) (-538.829) [-534.752] (-542.016) -- 0:00:29
      509000 -- (-538.090) [-535.762] (-535.674) (-542.125) * (-536.529) (-542.653) [-536.926] (-538.118) -- 0:00:29
      509500 -- (-539.153) (-534.878) [-537.429] (-535.622) * (-536.599) (-534.381) [-536.258] (-535.855) -- 0:00:29
      510000 -- [-536.780] (-539.287) (-536.158) (-541.254) * (-535.250) (-535.831) [-536.391] (-536.322) -- 0:00:29

      Average standard deviation of split frequencies: 0.010270

      510500 -- [-535.888] (-541.027) (-535.621) (-534.527) * (-535.225) (-537.605) [-536.714] (-538.002) -- 0:00:29
      511000 -- (-534.341) (-539.033) [-535.942] (-536.452) * (-538.602) (-538.911) [-537.113] (-540.006) -- 0:00:29
      511500 -- (-536.831) (-537.267) [-536.013] (-535.816) * (-536.320) (-539.276) [-535.596] (-536.516) -- 0:00:29
      512000 -- [-534.848] (-535.643) (-535.211) (-537.643) * (-536.331) (-537.308) [-534.874] (-535.945) -- 0:00:29
      512500 -- (-537.470) (-538.300) [-535.880] (-538.919) * (-536.961) [-538.269] (-535.156) (-535.857) -- 0:00:29
      513000 -- (-540.424) [-538.303] (-537.272) (-538.266) * [-536.965] (-535.969) (-535.281) (-536.297) -- 0:00:29
      513500 -- [-535.653] (-536.574) (-535.926) (-535.065) * [-536.994] (-534.508) (-537.625) (-536.600) -- 0:00:29
      514000 -- (-535.731) (-540.332) (-535.187) [-535.518] * (-537.621) (-534.882) (-534.988) [-535.983] -- 0:00:29
      514500 -- (-541.447) (-536.698) (-535.276) [-538.918] * (-538.120) (-535.003) (-534.946) [-535.952] -- 0:00:29
      515000 -- (-540.773) (-534.407) [-538.393] (-537.248) * [-535.434] (-539.590) (-539.706) (-535.563) -- 0:00:29

      Average standard deviation of split frequencies: 0.009318

      515500 -- (-536.595) (-536.026) [-536.422] (-536.113) * (-536.676) (-541.619) [-537.896] (-535.189) -- 0:00:29
      516000 -- [-536.414] (-534.349) (-540.970) (-536.534) * (-534.607) (-536.227) (-537.432) [-537.928] -- 0:00:29
      516500 -- (-536.327) (-537.511) (-541.884) [-535.096] * (-538.824) (-535.406) [-537.290] (-538.264) -- 0:00:29
      517000 -- (-535.965) (-537.855) (-541.347) [-536.062] * (-540.740) (-539.674) [-540.758] (-540.664) -- 0:00:28
      517500 -- (-534.481) (-536.023) [-536.243] (-538.267) * (-536.218) (-539.332) (-537.375) [-537.814] -- 0:00:28
      518000 -- [-535.909] (-536.908) (-534.164) (-536.115) * (-537.230) (-541.015) (-534.883) [-534.613] -- 0:00:28
      518500 -- [-535.438] (-535.435) (-535.504) (-534.836) * (-536.281) [-537.123] (-535.577) (-535.633) -- 0:00:28
      519000 -- (-535.592) (-535.982) (-537.548) [-535.095] * (-536.491) [-538.205] (-536.254) (-535.329) -- 0:00:29
      519500 -- (-534.887) (-538.300) (-539.940) [-536.285] * (-537.109) [-534.796] (-536.926) (-534.602) -- 0:00:29
      520000 -- [-535.211] (-535.309) (-536.522) (-535.835) * (-535.819) (-540.484) [-535.430] (-536.928) -- 0:00:29

      Average standard deviation of split frequencies: 0.009175

      520500 -- (-534.180) (-534.697) (-537.459) [-535.282] * (-537.286) (-540.270) (-534.569) [-534.864] -- 0:00:29
      521000 -- [-535.868] (-536.793) (-536.283) (-538.105) * [-535.446] (-537.989) (-535.687) (-537.234) -- 0:00:29
      521500 -- [-537.656] (-534.938) (-534.626) (-535.861) * (-535.356) (-536.334) (-534.522) [-538.450] -- 0:00:29
      522000 -- (-537.301) (-537.449) [-536.370] (-538.033) * (-538.134) (-535.625) [-538.092] (-537.672) -- 0:00:29
      522500 -- (-535.125) (-535.309) [-535.071] (-537.205) * [-540.134] (-538.478) (-536.330) (-536.247) -- 0:00:29
      523000 -- [-534.481] (-537.150) (-534.765) (-535.168) * (-537.078) [-540.113] (-538.186) (-536.106) -- 0:00:29
      523500 -- (-539.237) [-536.730] (-534.542) (-537.764) * [-536.115] (-537.018) (-534.523) (-534.173) -- 0:00:29
      524000 -- [-537.036] (-535.368) (-540.406) (-537.104) * (-534.972) (-537.216) [-535.574] (-538.485) -- 0:00:29
      524500 -- [-534.808] (-534.226) (-534.970) (-540.315) * (-534.748) (-535.124) (-539.838) [-536.313] -- 0:00:29
      525000 -- (-536.960) [-536.122] (-537.460) (-537.126) * (-536.796) (-535.541) [-535.973] (-537.728) -- 0:00:28

      Average standard deviation of split frequencies: 0.009466

      525500 -- (-538.887) [-536.216] (-535.966) (-535.580) * (-536.009) [-536.796] (-534.976) (-536.539) -- 0:00:28
      526000 -- [-538.016] (-535.369) (-541.392) (-536.357) * (-536.055) (-538.739) (-538.514) [-538.374] -- 0:00:28
      526500 -- [-537.647] (-536.476) (-536.551) (-538.457) * (-538.072) (-535.071) [-534.932] (-538.345) -- 0:00:28
      527000 -- (-535.157) [-536.256] (-537.934) (-536.724) * (-535.673) (-537.448) (-536.666) [-537.981] -- 0:00:28
      527500 -- [-537.885] (-537.334) (-538.826) (-536.330) * [-535.648] (-536.205) (-537.245) (-540.322) -- 0:00:28
      528000 -- (-535.352) (-534.579) (-537.781) [-535.004] * (-547.118) [-537.011] (-536.535) (-538.634) -- 0:00:28
      528500 -- (-536.401) (-537.680) [-537.647] (-536.723) * (-535.711) [-536.772] (-535.885) (-537.081) -- 0:00:28
      529000 -- (-542.239) (-538.919) (-536.897) [-535.503] * (-534.478) (-536.773) [-535.007] (-538.189) -- 0:00:28
      529500 -- (-541.979) [-535.223] (-537.893) (-535.399) * (-534.089) (-536.917) [-536.616] (-538.494) -- 0:00:28
      530000 -- [-535.961] (-537.485) (-536.036) (-543.634) * [-534.446] (-535.563) (-535.979) (-538.137) -- 0:00:28

      Average standard deviation of split frequencies: 0.009535

      530500 -- (-535.501) (-535.288) (-535.766) [-538.836] * (-537.689) [-535.441] (-535.811) (-536.580) -- 0:00:28
      531000 -- [-537.295] (-538.731) (-535.137) (-534.259) * (-535.242) (-538.817) (-537.720) [-535.590] -- 0:00:28
      531500 -- [-534.625] (-538.174) (-536.076) (-538.195) * (-536.354) (-537.069) (-539.166) [-537.781] -- 0:00:28
      532000 -- (-537.585) (-534.845) (-536.620) [-535.766] * [-535.308] (-537.478) (-543.947) (-534.740) -- 0:00:28
      532500 -- (-535.943) (-535.366) (-536.746) [-535.623] * (-538.445) [-535.031] (-542.330) (-539.561) -- 0:00:28
      533000 -- (-537.160) [-535.449] (-534.473) (-535.406) * (-535.348) (-535.053) (-539.632) [-536.998] -- 0:00:28
      533500 -- [-536.388] (-536.307) (-534.432) (-538.159) * [-534.268] (-539.528) (-534.805) (-535.711) -- 0:00:27
      534000 -- [-536.718] (-539.313) (-535.645) (-535.184) * (-534.785) (-535.874) (-535.671) [-534.957] -- 0:00:27
      534500 -- (-536.882) (-536.952) [-537.877] (-538.015) * (-534.341) (-540.385) (-535.388) [-534.914] -- 0:00:27
      535000 -- (-537.545) [-541.167] (-535.307) (-538.775) * (-538.053) (-537.959) [-534.292] (-536.267) -- 0:00:27

      Average standard deviation of split frequencies: 0.009498

      535500 -- [-536.648] (-537.428) (-536.074) (-537.333) * [-536.328] (-535.185) (-537.973) (-537.878) -- 0:00:28
      536000 -- (-541.100) [-535.822] (-541.650) (-536.829) * (-537.163) (-536.926) (-538.351) [-537.814] -- 0:00:28
      536500 -- (-536.572) [-535.827] (-535.340) (-538.225) * (-534.948) (-534.889) [-535.930] (-539.245) -- 0:00:28
      537000 -- (-539.102) (-535.563) (-534.965) [-539.395] * (-535.051) [-534.704] (-540.211) (-536.301) -- 0:00:28
      537500 -- (-536.299) (-535.992) [-538.079] (-535.368) * (-538.952) (-538.847) (-538.693) [-537.765] -- 0:00:28
      538000 -- (-537.958) (-535.111) [-534.729] (-535.828) * (-538.217) (-537.414) [-536.845] (-534.237) -- 0:00:28
      538500 -- [-536.829] (-534.332) (-539.367) (-538.057) * (-535.598) [-536.283] (-536.383) (-536.770) -- 0:00:28
      539000 -- [-535.409] (-535.582) (-535.952) (-539.551) * (-534.710) (-537.685) [-536.764] (-535.991) -- 0:00:28
      539500 -- (-534.990) (-535.544) [-540.296] (-536.340) * (-535.791) (-534.974) [-534.501] (-534.613) -- 0:00:28
      540000 -- (-539.068) (-535.977) (-537.596) [-534.945] * (-536.118) (-534.826) [-534.346] (-535.009) -- 0:00:28

