--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:22:30 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2498/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -898.46          -901.82
2       -898.52          -904.67
--------------------------------------
TOTAL     -898.49          -904.04
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.893153    0.092773    0.344270    1.495126    0.860419   1325.41   1413.20    1.000
r(A<->C){all}   0.168024    0.020461    0.000120    0.454267    0.128141    210.06    241.85    1.002
r(A<->G){all}   0.160458    0.018576    0.000046    0.431137    0.124720    222.50    252.07    1.004
r(A<->T){all}   0.170328    0.020066    0.000057    0.441223    0.135058    190.82    193.00    1.000
r(C<->G){all}   0.163176    0.019673    0.000021    0.449285    0.127114    175.82    208.39    1.000
r(C<->T){all}   0.170122    0.019850    0.000017    0.457311    0.134358    311.95    346.32    1.002
r(G<->T){all}   0.167892    0.019637    0.000002    0.444960    0.132083    175.79    208.16    1.003
pi(A){all}      0.198099    0.000249    0.166921    0.229249    0.198015    998.96   1141.58    1.000
pi(C){all}      0.325817    0.000337    0.291298    0.362966    0.325626   1085.77   1174.25    1.000
pi(G){all}      0.270779    0.000301    0.238609    0.306377    0.270298   1258.75   1379.88    1.000
pi(T){all}      0.205305    0.000249    0.174513    0.235169    0.205056   1193.40   1302.86    1.000
alpha{1,2}      0.431451    0.254073    0.000212    1.447037    0.251592   1013.83   1171.88    1.000
alpha{3}        0.478884    0.252378    0.000524    1.462121    0.316489   1198.92   1239.20    1.000
pinvar{all}     0.997585    0.000008    0.991730    0.999999    0.998533   1140.02   1213.22    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-858.415
Model 2: PositiveSelection	-858.415036
Model 0: one-ratio	-858.415024
Model 7: beta	-858.415031
Model 8: beta&w>1	-858.415


Model 0 vs 1	4.8000000106185325E-5

Model 2 vs 1	7.200000004559115E-5

Model 8 vs 7	6.200000007083872E-5
>C1
MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
GVIKQTMFGHAAAALSANA
>C2
MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
GVIKQTMFGHAAAALSANA
>C3
MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
GVIKQTMFGHAAAALSANA
>C4
MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
GVIKQTMFGHAAAALSANA
>C5
MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
GVIKQTMFGHAAAALSANA
>C6
MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
GVIKQTMFGHAAAALSANA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=219 

C1              MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
C2              MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
C3              MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
C4              MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
C5              MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
C6              MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
                **************************************************

C1              LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
C2              LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
C3              LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
C4              LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
C5              LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
C6              LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
                **************************************************

C1              FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
C2              FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
C3              FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
C4              FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
C5              FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
C6              FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
                **************************************************

C1              ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
C2              ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
C3              ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
C4              ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
C5              ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
C6              ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
                **************************************************

C1              GVIKQTMFGHAAAALSANA
C2              GVIKQTMFGHAAAALSANA
C3              GVIKQTMFGHAAAALSANA
C4              GVIKQTMFGHAAAALSANA
C5              GVIKQTMFGHAAAALSANA
C6              GVIKQTMFGHAAAALSANA
                *******************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  219 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  219 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6570]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [6570]--->[6570]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.485 Mb, Max= 30.766 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
C2              MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
C3              MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
C4              MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
C5              MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
C6              MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
                **************************************************

C1              LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
C2              LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
C3              LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
C4              LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
C5              LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
C6              LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
                **************************************************

C1              FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
C2              FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
C3              FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
C4              FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
C5              FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
C6              FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
                **************************************************

C1              ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
C2              ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
C3              ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
C4              ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
C5              ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
C6              ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
                **************************************************

C1              GVIKQTMFGHAAAALSANA
C2              GVIKQTMFGHAAAALSANA
C3              GVIKQTMFGHAAAALSANA
C4              GVIKQTMFGHAAAALSANA
C5              GVIKQTMFGHAAAALSANA
C6              GVIKQTMFGHAAAALSANA
                *******************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG
C2              ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG
C3              ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG
C4              ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG
C5              ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG
C6              ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG
                **************************************************

C1              TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC
C2              TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC
C3              TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC
C4              TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC
C5              TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC
C6              TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC
                **************************************************

C1              ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA
C2              ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA
C3              ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA
C4              ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA
C5              ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA
C6              ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA
                **************************************************

C1              CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA
C2              CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA
C3              CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA
C4              CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA
C5              CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA
C6              CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA
                **************************************************

C1              CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC
C2              CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC
C3              CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC
C4              CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC
C5              CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC
C6              CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC
                **************************************************

C1              GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG
C2              GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG
C3              GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG
C4              GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG
C5              GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG
C6              GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG
                **************************************************

C1              TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG
C2              TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG
C3              TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG
C4              TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG
C5              TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG
C6              TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG
                **************************************************

C1              TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT
C2              TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT
C3              TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT
C4              TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT
C5              TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT
C6              TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT
                **************************************************

C1              TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA
C2              TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA
C3              TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA
C4              TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA
C5              TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA
C6              TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA
                **************************************************

C1              GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC
C2              GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC
C3              GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC
C4              GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC
C5              GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC
C6              GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC
                **************************************************

C1              CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG
C2              CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG
C3              CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG
C4              CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG
C5              CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG
C6              CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG
                **************************************************

C1              TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG
C2              TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG
C3              TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG
C4              TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG
C5              TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG
C6              TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG
                **************************************************

C1              GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC
C2              GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC
C3              GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC
C4              GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC
C5              GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC
C6              GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC
                **************************************************

C1              CAATGCC
C2              CAATGCC
C3              CAATGCC
C4              CAATGCC
C5              CAATGCC
C6              CAATGCC
                *******



>C1
ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG
TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC
ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA
CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA
CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC
GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG
TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG
TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT
TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA
GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC
CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG
TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG
GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC
CAATGCC
>C2
ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG
TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC
ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA
CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA
CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC
GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG
TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG
TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT
TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA
GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC
CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG
TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG
GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC
CAATGCC
>C3
ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG
TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC
ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA
CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA
CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC
GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG
TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG
TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT
TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA
GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC
CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG
TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG
GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC
CAATGCC
>C4
ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG
TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC
ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA
CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA
CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC
GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG
TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG
TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT
TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA
GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC
CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG
TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG
GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC
CAATGCC
>C5
ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG
TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC
ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA
CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA
CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC
GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG
TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG
TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT
TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA
GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC
CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG
TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG
GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC
CAATGCC
>C6
ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG
TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC
ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA
CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA
CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC
GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG
TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG
TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT
TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA
GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC
CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG
TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG
GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC
CAATGCC
>C1
MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
GVIKQTMFGHAAAALSANA
>C2
MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
GVIKQTMFGHAAAALSANA
>C3
MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
GVIKQTMFGHAAAALSANA
>C4
MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
GVIKQTMFGHAAAALSANA
>C5
MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
GVIKQTMFGHAAAALSANA
>C6
MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
GVIKQTMFGHAAAALSANA