      Average standard deviation of split frequencies: 0.008951

      540500 -- (-538.691) (-537.704) (-537.314) [-534.988] * (-534.874) (-535.837) (-535.522) [-535.230] -- 0:00:28
      541000 -- (-538.283) (-536.655) (-537.320) [-535.733] * (-534.937) (-534.210) [-535.935] (-535.429) -- 0:00:27
      541500 -- (-536.435) (-539.086) [-534.602] (-535.689) * [-534.911] (-539.095) (-536.564) (-537.185) -- 0:00:27
      542000 -- (-537.571) (-534.483) [-537.796] (-536.347) * (-535.592) (-536.844) [-536.675] (-536.270) -- 0:00:27
      542500 -- (-536.488) (-536.522) (-536.594) [-538.925] * (-535.243) (-536.267) [-535.008] (-534.727) -- 0:00:27
      543000 -- [-536.963] (-535.760) (-535.210) (-535.593) * [-538.683] (-540.836) (-541.374) (-535.003) -- 0:00:27
      543500 -- (-536.966) (-534.741) (-535.160) [-539.155] * [-536.407] (-538.142) (-535.270) (-535.582) -- 0:00:27
      544000 -- (-535.533) (-537.398) [-535.551] (-535.510) * (-537.727) (-536.897) (-537.689) [-534.319] -- 0:00:27
      544500 -- (-537.047) (-538.423) (-536.184) [-537.658] * (-537.298) (-536.915) [-535.593] (-535.520) -- 0:00:27
      545000 -- (-535.603) (-538.476) (-536.039) [-536.793] * [-537.860] (-542.652) (-535.687) (-536.158) -- 0:00:27

      Average standard deviation of split frequencies: 0.009012

      545500 -- (-535.401) (-537.774) [-534.590] (-534.910) * (-544.410) [-540.222] (-537.272) (-536.823) -- 0:00:27
      546000 -- (-537.117) (-536.322) [-535.441] (-539.701) * (-537.345) (-534.352) [-537.391] (-538.345) -- 0:00:27
      546500 -- [-538.396] (-536.468) (-535.686) (-536.438) * (-534.919) [-538.750] (-537.902) (-535.332) -- 0:00:27
      547000 -- [-536.983] (-536.150) (-535.541) (-537.304) * (-535.704) (-535.905) [-535.980] (-536.289) -- 0:00:27
      547500 -- (-538.371) [-536.724] (-534.845) (-536.351) * [-537.898] (-535.639) (-537.010) (-536.524) -- 0:00:27
      548000 -- (-535.657) [-534.719] (-535.135) (-538.493) * (-535.772) (-534.799) [-535.832] (-534.910) -- 0:00:27
      548500 -- (-534.671) (-535.332) [-537.142] (-537.547) * (-537.658) [-537.017] (-537.848) (-534.305) -- 0:00:27
      549000 -- (-536.641) (-537.224) [-536.473] (-538.891) * (-536.028) (-536.643) [-537.472] (-540.045) -- 0:00:27
      549500 -- (-534.929) (-538.895) [-536.330] (-537.631) * (-539.600) (-537.630) (-539.112) [-537.625] -- 0:00:27
      550000 -- (-534.999) [-536.867] (-535.955) (-536.586) * (-539.910) [-535.088] (-536.536) (-537.457) -- 0:00:27

      Average standard deviation of split frequencies: 0.008400

      550500 -- (-537.409) (-535.239) (-540.192) [-535.568] * (-536.503) (-537.701) [-534.625] (-537.837) -- 0:00:26
      551000 -- (-535.226) (-537.028) (-538.787) [-535.801] * [-536.332] (-534.593) (-538.334) (-539.665) -- 0:00:26
      551500 -- (-537.042) (-534.360) (-538.024) [-536.513] * (-534.472) [-536.485] (-536.108) (-535.473) -- 0:00:26
      552000 -- (-539.801) [-534.805] (-535.602) (-535.130) * [-536.016] (-536.380) (-536.175) (-534.325) -- 0:00:27
      552500 -- [-534.664] (-536.769) (-535.498) (-537.653) * [-536.324] (-536.325) (-540.783) (-534.653) -- 0:00:27
      553000 -- [-537.999] (-536.070) (-536.802) (-538.601) * (-536.656) (-534.996) [-540.231] (-535.588) -- 0:00:27
      553500 -- (-538.886) (-538.689) [-536.631] (-534.760) * (-534.418) [-538.232] (-537.961) (-535.168) -- 0:00:27
      554000 -- (-537.526) [-536.497] (-537.460) (-535.762) * (-545.302) [-537.204] (-536.217) (-538.432) -- 0:00:27
      554500 -- (-534.739) (-538.985) (-536.042) [-535.221] * (-539.845) (-537.763) [-543.257] (-536.328) -- 0:00:27
      555000 -- (-534.990) [-538.771] (-540.521) (-535.708) * (-537.810) (-539.538) (-538.370) [-536.139] -- 0:00:27

      Average standard deviation of split frequencies: 0.007857

      555500 -- (-536.447) (-537.261) [-536.490] (-536.598) * (-535.511) [-539.431] (-537.014) (-536.920) -- 0:00:27
      556000 -- (-536.760) (-539.082) [-536.436] (-536.549) * [-538.784] (-534.682) (-538.331) (-534.689) -- 0:00:27
      556500 -- (-542.249) [-537.498] (-535.507) (-535.241) * [-536.039] (-534.864) (-538.559) (-534.852) -- 0:00:27
      557000 -- (-536.377) [-535.933] (-534.556) (-535.827) * [-534.864] (-536.906) (-539.844) (-536.475) -- 0:00:27
      557500 -- (-535.430) (-537.685) (-535.783) [-536.074] * (-535.305) [-536.760] (-536.459) (-536.802) -- 0:00:26
      558000 -- [-536.648] (-542.625) (-543.964) (-537.122) * [-534.920] (-534.907) (-538.212) (-535.375) -- 0:00:26
      558500 -- [-536.250] (-535.921) (-539.314) (-537.138) * (-539.642) [-535.883] (-534.646) (-537.754) -- 0:00:26
      559000 -- (-536.643) [-534.706] (-539.826) (-539.796) * (-537.041) (-536.226) (-536.662) [-535.920] -- 0:00:26
      559500 -- (-535.666) [-534.233] (-535.306) (-536.487) * (-542.927) (-538.663) [-536.586] (-539.027) -- 0:00:26
      560000 -- [-535.125] (-534.179) (-541.167) (-536.921) * (-536.656) [-541.339] (-540.812) (-535.067) -- 0:00:26

      Average standard deviation of split frequencies: 0.007791

      560500 -- [-534.574] (-535.094) (-535.599) (-535.413) * [-535.322] (-535.727) (-538.752) (-534.990) -- 0:00:26
      561000 -- (-534.948) (-534.833) [-535.809] (-536.072) * (-535.581) (-537.230) [-536.816] (-541.860) -- 0:00:26
      561500 -- (-540.533) [-537.042] (-536.817) (-535.859) * (-538.242) (-541.809) [-538.070] (-538.972) -- 0:00:26
      562000 -- (-537.816) (-534.894) (-535.959) [-536.395] * (-538.834) (-541.140) (-537.150) [-535.469] -- 0:00:26
      562500 -- (-537.781) [-534.485] (-536.532) (-534.499) * (-536.125) (-537.802) (-537.191) [-538.097] -- 0:00:26
      563000 -- (-534.752) (-534.816) (-539.350) [-536.032] * (-534.893) (-537.980) [-535.282] (-535.294) -- 0:00:26
      563500 -- (-536.753) [-536.821] (-534.479) (-535.388) * (-535.311) (-536.476) (-535.583) [-536.323] -- 0:00:26
      564000 -- [-534.590] (-536.250) (-535.592) (-535.136) * (-536.236) (-535.268) [-537.145] (-537.473) -- 0:00:26
      564500 -- (-535.044) (-536.899) (-536.992) [-535.406] * (-535.607) (-537.557) (-535.603) [-534.464] -- 0:00:26
      565000 -- (-538.672) (-536.254) [-537.252] (-535.549) * (-536.453) (-535.151) [-536.020] (-535.764) -- 0:00:26

      Average standard deviation of split frequencies: 0.007551

      565500 -- (-535.772) (-534.760) (-537.958) [-535.250] * (-535.109) [-535.153] (-535.995) (-539.809) -- 0:00:26
      566000 -- [-535.948] (-537.258) (-535.234) (-534.839) * (-540.108) [-540.598] (-537.094) (-536.878) -- 0:00:26
      566500 -- [-537.370] (-539.003) (-535.244) (-536.810) * [-534.942] (-536.484) (-537.873) (-536.098) -- 0:00:26
      567000 -- (-534.540) [-538.715] (-535.779) (-537.410) * (-534.273) (-535.372) [-535.567] (-534.716) -- 0:00:25
      567500 -- [-539.574] (-538.256) (-534.623) (-540.846) * (-536.298) (-537.332) (-538.398) [-535.509] -- 0:00:26
      568000 -- [-542.173] (-535.566) (-537.883) (-537.003) * (-535.263) (-539.080) [-535.599] (-535.262) -- 0:00:26
      568500 -- (-535.789) [-538.019] (-535.749) (-539.863) * (-534.922) (-535.486) (-536.097) [-535.231] -- 0:00:26
      569000 -- [-535.376] (-535.889) (-536.221) (-534.631) * (-535.128) [-535.367] (-537.394) (-536.221) -- 0:00:26
      569500 -- (-536.372) [-536.202] (-537.690) (-537.074) * (-535.048) (-536.444) (-536.327) [-536.502] -- 0:00:26
      570000 -- [-537.817] (-538.132) (-536.964) (-535.186) * (-535.060) (-535.508) (-536.560) [-539.049] -- 0:00:26

      Average standard deviation of split frequencies: 0.007324

      570500 -- [-534.578] (-537.534) (-535.996) (-538.042) * (-534.487) [-535.940] (-540.940) (-538.748) -- 0:00:26
      571000 -- (-543.437) (-536.817) (-534.792) [-535.279] * (-535.433) [-536.070] (-538.634) (-538.035) -- 0:00:26
      571500 -- (-535.726) (-535.164) [-536.592] (-536.104) * (-540.172) (-536.032) [-535.427] (-537.129) -- 0:00:26
      572000 -- (-535.897) (-535.164) [-537.329] (-537.955) * (-536.287) (-536.843) (-535.027) [-539.023] -- 0:00:26
      572500 -- (-535.808) [-536.007] (-535.773) (-535.913) * [-536.496] (-543.291) (-535.283) (-538.807) -- 0:00:26
      573000 -- [-534.678] (-539.232) (-536.950) (-535.624) * (-538.066) (-541.322) (-536.589) [-537.887] -- 0:00:26
      573500 -- (-534.981) (-536.252) (-538.217) [-536.670] * [-535.653] (-537.143) (-535.920) (-534.577) -- 0:00:26
      574000 -- (-538.976) (-535.168) [-536.732] (-538.669) * (-537.848) (-536.791) (-535.840) [-539.103] -- 0:00:25
      574500 -- (-534.231) (-534.959) (-537.430) [-535.648] * (-536.930) (-537.652) [-537.476] (-535.940) -- 0:00:25
      575000 -- (-535.768) (-535.259) (-537.916) [-537.657] * (-537.376) (-536.614) (-535.208) [-536.333] -- 0:00:25

      Average standard deviation of split frequencies: 0.006656

      575500 -- (-534.813) (-536.865) [-535.742] (-536.828) * [-535.536] (-535.316) (-537.118) (-534.955) -- 0:00:25
      576000 -- (-539.060) [-536.583] (-536.921) (-537.472) * [-536.062] (-535.723) (-535.933) (-541.446) -- 0:00:25
      576500 -- (-534.202) (-535.879) [-539.654] (-536.563) * (-535.960) (-535.031) (-534.751) [-540.349] -- 0:00:25
      577000 -- (-534.310) [-538.061] (-535.596) (-535.988) * (-536.837) (-538.206) [-535.486] (-537.969) -- 0:00:25
      577500 -- (-534.779) [-537.288] (-535.804) (-536.933) * (-536.665) (-535.639) [-534.968] (-537.432) -- 0:00:25
      578000 -- (-534.967) (-535.901) (-542.336) [-541.012] * (-534.605) (-536.640) [-537.105] (-538.206) -- 0:00:25
      578500 -- (-536.504) (-538.991) (-536.491) [-536.401] * [-535.171] (-537.577) (-536.577) (-540.669) -- 0:00:25
      579000 -- (-535.786) [-537.266] (-535.392) (-536.397) * (-536.636) (-535.775) [-535.684] (-537.857) -- 0:00:25
      579500 -- (-534.697) (-537.523) [-534.991] (-537.538) * (-538.101) [-535.774] (-535.816) (-538.369) -- 0:00:25
      580000 -- (-537.387) (-543.080) (-535.749) [-538.777] * (-537.642) (-535.500) [-537.087] (-536.273) -- 0:00:25

      Average standard deviation of split frequencies: 0.006819

      580500 -- (-537.769) [-537.103] (-539.946) (-541.031) * [-543.365] (-540.480) (-535.236) (-536.733) -- 0:00:25
      581000 -- [-535.343] (-537.169) (-540.633) (-537.051) * (-539.891) (-536.077) [-534.788] (-534.522) -- 0:00:25
      581500 -- (-538.615) [-536.533] (-536.108) (-534.845) * [-538.516] (-534.696) (-534.753) (-541.030) -- 0:00:25
      582000 -- (-534.131) (-536.806) (-536.310) [-537.452] * [-536.237] (-535.301) (-537.530) (-536.921) -- 0:00:25
      582500 -- [-534.688] (-535.956) (-535.610) (-537.590) * (-534.878) [-535.687] (-538.952) (-538.774) -- 0:00:25
      583000 -- (-537.409) (-536.129) [-538.817] (-539.957) * [-535.646] (-537.161) (-537.246) (-534.788) -- 0:00:25
      583500 -- (-538.270) [-536.613] (-535.865) (-537.118) * (-540.545) (-535.534) [-535.535] (-536.769) -- 0:00:24
      584000 -- (-537.531) (-538.886) (-537.208) [-534.794] * (-535.012) [-536.764] (-537.089) (-538.750) -- 0:00:25
      584500 -- (-536.817) (-539.348) (-536.038) [-537.818] * (-535.833) (-535.903) [-535.016] (-539.185) -- 0:00:25
      585000 -- [-537.620] (-536.513) (-538.230) (-535.875) * [-538.842] (-537.045) (-537.382) (-537.171) -- 0:00:25

      Average standard deviation of split frequencies: 0.007455

      585500 -- (-534.966) (-536.733) (-536.205) [-537.047] * (-537.077) (-538.477) [-536.251] (-536.794) -- 0:00:25
      586000 -- [-535.975] (-537.128) (-539.249) (-535.993) * (-535.201) [-536.455] (-538.195) (-540.457) -- 0:00:25
      586500 -- (-535.836) (-536.028) (-535.370) [-535.258] * (-540.250) (-541.306) (-539.597) [-535.986] -- 0:00:25
      587000 -- (-538.086) [-536.490] (-536.462) (-535.705) * (-537.164) [-539.444] (-540.590) (-536.916) -- 0:00:25
      587500 -- [-535.695] (-535.637) (-534.863) (-535.072) * (-536.703) (-537.477) (-536.437) [-535.400] -- 0:00:25
      588000 -- [-534.782] (-539.007) (-536.115) (-535.004) * (-535.276) (-535.667) (-535.302) [-535.244] -- 0:00:25
      588500 -- (-540.171) (-535.504) [-538.011] (-536.065) * (-535.579) (-535.121) [-539.498] (-537.461) -- 0:00:25
      589000 -- (-540.930) [-534.574] (-537.135) (-535.408) * (-539.463) (-537.777) (-538.603) [-535.605] -- 0:00:25
      589500 -- (-534.513) [-539.110] (-539.173) (-535.534) * (-536.187) (-534.980) [-534.713] (-536.294) -- 0:00:25
      590000 -- (-536.147) [-539.600] (-536.091) (-535.839) * (-534.376) (-535.041) [-534.629] (-536.152) -- 0:00:25

      Average standard deviation of split frequencies: 0.007746

      590500 -- (-538.525) [-538.973] (-536.131) (-537.258) * (-536.253) (-537.185) [-534.902] (-535.962) -- 0:00:24
      591000 -- (-535.732) [-536.427] (-535.448) (-534.802) * (-540.063) [-539.087] (-535.593) (-534.892) -- 0:00:24
      591500 -- (-535.706) (-538.773) (-535.268) [-536.851] * [-535.179] (-538.277) (-535.544) (-536.819) -- 0:00:24
      592000 -- [-537.788] (-534.916) (-535.785) (-536.917) * (-535.703) (-535.016) (-535.896) [-536.534] -- 0:00:24
      592500 -- (-541.812) [-534.987] (-535.516) (-537.082) * (-534.273) [-537.848] (-539.342) (-536.125) -- 0:00:24
      593000 -- (-536.719) (-537.044) (-536.191) [-536.336] * [-538.399] (-537.461) (-539.318) (-535.456) -- 0:00:24
      593500 -- (-536.688) (-536.934) (-537.787) [-536.437] * (-537.159) (-534.431) (-539.890) [-535.489] -- 0:00:24
      594000 -- (-535.639) [-535.739] (-536.860) (-537.766) * (-536.752) (-535.275) (-542.298) [-535.787] -- 0:00:24
      594500 -- (-538.943) [-535.633] (-536.611) (-535.002) * (-535.552) [-535.010] (-536.018) (-539.037) -- 0:00:24
      595000 -- [-535.637] (-537.477) (-539.666) (-536.365) * (-535.846) [-540.959] (-535.228) (-536.645) -- 0:00:24

      Average standard deviation of split frequencies: 0.007267

      595500 -- [-537.081] (-535.876) (-535.338) (-536.594) * (-538.835) (-535.608) (-535.879) [-537.151] -- 0:00:24
      596000 -- (-539.346) (-537.353) [-535.427] (-537.370) * (-538.962) (-537.737) (-535.603) [-534.404] -- 0:00:24
      596500 -- [-535.138] (-536.131) (-535.336) (-544.631) * [-537.278] (-536.131) (-536.896) (-535.285) -- 0:00:24
      597000 -- (-536.851) (-535.489) [-534.325] (-539.770) * (-537.836) [-539.418] (-537.473) (-536.027) -- 0:00:24
      597500 -- (-541.607) (-535.492) [-534.853] (-537.386) * (-537.834) (-538.848) [-535.571] (-538.789) -- 0:00:24
      598000 -- [-534.439] (-537.585) (-538.442) (-536.989) * (-535.152) (-538.331) (-537.373) [-537.710] -- 0:00:24
      598500 -- (-535.510) (-535.544) (-538.372) [-537.772] * (-537.991) [-538.636] (-536.998) (-534.571) -- 0:00:24
      599000 -- (-535.417) (-537.065) (-536.745) [-535.217] * (-542.169) (-535.931) (-535.130) [-535.417] -- 0:00:24
      599500 -- (-536.289) (-539.241) (-538.480) [-535.714] * (-537.689) [-534.537] (-535.876) (-536.084) -- 0:00:24
      600000 -- (-536.844) [-536.374] (-538.054) (-535.041) * (-540.544) (-534.602) (-535.793) [-534.980] -- 0:00:24