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 657 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579857641
      Setting output file names to "/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1419500002
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5684953126
      Seed = 1900633949
      Swapseed = 1579857641
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1470.397416 -- -24.965149
         Chain 2 -- -1470.397416 -- -24.965149
         Chain 3 -- -1470.397500 -- -24.965149
         Chain 4 -- -1470.397416 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1470.397416 -- -24.965149
         Chain 2 -- -1470.397500 -- -24.965149
         Chain 3 -- -1470.397500 -- -24.965149
         Chain 4 -- -1470.397416 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1470.397] (-1470.397) (-1470.397) (-1470.397) * [-1470.397] (-1470.397) (-1470.397) (-1470.397) 
        500 -- (-923.006) (-908.986) (-912.181) [-905.822] * [-904.500] (-910.715) (-920.069) (-909.663) -- 0:00:00
       1000 -- (-916.825) [-906.674] (-908.948) (-911.771) * (-915.147) [-905.340] (-918.197) (-906.798) -- 0:00:00
       1500 -- (-905.400) (-919.179) [-908.075] (-912.295) * (-906.940) [-908.187] (-909.650) (-912.455) -- 0:00:00
       2000 -- [-908.763] (-913.999) (-906.531) (-908.164) * (-913.912) [-907.968] (-911.063) (-904.939) -- 0:00:00
       2500 -- (-909.882) [-908.539] (-927.336) (-914.833) * (-918.008) (-907.853) (-906.547) [-905.214] -- 0:00:00
       3000 -- (-904.594) (-904.378) [-908.628] (-909.390) * (-912.791) [-900.725] (-905.772) (-913.853) -- 0:00:00
       3500 -- (-912.449) (-916.841) (-908.874) [-912.623] * (-909.900) (-904.314) (-908.575) [-915.343] -- 0:00:00
       4000 -- [-908.213] (-905.808) (-913.030) (-909.002) * (-914.230) [-904.937] (-919.419) (-910.962) -- 0:00:00
       4500 -- (-904.207) [-917.517] (-909.329) (-911.444) * (-909.551) (-907.144) (-911.490) [-906.921] -- 0:00:00
       5000 -- (-911.499) (-920.579) (-903.194) [-908.108] * (-913.383) [-904.588] (-914.050) (-908.652) -- 0:00:00

      Average standard deviation of split frequencies: 0.081983

       5500 -- (-914.900) (-919.688) (-914.543) [-908.245] * (-904.759) [-907.142] (-906.693) (-910.112) -- 0:00:00
       6000 -- (-908.891) (-912.770) [-906.160] (-906.686) * (-906.216) [-906.321] (-911.953) (-910.073) -- 0:00:00
       6500 -- (-909.077) [-906.444] (-909.312) (-906.159) * (-909.688) (-905.655) [-906.488] (-903.344) -- 0:00:00
       7000 -- (-908.897) (-912.773) [-907.039] (-910.152) * (-913.434) (-908.442) (-907.678) [-906.178] -- 0:00:00
       7500 -- (-904.838) (-906.007) (-910.318) [-907.836] * (-909.114) [-911.288] (-906.049) (-913.245) -- 0:00:00
       8000 -- (-908.666) (-911.043) (-913.724) [-910.306] * (-908.470) (-907.083) [-907.729] (-911.938) -- 0:00:00
       8500 -- [-910.429] (-915.768) (-914.226) (-919.104) * (-903.322) (-907.911) [-904.910] (-905.064) -- 0:00:00
       9000 -- [-904.229] (-921.922) (-913.076) (-905.190) * [-907.081] (-904.224) (-909.536) (-907.049) -- 0:00:00
       9500 -- (-909.460) (-908.408) [-903.998] (-916.209) * (-913.211) [-912.742] (-907.581) (-904.916) -- 0:01:44
      10000 -- [-906.461] (-911.671) (-907.915) (-907.712) * [-914.550] (-910.547) (-902.998) (-909.666) -- 0:01:39

      Average standard deviation of split frequencies: 0.072106

      10500 -- (-905.351) (-908.137) [-908.294] (-905.660) * (-905.542) (-907.377) [-902.991] (-906.863) -- 0:01:34
      11000 -- (-908.990) (-909.255) (-906.629) [-905.667] * (-905.866) (-913.524) (-903.823) [-908.036] -- 0:01:29
      11500 -- [-902.724] (-901.453) (-908.468) (-903.325) * (-914.208) (-914.775) [-907.043] (-903.747) -- 0:01:25
      12000 -- [-905.343] (-909.659) (-919.113) (-910.901) * (-904.489) (-911.396) [-904.024] (-907.471) -- 0:01:22
      12500 -- [-907.509] (-909.821) (-908.454) (-904.190) * (-914.119) [-905.672] (-910.994) (-913.061) -- 0:01:19
      13000 -- [-904.926] (-910.937) (-912.091) (-906.583) * (-908.761) (-908.274) [-907.930] (-918.154) -- 0:01:15
      13500 -- (-903.908) [-912.416] (-912.072) (-904.177) * (-906.092) (-904.261) [-902.492] (-912.324) -- 0:01:13
      14000 -- (-910.160) (-907.217) [-908.420] (-904.843) * (-909.023) (-910.637) (-908.593) [-907.203] -- 0:01:10
      14500 -- (-908.454) (-908.551) [-907.554] (-901.779) * (-906.420) [-911.423] (-910.758) (-900.856) -- 0:01:07
      15000 -- (-906.856) (-911.415) [-907.547] (-911.051) * [-908.427] (-909.619) (-907.657) (-908.311) -- 0:01:05