      Average standard deviation of split frequencies: 0.008217

      600500 -- [-536.531] (-539.805) (-536.749) (-535.770) * [-536.421] (-537.492) (-534.983) (-537.285) -- 0:00:24
      601000 -- (-536.735) (-541.187) (-536.527) [-534.744] * [-535.538] (-538.432) (-535.522) (-538.567) -- 0:00:24
      601500 -- [-540.171] (-535.018) (-536.329) (-540.159) * [-534.676] (-535.348) (-538.071) (-538.111) -- 0:00:24
      602000 -- [-536.060] (-535.029) (-535.797) (-538.095) * (-538.329) (-537.386) (-537.304) [-534.488] -- 0:00:24
      602500 -- [-535.756] (-538.802) (-537.769) (-538.025) * [-535.640] (-537.189) (-536.382) (-538.493) -- 0:00:24
      603000 -- (-535.346) (-539.624) (-537.891) [-538.223] * [-536.084] (-537.279) (-537.500) (-534.715) -- 0:00:24
      603500 -- (-534.944) (-538.677) (-535.578) [-536.615] * (-535.712) (-535.777) (-534.554) [-534.396] -- 0:00:24
      604000 -- (-534.596) (-539.451) [-535.074] (-536.450) * (-538.002) [-536.328] (-537.032) (-536.832) -- 0:00:24
      604500 -- (-535.785) (-536.978) [-536.752] (-536.096) * (-535.893) [-534.976] (-537.197) (-535.985) -- 0:00:24
      605000 -- (-535.945) [-537.237] (-537.742) (-536.307) * [-535.944] (-534.527) (-537.835) (-538.447) -- 0:00:24

      Average standard deviation of split frequencies: 0.008191

      605500 -- (-536.800) (-537.539) (-536.363) [-536.859] * (-535.171) [-537.538] (-537.445) (-536.449) -- 0:00:24
      606000 -- (-541.008) [-535.699] (-538.797) (-537.003) * [-534.516] (-537.101) (-539.341) (-537.503) -- 0:00:24
      606500 -- (-536.709) (-535.793) [-538.080] (-539.136) * (-534.215) (-537.975) [-534.639] (-535.149) -- 0:00:24
      607000 -- (-536.955) [-538.326] (-535.987) (-535.562) * (-540.347) (-537.903) [-538.228] (-538.752) -- 0:00:23
      607500 -- (-538.223) (-538.946) [-539.724] (-537.806) * (-541.229) [-536.166] (-539.086) (-536.229) -- 0:00:23
      608000 -- [-536.660] (-541.057) (-535.597) (-536.394) * [-537.592] (-535.644) (-539.991) (-534.936) -- 0:00:23
      608500 -- [-537.440] (-539.673) (-537.272) (-534.516) * [-537.508] (-536.612) (-539.763) (-534.840) -- 0:00:23
      609000 -- [-535.217] (-536.996) (-545.169) (-535.485) * [-537.754] (-540.888) (-536.281) (-536.400) -- 0:00:23
      609500 -- [-535.867] (-536.475) (-535.329) (-535.372) * (-536.306) (-535.542) (-538.214) [-535.912] -- 0:00:23
      610000 -- (-537.442) (-536.822) (-536.229) [-535.312] * [-535.980] (-536.283) (-536.962) (-537.701) -- 0:00:23

      Average standard deviation of split frequencies: 0.008491

      610500 -- (-536.195) (-535.733) [-536.577] (-535.537) * (-536.087) (-535.896) (-534.558) [-535.807] -- 0:00:23
      611000 -- (-537.828) [-535.011] (-537.075) (-537.347) * (-540.711) (-535.953) [-536.164] (-538.298) -- 0:00:23
      611500 -- (-537.515) (-535.201) [-538.314] (-534.712) * (-538.700) [-534.928] (-537.911) (-541.058) -- 0:00:23
      612000 -- (-541.079) [-534.991] (-538.520) (-534.729) * (-538.474) (-535.222) (-539.624) [-536.943] -- 0:00:23
      612500 -- (-541.120) (-539.087) [-535.687] (-536.501) * (-534.940) [-534.868] (-535.399) (-538.813) -- 0:00:23
      613000 -- (-535.905) (-534.887) [-535.204] (-536.257) * (-536.017) [-539.214] (-535.867) (-536.784) -- 0:00:23
      613500 -- (-539.702) [-535.388] (-537.059) (-534.833) * [-535.680] (-540.583) (-534.439) (-536.560) -- 0:00:23
      614000 -- (-538.185) (-536.031) [-534.274] (-534.787) * (-538.339) (-538.083) (-536.849) [-535.338] -- 0:00:23
      614500 -- (-537.250) (-534.284) (-535.269) [-536.184] * (-535.294) (-536.774) (-537.683) [-541.124] -- 0:00:23
      615000 -- (-535.800) (-537.754) [-534.969] (-538.545) * [-536.494] (-539.096) (-535.163) (-535.771) -- 0:00:23

      Average standard deviation of split frequencies: 0.008463

      615500 -- (-538.301) (-535.728) [-534.262] (-535.781) * [-535.915] (-537.774) (-535.212) (-534.904) -- 0:00:23
      616000 -- (-535.585) [-536.325] (-537.541) (-535.377) * (-538.686) [-541.316] (-537.757) (-538.512) -- 0:00:23
      616500 -- [-536.268] (-536.870) (-539.780) (-535.361) * [-536.039] (-541.002) (-537.353) (-537.374) -- 0:00:23
      617000 -- (-535.059) (-537.401) [-542.383] (-535.543) * (-536.566) [-540.200] (-542.429) (-540.044) -- 0:00:23
      617500 -- (-536.402) (-535.087) [-535.910] (-538.077) * (-535.893) (-540.283) [-537.234] (-535.381) -- 0:00:23
      618000 -- (-537.659) (-537.112) (-536.683) [-535.937] * (-534.967) (-536.345) [-536.140] (-535.525) -- 0:00:23
      618500 -- (-535.065) [-537.487] (-534.835) (-536.944) * [-538.445] (-537.609) (-535.517) (-537.861) -- 0:00:23
      619000 -- (-535.429) [-534.935] (-537.530) (-538.280) * (-538.498) [-535.549] (-535.302) (-542.709) -- 0:00:23
      619500 -- (-536.003) (-535.432) [-535.399] (-535.811) * (-542.688) (-540.941) (-534.553) [-536.115] -- 0:00:23
      620000 -- (-540.530) (-536.409) [-534.893] (-535.560) * [-536.675] (-541.713) (-538.068) (-537.903) -- 0:00:23

      Average standard deviation of split frequencies: 0.008980

      620500 -- (-538.976) (-539.512) (-539.901) [-535.279] * (-536.182) [-538.832] (-536.399) (-535.728) -- 0:00:23
      621000 -- (-540.429) (-539.199) (-537.083) [-534.860] * [-535.292] (-541.138) (-545.269) (-537.255) -- 0:00:23
      621500 -- (-538.463) (-537.253) (-540.617) [-537.124] * (-535.593) [-535.416] (-537.801) (-536.202) -- 0:00:23
      622000 -- [-538.396] (-541.387) (-537.827) (-536.757) * (-534.586) [-537.062] (-537.329) (-538.772) -- 0:00:23
      622500 -- (-535.629) [-536.273] (-538.265) (-539.739) * (-537.050) (-536.293) (-536.593) [-535.558] -- 0:00:23
      623000 -- (-536.281) (-536.856) (-538.329) [-535.707] * (-538.057) (-535.620) (-535.291) [-536.203] -- 0:00:22
      623500 -- (-541.244) (-536.430) [-536.475] (-537.606) * (-534.806) (-536.137) (-537.526) [-535.024] -- 0:00:22
      624000 -- (-537.725) (-536.936) [-536.047] (-535.302) * (-535.999) [-535.648] (-537.758) (-534.985) -- 0:00:22
      624500 -- (-540.055) [-536.256] (-535.821) (-534.163) * [-534.847] (-536.823) (-537.631) (-540.361) -- 0:00:22
      625000 -- (-536.665) (-537.261) [-535.804] (-535.054) * (-535.712) (-535.581) (-540.341) [-536.999] -- 0:00:22

      Average standard deviation of split frequencies: 0.009258

      625500 -- (-538.731) (-535.570) (-538.008) [-535.357] * (-536.574) [-535.827] (-538.171) (-535.815) -- 0:00:22
      626000 -- [-535.375] (-536.267) (-534.990) (-536.533) * (-537.858) (-539.135) [-539.368] (-535.080) -- 0:00:22
      626500 -- [-536.560] (-537.867) (-536.799) (-535.324) * [-534.243] (-537.958) (-535.215) (-538.866) -- 0:00:22
      627000 -- (-537.813) (-538.875) [-535.905] (-536.402) * (-534.474) (-536.156) (-541.399) [-539.813] -- 0:00:22
      627500 -- (-537.814) (-542.584) [-535.563] (-537.062) * [-535.803] (-538.287) (-542.728) (-537.911) -- 0:00:22
      628000 -- (-540.846) (-537.534) [-536.295] (-537.825) * [-534.665] (-539.887) (-538.147) (-535.729) -- 0:00:22
      628500 -- (-534.908) (-535.834) [-538.876] (-535.327) * (-535.951) [-534.956] (-535.790) (-535.118) -- 0:00:22
      629000 -- (-534.841) (-538.682) (-539.771) [-536.889] * (-538.758) (-540.987) [-536.160] (-536.562) -- 0:00:22
      629500 -- (-536.462) [-540.451] (-537.846) (-537.895) * [-537.527] (-537.964) (-538.396) (-535.016) -- 0:00:22
      630000 -- [-537.248] (-535.022) (-537.827) (-536.236) * [-534.844] (-536.789) (-536.018) (-534.852) -- 0:00:22

      Average standard deviation of split frequencies: 0.009014

      630500 -- [-535.421] (-535.255) (-544.258) (-535.438) * (-535.407) (-537.067) (-536.320) [-535.098] -- 0:00:22
      631000 -- (-535.717) (-536.122) (-538.949) [-537.347] * (-536.899) [-535.446] (-535.761) (-535.589) -- 0:00:22
      631500 -- (-536.141) [-538.332] (-540.986) (-535.213) * (-535.869) [-534.717] (-536.849) (-539.122) -- 0:00:22
      632000 -- [-536.193] (-536.138) (-535.973) (-536.629) * (-535.525) [-534.405] (-535.594) (-537.950) -- 0:00:22
      632500 -- (-541.842) [-536.484] (-536.243) (-535.987) * (-534.794) [-536.349] (-534.585) (-537.385) -- 0:00:22
      633000 -- (-539.454) [-537.273] (-537.872) (-534.858) * (-535.782) (-534.867) [-536.486] (-535.207) -- 0:00:22
      633500 -- (-536.021) [-535.406] (-536.108) (-535.586) * (-536.225) [-535.246] (-536.767) (-534.740) -- 0:00:22
      634000 -- (-535.381) [-536.576] (-534.844) (-534.191) * [-534.394] (-535.805) (-538.386) (-537.377) -- 0:00:22
      634500 -- [-536.256] (-534.897) (-538.867) (-534.361) * [-534.302] (-538.313) (-534.659) (-535.780) -- 0:00:22
      635000 -- (-539.175) (-538.378) (-538.026) [-534.289] * (-534.628) [-536.388] (-536.350) (-539.615) -- 0:00:22

      Average standard deviation of split frequencies: 0.008153

      635500 -- [-540.928] (-542.313) (-536.351) (-537.753) * (-536.693) (-544.303) [-536.188] (-534.749) -- 0:00:22
      636000 -- (-539.655) (-534.206) (-536.251) [-538.342] * (-536.493) (-539.524) (-536.256) [-537.179] -- 0:00:22
      636500 -- (-535.060) (-534.693) [-537.575] (-536.100) * (-534.995) (-538.304) (-535.539) [-536.175] -- 0:00:22
      637000 -- (-536.551) (-534.571) (-535.898) [-535.168] * [-534.247] (-536.362) (-537.459) (-538.441) -- 0:00:22
      637500 -- [-536.654] (-534.738) (-537.533) (-538.427) * (-537.773) (-535.607) [-536.093] (-536.239) -- 0:00:22
      638000 -- [-537.243] (-537.225) (-536.656) (-536.414) * (-535.062) [-538.608] (-535.927) (-539.717) -- 0:00:22
      638500 -- (-536.210) (-536.063) [-534.961] (-538.546) * (-538.861) (-534.492) [-537.398] (-539.608) -- 0:00:22
      639000 -- [-535.439] (-536.886) (-535.604) (-537.353) * (-542.998) (-534.470) [-534.440] (-547.004) -- 0:00:22
      639500 -- (-534.845) (-537.464) [-535.378] (-537.497) * (-536.898) (-534.731) [-535.963] (-538.574) -- 0:00:21
      640000 -- (-541.140) [-535.202] (-537.137) (-535.273) * (-536.312) (-534.927) [-539.058] (-534.665) -- 0:00:21

      Average standard deviation of split frequencies: 0.007588

      640500 -- (-535.124) (-535.457) (-535.822) [-536.789] * (-538.923) (-538.884) (-537.456) [-535.244] -- 0:00:21
      641000 -- [-539.360] (-535.119) (-534.356) (-539.037) * (-540.134) [-537.606] (-537.546) (-536.221) -- 0:00:21
      641500 -- (-537.906) [-537.126] (-535.759) (-536.952) * [-536.311] (-537.087) (-539.004) (-535.067) -- 0:00:21
      642000 -- (-537.977) (-534.924) [-536.041] (-535.998) * (-536.757) (-534.781) [-536.443] (-535.885) -- 0:00:21
      642500 -- (-537.335) (-535.616) [-534.904] (-534.258) * (-537.312) [-534.293] (-539.348) (-537.151) -- 0:00:21
      643000 -- (-535.181) [-536.189] (-536.147) (-534.788) * [-537.626] (-534.344) (-536.245) (-535.408) -- 0:00:21
      643500 -- [-534.468] (-538.467) (-540.144) (-534.792) * (-538.635) [-538.382] (-536.669) (-537.297) -- 0:00:21
      644000 -- (-536.196) (-535.917) [-540.610] (-535.849) * (-539.003) (-537.176) (-536.650) [-535.178] -- 0:00:21
      644500 -- (-535.061) (-535.587) [-537.179] (-535.670) * (-536.589) (-538.905) [-537.401] (-534.714) -- 0:00:21
      645000 -- (-534.616) (-536.657) (-539.888) [-534.436] * [-535.086] (-537.882) (-538.381) (-535.682) -- 0:00:21

      Average standard deviation of split frequencies: 0.007480

      645500 -- (-534.782) (-535.185) (-537.951) [-534.908] * [-534.956] (-536.958) (-536.451) (-537.863) -- 0:00:21
      646000 -- (-534.688) [-537.423] (-540.253) (-534.853) * (-535.202) (-534.435) [-535.732] (-537.608) -- 0:00:21
      646500 -- (-535.322) (-538.383) [-539.992] (-536.125) * (-534.313) [-534.655] (-537.939) (-535.514) -- 0:00:21
      647000 -- [-535.155] (-537.343) (-535.949) (-536.192) * (-537.146) (-536.740) [-535.316] (-534.513) -- 0:00:21
      647500 -- [-535.029] (-541.730) (-541.135) (-535.506) * [-536.087] (-537.704) (-536.383) (-535.628) -- 0:00:21
      648000 -- (-537.343) [-541.531] (-535.810) (-535.499) * [-535.788] (-536.249) (-535.880) (-534.881) -- 0:00:21
      648500 -- (-537.806) [-537.051] (-535.520) (-534.886) * [-539.945] (-536.640) (-536.531) (-536.390) -- 0:00:21
      649000 -- (-535.955) (-536.183) (-536.987) [-544.039] * (-535.175) (-535.459) [-536.477] (-537.482) -- 0:00:21
      649500 -- [-535.967] (-535.644) (-536.194) (-540.694) * (-537.068) (-536.987) (-535.292) [-540.236] -- 0:00:21
      650000 -- (-540.544) [-536.588] (-538.969) (-536.985) * (-538.810) (-543.773) (-537.430) [-535.439] -- 0:00:21

      Average standard deviation of split frequencies: 0.007834

      650500 -- (-537.968) (-535.864) [-535.528] (-534.606) * (-537.741) (-535.732) (-535.258) [-538.053] -- 0:00:21
      651000 -- (-534.853) [-537.325] (-536.694) (-536.651) * (-534.952) [-538.223] (-535.894) (-535.060) -- 0:00:21
      651500 -- (-535.226) (-536.954) [-535.509] (-536.860) * (-538.709) (-536.708) [-535.240] (-534.133) -- 0:00:21
      652000 -- (-535.310) (-542.378) (-534.313) [-534.504] * [-537.278] (-537.111) (-536.484) (-537.016) -- 0:00:21
      652500 -- [-535.163] (-539.659) (-540.059) (-534.577) * (-537.623) [-540.602] (-538.216) (-537.037) -- 0:00:21
      653000 -- (-535.761) (-537.087) [-534.931] (-536.339) * [-535.283] (-541.125) (-535.288) (-536.957) -- 0:00:21
      653500 -- (-534.937) [-537.008] (-537.814) (-538.060) * (-534.802) (-536.551) [-534.837] (-536.686) -- 0:00:21
      654000 -- (-540.441) (-535.508) [-536.833] (-537.691) * (-536.196) [-538.382] (-536.782) (-535.479) -- 0:00:21
      654500 -- (-537.776) (-534.871) (-536.709) [-537.873] * (-535.829) (-539.475) [-540.791] (-536.869) -- 0:00:21
      655000 -- (-538.117) [-535.099] (-539.091) (-539.538) * [-534.996] (-537.281) (-535.767) (-535.275) -- 0:00:21

      Average standard deviation of split frequencies: 0.007905

      655500 -- [-535.433] (-538.691) (-537.103) (-535.889) * (-536.693) (-537.037) [-535.008] (-535.310) -- 0:00:21
      656000 -- (-535.829) [-535.239] (-534.848) (-535.347) * (-536.752) (-536.627) (-536.845) [-535.509] -- 0:00:20
      656500 -- [-535.063] (-538.929) (-537.610) (-534.824) * (-537.462) (-536.132) [-538.883] (-536.656) -- 0:00:20
      657000 -- (-536.663) (-542.061) [-536.599] (-535.263) * (-535.516) [-536.286] (-540.183) (-537.573) -- 0:00:20
      657500 -- (-534.415) [-536.470] (-538.616) (-538.624) * [-536.954] (-535.438) (-539.913) (-538.533) -- 0:00:20
      658000 -- (-534.850) (-535.265) (-541.635) [-541.182] * (-536.798) [-535.646] (-537.270) (-535.861) -- 0:00:20
      658500 -- (-534.888) (-536.997) [-534.830] (-536.000) * [-537.579] (-537.392) (-536.759) (-534.426) -- 0:00:20
      659000 -- (-537.112) (-537.128) (-539.967) [-536.828] * (-537.388) (-537.540) [-536.388] (-535.548) -- 0:00:20
      659500 -- (-537.296) (-537.469) [-539.623] (-540.484) * [-536.412] (-537.545) (-537.755) (-535.382) -- 0:00:20
      660000 -- (-539.697) [-535.952] (-534.881) (-537.914) * (-538.925) (-537.243) (-535.597) [-535.160] -- 0:00:20