      Average standard deviation of split frequencies: 0.058926

      15500 -- [-907.751] (-911.666) (-911.663) (-911.596) * [-912.729] (-913.765) (-907.627) (-920.090) -- 0:01:03
      16000 -- (-909.408) (-905.342) (-914.404) [-907.402] * (-906.831) [-905.823] (-906.984) (-916.671) -- 0:01:01
      16500 -- (-904.328) (-913.027) [-900.825] (-909.593) * (-910.491) (-914.055) [-903.816] (-905.543) -- 0:00:59
      17000 -- [-906.705] (-904.825) (-900.509) (-909.032) * (-910.010) (-909.629) [-907.265] (-909.637) -- 0:00:57
      17500 -- (-912.183) (-909.499) (-899.603) [-906.339] * (-904.199) (-909.357) [-907.831] (-906.499) -- 0:00:56
      18000 -- (-912.902) (-913.428) [-897.436] (-901.986) * (-908.404) [-903.269] (-909.715) (-916.071) -- 0:00:54
      18500 -- (-912.063) [-912.075] (-898.150) (-906.526) * (-911.629) (-908.087) (-913.486) [-909.972] -- 0:00:53
      19000 -- [-904.295] (-906.256) (-897.459) (-906.376) * [-905.344] (-903.876) (-911.096) (-912.687) -- 0:00:51
      19500 -- (-909.842) [-902.417] (-898.763) (-917.661) * [-904.920] (-921.710) (-906.412) (-907.314) -- 0:00:50
      20000 -- [-907.236] (-913.994) (-899.265) (-898.686) * (-918.665) (-898.107) (-913.087) [-910.670] -- 0:00:49

      Average standard deviation of split frequencies: 0.052463

      20500 -- (-908.892) (-911.449) (-899.008) [-898.469] * (-900.141) (-898.492) [-905.812] (-910.794) -- 0:00:47
      21000 -- (-912.010) [-907.553] (-899.655) (-900.580) * (-904.850) (-898.703) (-906.626) [-901.871] -- 0:00:46
      21500 -- [-910.638] (-909.626) (-898.510) (-902.809) * [-902.505] (-897.751) (-912.325) (-907.522) -- 0:00:45
      22000 -- (-907.929) (-911.316) (-899.547) [-900.460] * (-900.218) (-898.939) [-906.704] (-915.063) -- 0:00:44
      22500 -- (-905.887) (-906.720) (-903.346) [-901.961] * (-898.555) [-899.293] (-905.221) (-908.468) -- 0:01:26
      23000 -- (-908.117) (-914.797) (-901.726) [-901.876] * [-898.042] (-897.925) (-906.953) (-916.621) -- 0:01:24
      23500 -- (-908.731) [-908.468] (-898.181) (-900.951) * (-898.677) (-899.076) (-913.000) [-908.730] -- 0:01:23
      24000 -- [-914.891] (-910.101) (-898.467) (-899.390) * (-900.503) (-897.939) [-906.473] (-908.662) -- 0:01:21
      24500 -- [-907.183] (-916.044) (-897.756) (-899.239) * (-903.299) (-897.401) (-913.423) [-910.176] -- 0:01:19
      25000 -- (-909.557) [-908.091] (-897.516) (-898.132) * (-901.364) (-897.761) (-908.126) [-906.038] -- 0:01:18