      Average standard deviation of split frequencies: 0.007230

      660500 -- (-536.122) [-535.744] (-535.981) (-537.499) * (-535.869) [-535.632] (-538.245) (-536.997) -- 0:00:20
      661000 -- (-535.619) (-536.099) (-535.905) [-536.164] * (-537.683) [-534.973] (-535.683) (-538.248) -- 0:00:20
      661500 -- (-536.832) (-539.004) [-535.192] (-534.330) * (-536.099) [-534.855] (-536.910) (-537.186) -- 0:00:20
      662000 -- (-536.801) (-536.475) (-534.595) [-535.132] * (-534.798) [-538.522] (-534.370) (-535.951) -- 0:00:20
      662500 -- (-535.406) (-534.984) (-537.176) [-535.236] * [-535.845] (-541.212) (-535.081) (-535.467) -- 0:00:20
      663000 -- (-534.712) [-535.610] (-539.331) (-537.739) * [-535.526] (-537.062) (-537.743) (-537.168) -- 0:00:20
      663500 -- (-539.933) (-534.871) (-535.210) [-536.100] * (-536.149) (-537.949) [-535.382] (-536.852) -- 0:00:20
      664000 -- [-534.068] (-536.943) (-538.380) (-537.003) * (-542.375) (-537.410) [-535.714] (-540.092) -- 0:00:20
      664500 -- (-535.235) (-536.422) [-535.785] (-535.736) * (-543.176) (-535.972) [-535.208] (-535.142) -- 0:00:20
      665000 -- (-535.375) (-542.951) (-537.679) [-536.554] * (-536.040) [-536.973] (-536.671) (-535.302) -- 0:00:20

      Average standard deviation of split frequencies: 0.007220

      665500 -- (-535.264) (-536.403) [-537.862] (-538.115) * (-536.513) [-535.957] (-539.913) (-537.084) -- 0:00:20
      666000 -- (-537.373) (-537.752) [-534.833] (-536.615) * (-535.334) [-536.160] (-536.031) (-535.301) -- 0:00:20
      666500 -- [-535.165] (-537.581) (-538.302) (-535.401) * (-539.329) [-541.902] (-534.261) (-537.082) -- 0:00:20
      667000 -- (-538.142) (-536.108) [-535.361] (-537.113) * (-539.010) (-536.444) [-536.247] (-535.328) -- 0:00:20
      667500 -- (-534.684) (-538.169) [-534.852] (-535.332) * (-537.755) [-535.598] (-537.270) (-534.771) -- 0:00:20
      668000 -- [-537.494] (-536.758) (-535.444) (-536.222) * (-536.562) [-535.348] (-537.958) (-540.840) -- 0:00:20
      668500 -- [-536.585] (-534.824) (-535.749) (-534.618) * (-536.424) [-535.525] (-536.313) (-540.803) -- 0:00:20
      669000 -- (-536.489) (-535.054) [-535.567] (-536.390) * (-537.347) [-536.410] (-536.301) (-538.020) -- 0:00:20
      669500 -- (-536.399) (-536.090) [-536.090] (-534.365) * (-535.318) [-536.280] (-536.783) (-537.676) -- 0:00:20
      670000 -- (-536.945) [-537.147] (-540.687) (-534.311) * (-537.203) (-536.079) [-535.525] (-535.644) -- 0:00:20

      Average standard deviation of split frequencies: 0.007205

      670500 -- (-537.499) (-536.966) [-539.269] (-534.314) * (-536.613) [-535.125] (-536.153) (-537.817) -- 0:00:20
      671000 -- (-537.771) (-535.819) (-539.053) [-536.782] * (-535.424) [-536.558] (-534.901) (-534.636) -- 0:00:20
      671500 -- [-539.737] (-535.187) (-536.158) (-537.011) * (-536.364) (-535.889) [-536.857] (-536.157) -- 0:00:20
      672000 -- (-534.682) (-536.415) (-535.416) [-536.292] * (-535.377) (-536.361) (-536.731) [-534.793] -- 0:00:20
      672500 -- (-536.197) (-535.548) (-535.081) [-536.204] * (-534.254) [-535.329] (-539.065) (-534.901) -- 0:00:19
      673000 -- (-539.026) [-535.483] (-536.736) (-538.012) * (-536.902) [-537.247] (-538.575) (-541.449) -- 0:00:19
      673500 -- (-537.859) (-535.547) (-536.632) [-538.412] * (-535.053) [-534.440] (-537.763) (-538.198) -- 0:00:19
      674000 -- (-542.046) (-538.601) (-539.514) [-538.024] * [-537.648] (-534.848) (-539.638) (-536.749) -- 0:00:19
      674500 -- (-536.665) (-536.210) [-539.133] (-535.369) * (-538.449) [-539.280] (-536.368) (-535.454) -- 0:00:19
      675000 -- (-536.172) [-537.756] (-536.462) (-535.390) * (-536.609) [-536.349] (-538.091) (-537.505) -- 0:00:19

      Average standard deviation of split frequencies: 0.007061

      675500 -- (-535.458) [-535.656] (-534.650) (-535.311) * (-536.506) [-535.513] (-537.229) (-536.243) -- 0:00:19
      676000 -- [-535.832] (-539.112) (-536.522) (-535.071) * (-535.063) [-535.493] (-537.362) (-536.026) -- 0:00:19
      676500 -- [-535.291] (-536.726) (-537.159) (-538.036) * (-534.493) [-539.514] (-538.571) (-537.597) -- 0:00:19
      677000 -- (-535.813) (-535.768) (-536.558) [-538.209] * (-534.611) (-542.955) (-536.414) [-538.231] -- 0:00:19
      677500 -- (-536.817) (-536.536) [-535.347] (-536.508) * (-536.229) [-538.326] (-538.975) (-542.615) -- 0:00:19
      678000 -- (-536.665) [-537.270] (-536.244) (-535.868) * (-538.323) [-539.190] (-537.815) (-535.766) -- 0:00:19
      678500 -- (-537.818) [-534.902] (-537.872) (-540.187) * (-535.697) (-535.533) [-536.949] (-538.625) -- 0:00:19
      679000 -- [-536.076] (-538.276) (-542.679) (-537.010) * (-536.776) (-537.757) [-536.720] (-537.641) -- 0:00:19
      679500 -- (-535.858) [-536.613] (-538.727) (-536.483) * (-534.119) [-534.617] (-534.745) (-539.429) -- 0:00:19
      680000 -- (-536.330) [-537.350] (-538.126) (-536.944) * (-535.112) (-538.397) (-536.670) [-535.620] -- 0:00:19

      Average standard deviation of split frequencies: 0.007142

      680500 -- (-534.425) (-535.909) (-537.988) [-535.856] * [-537.678] (-536.334) (-536.446) (-536.776) -- 0:00:19
      681000 -- (-535.767) (-535.088) [-534.841] (-535.521) * (-536.334) (-536.328) (-538.864) [-536.258] -- 0:00:19
      681500 -- (-535.264) (-535.127) [-535.884] (-534.908) * (-539.358) (-536.351) [-536.639] (-535.515) -- 0:00:19
      682000 -- (-536.471) (-536.656) (-534.925) [-534.759] * (-535.140) (-536.869) (-535.091) [-540.723] -- 0:00:19
      682500 -- (-537.700) (-537.083) [-538.242] (-536.387) * (-537.160) (-538.115) [-534.643] (-543.339) -- 0:00:19
      683000 -- [-535.153] (-537.231) (-537.482) (-536.887) * [-536.105] (-534.197) (-536.897) (-539.021) -- 0:00:19
      683500 -- (-535.424) (-537.173) (-537.742) [-538.627] * (-538.819) (-536.010) [-536.914] (-536.255) -- 0:00:19
      684000 -- (-537.644) (-536.418) [-535.034] (-538.030) * (-534.545) (-538.165) (-536.558) [-535.181] -- 0:00:19
      684500 -- (-535.769) (-534.900) (-535.692) [-535.517] * (-535.007) (-538.342) (-536.382) [-535.650] -- 0:00:19
      685000 -- (-536.135) [-535.701] (-536.181) (-535.232) * [-536.178] (-536.234) (-536.752) (-535.012) -- 0:00:19

      Average standard deviation of split frequencies: 0.006743

      685500 -- (-535.770) (-535.133) [-538.069] (-535.417) * (-537.319) (-536.185) (-538.658) [-534.399] -- 0:00:19
      686000 -- [-536.953] (-539.021) (-535.581) (-536.938) * (-537.463) [-538.816] (-538.474) (-534.604) -- 0:00:19
      686500 -- (-537.351) (-537.065) [-534.667] (-535.792) * (-534.590) (-538.278) (-535.492) [-537.706] -- 0:00:19
      687000 -- (-535.849) [-535.505] (-536.364) (-537.505) * (-535.803) (-534.916) [-534.460] (-536.316) -- 0:00:19
      687500 -- (-538.106) [-537.205] (-541.633) (-538.191) * (-536.116) (-534.871) [-535.937] (-538.033) -- 0:00:19
      688000 -- [-536.315] (-538.181) (-538.055) (-539.418) * (-540.802) [-535.552] (-538.354) (-539.239) -- 0:00:19
      688500 -- (-535.366) [-540.817] (-536.081) (-540.541) * [-536.291] (-534.838) (-536.191) (-535.264) -- 0:00:19
      689000 -- (-536.201) (-535.905) (-535.890) [-536.298] * (-536.511) (-534.954) [-536.234] (-536.858) -- 0:00:18
      689500 -- (-538.317) (-540.705) [-535.885] (-536.688) * (-536.756) [-539.276] (-535.761) (-537.861) -- 0:00:18
      690000 -- (-536.923) (-543.377) (-538.160) [-534.986] * (-535.787) (-538.994) (-535.492) [-536.842] -- 0:00:18

      Average standard deviation of split frequencies: 0.006655

      690500 -- (-538.862) (-535.921) (-536.135) [-534.959] * (-536.169) (-536.594) (-538.797) [-536.870] -- 0:00:18
      691000 -- (-541.602) (-536.035) (-538.311) [-535.468] * (-535.688) [-537.852] (-537.459) (-536.334) -- 0:00:18
      691500 -- (-536.055) (-535.740) [-537.415] (-534.840) * [-535.542] (-536.083) (-535.430) (-536.490) -- 0:00:18
      692000 -- [-536.385] (-534.726) (-536.134) (-535.815) * (-542.080) (-537.184) (-535.196) [-538.756] -- 0:00:18
      692500 -- (-539.257) (-541.222) [-534.782] (-535.999) * (-534.642) (-539.671) (-536.307) [-539.500] -- 0:00:18
      693000 -- [-536.821] (-535.804) (-535.313) (-534.626) * [-534.669] (-542.501) (-537.715) (-537.979) -- 0:00:18
      693500 -- (-535.988) [-535.111] (-535.809) (-535.691) * (-534.577) [-536.939] (-537.559) (-535.461) -- 0:00:18
      694000 -- (-538.499) (-538.194) (-538.761) [-537.999] * (-540.337) (-536.227) (-536.301) [-535.228] -- 0:00:18
      694500 -- [-537.010] (-537.401) (-536.207) (-538.765) * (-541.391) (-536.796) (-536.282) [-535.551] -- 0:00:18
      695000 -- (-535.927) [-537.748] (-536.105) (-537.486) * [-537.567] (-536.412) (-536.983) (-535.269) -- 0:00:18

      Average standard deviation of split frequencies: 0.007027

      695500 -- (-536.423) [-534.521] (-536.678) (-535.483) * (-536.993) [-535.960] (-542.893) (-535.085) -- 0:00:18
      696000 -- (-534.321) [-535.420] (-537.772) (-536.229) * [-538.076] (-537.028) (-539.160) (-536.873) -- 0:00:18
      696500 -- (-540.391) (-535.423) (-541.774) [-535.855] * [-540.463] (-534.526) (-538.474) (-536.728) -- 0:00:18
      697000 -- (-535.473) (-534.903) (-542.431) [-537.534] * (-539.922) [-534.243] (-538.956) (-535.002) -- 0:00:18
      697500 -- (-537.201) [-534.473] (-536.536) (-535.698) * (-538.885) [-536.079] (-538.909) (-535.147) -- 0:00:18
      698000 -- (-540.963) [-535.956] (-536.534) (-537.884) * (-536.618) (-537.875) (-536.277) [-534.851] -- 0:00:18
      698500 -- (-537.706) [-536.709] (-536.884) (-539.950) * (-534.995) [-535.974] (-535.500) (-536.022) -- 0:00:18
      699000 -- (-538.338) (-534.347) [-537.569] (-536.656) * (-535.864) (-540.173) [-536.044] (-537.229) -- 0:00:18
      699500 -- (-535.257) (-535.423) [-534.559] (-534.396) * (-534.266) (-539.294) [-539.012] (-537.380) -- 0:00:18
      700000 -- [-535.630] (-535.997) (-534.455) (-534.597) * [-535.318] (-539.192) (-537.960) (-535.983) -- 0:00:18

      Average standard deviation of split frequencies: 0.007317

      700500 -- (-535.945) (-538.809) [-537.305] (-537.612) * (-537.264) (-536.254) [-535.535] (-535.623) -- 0:00:18
      701000 -- (-535.000) (-534.851) [-537.280] (-537.592) * (-541.485) (-543.422) [-535.583] (-537.409) -- 0:00:18
      701500 -- (-535.541) [-536.963] (-536.334) (-535.754) * (-536.057) (-535.860) (-537.048) [-535.828] -- 0:00:18
      702000 -- (-539.222) (-536.634) [-540.243] (-538.892) * (-535.612) (-534.343) [-537.918] (-535.311) -- 0:00:18
      702500 -- [-535.386] (-537.051) (-539.018) (-535.740) * [-538.227] (-536.450) (-537.730) (-538.464) -- 0:00:18
      703000 -- (-536.298) (-536.730) (-536.866) [-538.202] * [-538.404] (-536.281) (-536.428) (-538.163) -- 0:00:18
      703500 -- (-534.785) (-542.313) [-536.180] (-537.286) * (-535.970) [-535.316] (-538.411) (-537.401) -- 0:00:18
      704000 -- (-538.825) [-537.252] (-535.005) (-540.638) * (-535.564) [-535.165] (-537.301) (-539.145) -- 0:00:18
      704500 -- (-537.832) (-538.838) [-535.750] (-536.542) * (-537.283) (-540.130) (-536.936) [-537.634] -- 0:00:18
      705000 -- [-537.518] (-535.235) (-537.849) (-535.157) * (-537.928) (-534.961) [-537.017] (-536.726) -- 0:00:17

      Average standard deviation of split frequencies: 0.007011

      705500 -- [-539.787] (-535.519) (-535.850) (-535.839) * (-535.886) [-534.881] (-534.050) (-535.672) -- 0:00:17
      706000 -- (-539.797) (-535.000) [-535.799] (-541.932) * [-535.728] (-535.440) (-534.484) (-534.626) -- 0:00:17
      706500 -- (-540.638) [-536.912] (-538.445) (-536.135) * (-536.199) (-539.557) (-535.890) [-538.470] -- 0:00:17
      707000 -- (-535.794) (-540.871) (-537.863) [-535.018] * (-538.144) (-539.138) (-536.602) [-536.469] -- 0:00:17
      707500 -- (-539.634) [-534.412] (-536.659) (-535.888) * (-535.156) (-539.992) (-535.992) [-539.928] -- 0:00:17
      708000 -- [-535.211] (-539.101) (-536.476) (-535.258) * (-536.164) (-535.645) (-534.796) [-537.120] -- 0:00:17
      708500 -- [-537.760] (-537.229) (-535.455) (-536.998) * (-536.745) (-537.362) (-537.908) [-535.511] -- 0:00:17
      709000 -- (-537.147) (-535.334) [-534.846] (-536.601) * (-541.958) [-534.773] (-538.098) (-536.287) -- 0:00:17
      709500 -- (-538.974) [-534.946] (-539.789) (-537.217) * (-537.714) [-535.498] (-536.061) (-535.967) -- 0:00:17
      710000 -- (-540.062) (-536.521) [-538.556] (-537.437) * (-536.584) [-538.331] (-536.313) (-534.932) -- 0:00:17

      Average standard deviation of split frequencies: 0.007380

      710500 -- (-539.270) (-535.328) (-535.386) [-535.582] * [-534.889] (-538.921) (-534.741) (-537.228) -- 0:00:17
      711000 -- (-537.322) [-535.729] (-536.164) (-536.473) * (-536.750) (-537.673) (-536.885) [-537.771] -- 0:00:17
      711500 -- (-535.099) [-534.508] (-537.373) (-537.442) * (-537.357) [-535.270] (-534.841) (-535.372) -- 0:00:17
      712000 -- (-534.373) (-534.508) (-535.399) [-538.897] * (-534.837) (-535.707) (-538.813) [-536.596] -- 0:00:17
      712500 -- (-534.705) [-534.772] (-535.844) (-536.002) * (-537.505) (-536.081) (-535.991) [-536.629] -- 0:00:17
      713000 -- [-535.425] (-536.351) (-537.926) (-535.757) * [-535.187] (-535.084) (-539.022) (-535.388) -- 0:00:17
      713500 -- (-537.695) [-535.626] (-536.353) (-534.733) * (-539.814) (-534.613) [-535.030] (-536.743) -- 0:00:17
      714000 -- [-534.871] (-535.503) (-535.128) (-534.951) * (-536.802) (-536.261) (-536.716) [-535.764] -- 0:00:17
      714500 -- (-534.871) (-535.261) [-536.433] (-538.368) * (-535.549) [-535.086] (-534.572) (-535.606) -- 0:00:17
      715000 -- (-536.771) [-540.584] (-539.330) (-541.465) * (-537.794) [-536.774] (-534.353) (-536.279) -- 0:00:17

      Average standard deviation of split frequencies: 0.007695

      715500 -- [-536.437] (-540.889) (-535.317) (-537.612) * (-535.883) (-537.902) (-537.743) [-537.188] -- 0:00:17
      716000 -- [-537.497] (-535.684) (-535.020) (-538.245) * (-537.965) (-536.104) [-536.249] (-539.190) -- 0:00:17
      716500 -- [-536.930] (-534.231) (-534.829) (-536.136) * (-536.337) (-535.890) [-535.189] (-540.589) -- 0:00:17
      717000 -- (-541.053) (-535.682) [-535.305] (-537.927) * (-537.669) [-538.414] (-535.338) (-537.548) -- 0:00:17
      717500 -- (-534.586) (-545.124) [-535.982] (-534.964) * (-535.649) [-538.127] (-537.000) (-536.176) -- 0:00:17
      718000 -- (-538.200) (-537.498) [-535.217] (-536.968) * [-536.760] (-536.035) (-536.094) (-537.503) -- 0:00:17
      718500 -- (-540.273) (-539.686) [-537.257] (-535.399) * [-538.907] (-535.485) (-536.869) (-536.764) -- 0:00:17
      719000 -- (-535.627) (-539.031) [-536.871] (-536.007) * (-538.053) (-536.978) (-535.118) [-537.979] -- 0:00:17
      719500 -- (-535.492) [-536.941] (-538.021) (-534.828) * (-535.184) (-539.338) [-536.098] (-534.951) -- 0:00:17
      720000 -- [-536.696] (-536.987) (-538.744) (-538.024) * (-539.073) (-538.490) (-537.110) [-534.542] -- 0:00:17