      Average standard deviation of split frequencies: 0.038852

      25500 -- [-910.633] (-907.334) (-903.466) (-898.962) * (-897.559) [-897.053] (-910.100) (-905.915) -- 0:01:16
      26000 -- (-912.006) (-909.910) (-898.469) [-898.208] * (-897.335) [-897.521] (-905.758) (-908.482) -- 0:01:14
      26500 -- [-903.407] (-906.132) (-900.787) (-900.229) * (-898.085) (-896.777) (-909.215) [-908.967] -- 0:01:13
      27000 -- [-904.892] (-907.652) (-898.116) (-900.230) * (-897.179) (-898.305) (-907.127) [-911.568] -- 0:01:12
      27500 -- [-909.076] (-905.923) (-898.539) (-899.382) * (-899.773) [-898.655] (-906.262) (-911.358) -- 0:01:10
      28000 -- (-910.945) (-912.093) (-900.545) [-898.987] * (-907.192) [-898.710] (-910.124) (-908.561) -- 0:01:09
      28500 -- [-908.630] (-915.192) (-899.429) (-901.291) * [-902.083] (-900.243) (-909.328) (-907.697) -- 0:01:08
      29000 -- [-909.753] (-919.917) (-902.110) (-901.024) * (-905.513) (-903.090) [-910.884] (-903.313) -- 0:01:06
      29500 -- (-908.048) (-910.721) (-896.852) [-898.175] * (-903.680) (-899.396) (-915.030) [-908.499] -- 0:01:05
      30000 -- (-913.195) (-902.088) [-897.242] (-897.326) * (-900.914) (-901.242) [-906.812] (-915.791) -- 0:01:04

      Average standard deviation of split frequencies: 0.036124

      30500 -- (-911.484) (-907.799) [-898.463] (-903.129) * (-899.007) [-897.768] (-910.767) (-903.770) -- 0:01:03
      31000 -- (-910.687) (-909.743) [-903.407] (-899.148) * (-902.848) (-899.063) [-905.833] (-917.184) -- 0:01:02
      31500 -- (-903.221) (-908.448) [-899.705] (-898.546) * [-898.466] (-897.834) (-914.635) (-908.420) -- 0:01:01
      32000 -- (-898.300) (-905.875) (-899.230) [-898.749] * (-901.953) (-898.285) [-909.964] (-909.123) -- 0:01:00
      32500 -- [-898.390] (-908.192) (-898.302) (-900.064) * (-899.653) [-897.108] (-913.981) (-911.601) -- 0:00:59
      33000 -- [-902.437] (-903.109) (-898.988) (-899.396) * (-900.344) [-897.535] (-913.423) (-932.222) -- 0:00:58
      33500 -- (-901.930) (-909.643) (-898.107) [-898.319] * (-901.553) [-897.272] (-907.193) (-907.861) -- 0:00:57
      34000 -- (-901.727) (-908.377) [-897.272] (-899.524) * [-897.562] (-897.226) (-907.064) (-899.989) -- 0:00:56
      34500 -- (-897.257) (-907.214) [-898.641] (-899.373) * (-898.246) (-897.265) [-905.877] (-897.175) -- 0:00:55
      35000 -- [-897.989] (-907.092) (-898.240) (-899.605) * [-898.191] (-897.447) (-907.717) (-897.234) -- 0:00:55