      Average standard deviation of split frequencies: 0.007400

      720500 -- (-534.451) [-535.327] (-538.315) (-538.811) * (-536.036) (-534.962) [-535.663] (-535.731) -- 0:00:17
      721000 -- [-534.364] (-538.221) (-538.734) (-537.818) * (-537.907) (-534.715) [-535.989] (-541.250) -- 0:00:17
      721500 -- (-534.538) [-534.729] (-536.541) (-540.637) * (-536.525) [-534.776] (-534.568) (-539.909) -- 0:00:16
      722000 -- (-537.423) (-536.446) [-541.150] (-536.812) * (-534.906) [-535.724] (-535.311) (-537.495) -- 0:00:16
      722500 -- (-537.044) (-535.965) (-539.654) [-535.453] * (-538.159) (-538.942) [-535.452] (-536.370) -- 0:00:16
      723000 -- [-536.760] (-539.110) (-536.962) (-536.128) * (-539.396) (-539.504) (-537.807) [-536.571] -- 0:00:16
      723500 -- (-535.888) [-536.377] (-536.050) (-534.470) * (-538.774) [-535.745] (-538.914) (-538.518) -- 0:00:16
      724000 -- (-537.016) (-538.581) [-534.481] (-536.426) * [-536.032] (-535.646) (-536.059) (-536.471) -- 0:00:16
      724500 -- (-535.111) [-535.594] (-534.502) (-544.150) * (-536.211) (-537.012) (-536.126) [-537.566] -- 0:00:16
      725000 -- [-535.170] (-536.017) (-537.687) (-536.574) * (-537.364) [-535.675] (-543.717) (-545.275) -- 0:00:16

      Average standard deviation of split frequencies: 0.007711

      725500 -- (-535.417) (-537.920) (-535.370) [-538.150] * (-536.351) (-539.470) [-536.834] (-534.628) -- 0:00:16
      726000 -- [-534.721] (-538.696) (-536.948) (-534.593) * (-536.488) (-537.348) [-535.068] (-535.457) -- 0:00:16
      726500 -- [-537.441] (-539.180) (-536.513) (-536.382) * (-536.918) [-535.855] (-538.056) (-539.114) -- 0:00:16
      727000 -- [-536.236] (-535.268) (-536.103) (-536.860) * (-538.605) (-535.322) [-536.376] (-536.669) -- 0:00:16
      727500 -- [-534.503] (-535.661) (-537.295) (-538.350) * (-538.936) (-535.741) (-535.154) [-535.042] -- 0:00:16
      728000 -- (-538.956) (-536.371) (-540.276) [-535.198] * (-539.082) [-535.150] (-539.563) (-535.552) -- 0:00:16
      728500 -- (-540.849) [-535.431] (-540.062) (-535.662) * (-538.759) [-535.449] (-539.411) (-537.069) -- 0:00:16
      729000 -- (-537.841) (-534.368) (-537.682) [-535.061] * (-535.236) (-535.719) (-539.725) [-535.345] -- 0:00:16
      729500 -- (-535.995) (-535.200) (-537.754) [-535.659] * (-535.068) (-535.493) [-536.428] (-537.802) -- 0:00:16
      730000 -- [-535.757] (-535.056) (-534.524) (-537.185) * [-535.771] (-534.512) (-537.928) (-535.777) -- 0:00:16

      Average standard deviation of split frequencies: 0.008024

      730500 -- [-534.890] (-537.268) (-535.033) (-537.095) * (-536.894) [-535.459] (-536.460) (-539.398) -- 0:00:16
      731000 -- (-535.800) [-534.500] (-536.583) (-534.747) * (-534.518) (-536.813) (-534.711) [-535.032] -- 0:00:16
      731500 -- [-535.784] (-537.452) (-538.115) (-535.583) * (-537.592) [-535.399] (-534.517) (-541.118) -- 0:00:16
      732000 -- (-539.879) (-539.101) (-535.489) [-536.417] * (-540.356) [-536.250] (-536.303) (-534.830) -- 0:00:16
      732500 -- [-537.026] (-537.147) (-536.807) (-540.020) * (-540.724) (-539.139) (-535.554) [-535.345] -- 0:00:16
      733000 -- (-536.010) (-536.158) [-537.171] (-543.387) * (-537.343) [-536.367] (-535.324) (-534.836) -- 0:00:16
      733500 -- (-536.151) (-534.510) [-536.618] (-537.575) * (-535.464) (-535.865) (-538.975) [-535.851] -- 0:00:16
      734000 -- (-535.704) (-537.368) (-535.739) [-535.252] * (-538.344) (-536.468) [-535.392] (-535.586) -- 0:00:16
      734500 -- [-535.288] (-535.924) (-538.036) (-536.788) * [-535.082] (-538.057) (-539.194) (-536.004) -- 0:00:16
      735000 -- (-534.214) (-534.543) (-544.712) [-535.349] * [-535.626] (-536.750) (-538.552) (-541.153) -- 0:00:16

      Average standard deviation of split frequencies: 0.007899

      735500 -- (-535.788) (-534.632) (-538.647) [-535.803] * (-536.503) (-539.747) (-538.448) [-537.048] -- 0:00:16
      736000 -- (-535.652) (-534.493) (-537.129) [-537.976] * (-536.108) (-537.192) (-538.208) [-537.450] -- 0:00:16
      736500 -- (-536.121) (-536.590) [-539.061] (-537.245) * (-542.559) (-534.347) (-540.369) [-534.833] -- 0:00:16
      737000 -- [-536.381] (-536.890) (-534.806) (-541.383) * (-534.944) (-537.871) (-536.338) [-534.961] -- 0:00:16
      737500 -- (-537.652) (-536.354) (-538.503) [-536.852] * (-535.408) [-537.450] (-539.960) (-537.035) -- 0:00:16
      738000 -- (-534.627) (-540.010) [-537.421] (-534.476) * (-536.280) (-537.900) [-535.359] (-535.743) -- 0:00:15
      738500 -- [-534.922] (-535.021) (-536.337) (-537.334) * (-536.834) (-537.335) [-535.708] (-534.026) -- 0:00:15
      739000 -- (-538.635) [-534.968] (-536.706) (-539.299) * (-537.299) [-536.085] (-536.356) (-535.314) -- 0:00:15
      739500 -- (-536.423) (-537.537) [-536.370] (-535.276) * (-538.764) (-538.346) (-537.976) [-537.644] -- 0:00:15
      740000 -- [-537.946] (-536.386) (-536.796) (-535.929) * (-538.986) (-534.498) (-537.111) [-535.426] -- 0:00:15

      Average standard deviation of split frequencies: 0.008062

      740500 -- [-537.840] (-534.861) (-535.762) (-540.316) * [-535.273] (-536.685) (-538.864) (-535.421) -- 0:00:15
      741000 -- (-536.486) (-540.402) (-535.344) [-536.325] * [-535.211] (-538.500) (-536.440) (-535.097) -- 0:00:15
      741500 -- (-535.272) (-539.145) [-536.939] (-537.693) * [-536.592] (-535.765) (-535.768) (-535.480) -- 0:00:15
      742000 -- (-536.410) (-536.060) (-539.884) [-539.404] * (-535.721) (-536.338) (-540.183) [-535.247] -- 0:00:15
      742500 -- (-536.381) (-536.633) [-539.112] (-540.024) * (-537.890) [-535.800] (-537.093) (-535.656) -- 0:00:15
      743000 -- (-536.686) [-536.571] (-536.897) (-537.986) * (-536.100) [-536.385] (-535.793) (-539.192) -- 0:00:15
      743500 -- (-540.963) (-536.786) [-539.441] (-538.370) * (-539.676) [-534.931] (-537.644) (-536.241) -- 0:00:15
      744000 -- (-538.134) (-535.723) (-538.915) [-537.171] * (-536.299) [-539.798] (-540.919) (-535.603) -- 0:00:15
      744500 -- (-540.990) (-535.432) [-535.933] (-534.914) * (-535.339) (-539.322) [-536.177] (-534.862) -- 0:00:15
      745000 -- (-535.637) [-536.338] (-536.833) (-538.249) * (-537.467) (-535.408) (-537.800) [-535.679] -- 0:00:15

      Average standard deviation of split frequencies: 0.008046

      745500 -- (-534.625) (-536.043) [-537.687] (-537.231) * [-535.880] (-537.693) (-536.529) (-539.898) -- 0:00:15
      746000 -- (-536.343) (-536.709) (-538.339) [-535.847] * (-535.554) [-536.081] (-538.326) (-536.029) -- 0:00:15
      746500 -- (-537.560) (-538.967) (-539.550) [-536.444] * [-535.486] (-535.832) (-536.945) (-536.366) -- 0:00:15
      747000 -- (-538.664) [-537.668] (-539.619) (-538.018) * [-538.640] (-536.842) (-537.807) (-538.645) -- 0:00:15
      747500 -- [-536.708] (-536.115) (-539.553) (-536.093) * [-538.987] (-539.875) (-535.840) (-536.313) -- 0:00:15
      748000 -- (-536.980) (-535.218) [-538.988] (-540.486) * (-539.992) (-538.890) [-535.822] (-539.158) -- 0:00:15
      748500 -- (-537.408) [-534.349] (-537.221) (-536.271) * (-539.225) (-538.441) [-535.643] (-541.694) -- 0:00:15
      749000 -- (-536.872) [-534.373] (-535.731) (-