      Average standard deviation of split frequencies: 0.029827

      35500 -- (-898.330) (-914.090) (-898.043) [-898.275] * (-898.061) (-897.632) (-909.906) [-898.717] -- 0:00:54
      36000 -- (-897.286) (-903.567) (-904.235) [-898.788] * (-899.017) [-897.268] (-909.615) (-898.855) -- 0:00:53
      36500 -- (-899.811) (-913.225) [-902.276] (-900.133) * (-899.109) (-898.477) (-906.652) [-899.329] -- 0:01:19
      37000 -- (-900.549) (-912.277) (-899.962) [-899.304] * (-899.053) (-899.173) (-900.026) [-899.228] -- 0:01:18
      37500 -- [-903.125] (-904.175) (-901.038) (-898.297) * (-898.935) (-898.139) (-898.463) [-899.645] -- 0:01:17
      38000 -- (-900.145) [-909.738] (-898.653) (-898.317) * (-899.088) (-899.980) (-897.548) [-901.790] -- 0:01:15
      38500 -- (-899.724) (-910.427) [-899.758] (-900.139) * (-902.330) [-899.269] (-898.224) (-899.084) -- 0:01:14
      39000 -- (-898.926) (-907.650) [-898.520] (-898.109) * [-897.316] (-898.843) (-898.240) (-903.459) -- 0:01:13
      39500 -- (-898.488) (-911.661) [-901.275] (-898.514) * (-898.306) (-901.462) (-899.276) [-900.094] -- 0:01:12
      40000 -- (-897.288) (-908.600) [-900.860] (-898.171) * (-902.085) (-903.072) (-897.711) [-898.412] -- 0:01:12

      Average standard deviation of split frequencies: 0.035386

      40500 -- [-898.760] (-913.612) (-899.577) (-902.875) * [-900.326] (-899.577) (-900.753) (-898.714) -- 0:01:11
      41000 -- (-901.237) (-903.457) [-899.186] (-899.140) * (-900.111) [-900.920] (-900.663) (-897.689) -- 0:01:10
      41500 -- (-898.854) [-904.089] (-900.134) (-902.500) * (-897.568) (-898.301) (-898.343) [-897.982] -- 0:01:09
      42000 -- [-899.565] (-907.768) (-899.205) (-898.710) * (-897.792) (-898.558) (-898.108) [-897.828] -- 0:01:08
      42500 -- (-900.110) (-910.226) [-899.829] (-899.585) * [-897.849] (-899.575) (-901.646) (-901.132) -- 0:01:07
      43000 -- (-899.743) (-915.416) (-897.991) [-897.207] * (-905.809) [-900.020] (-898.053) (-898.674) -- 0:01:06
      43500 -- (-898.115) [-904.992] (-897.733) (-898.973) * (-905.051) (-902.554) (-900.202) [-897.726] -- 0:01:05
      44000 -- (-901.748) (-904.171) (-900.924) [-898.888] * (-898.635) (-903.736) (-898.788) [-898.234] -- 0:01:05
      44500 -- (-900.403) (-917.833) (-899.157) [-899.914] * (-897.568) [-899.973] (-899.092) (-899.155) -- 0:01:04
      45000 -- (-897.685) [-911.256] (-898.979) (-899.725) * (-901.391) (-903.274) (-897.954) [-898.872] -- 0:01:03

      Average standard deviation of split frequencies: 0.035136

      45500 -- (-898.526) (-915.303) [-897.643] (-902.044) * (-899.342) (-902.224) [-902.948] (-900.571) -- 0:01:02
      46000 -- (-898.379) (-906.451) [-897.777] (-899.192) * (-899.044) (-899.249) (-898.819) [-898.252] -- 0:01:02
      46500 -- (-897.181) (-911.926) (-899.691) [-899.006] * [-897.822] (-899.159) (-902.273) (-900.917) -- 0:01:01
      47000 -- [-897.090] (-902.672) (-902.109) (-897.597) * (-898.543) (-900.722) [-898.980] (-901.864) -- 0:01:00
      47500 -- (-897.674) [-903.466] (-900.311) (-898.939) * (-898.580) (-901.586) [-899.615] (-898.625) -- 0:01:00
      48000 -- (-900.673) [-908.093] (-898.174) (-898.755) * [-898.603] (-898.911) (-901.775) (-897.194) -- 0:00:59
      48500 -- (-897.419) (-904.350) [-897.317] (-899.566) * (-898.480) (-902.821) [-900.672] (-897.869) -- 0:00:58
      49000 -- (-899.808) (-912.062) (-900.532) [-898.029] * [-899.805] (-899.063) (-903.868) (-899.134) -- 0:00:58
      49500 -- (-898.547) (-916.750) (-898.901) [-898.868] * (-902.927) (-897.514) [-897.629] (-899.180) -- 0:00:57
      50000 -- (-898.583) (-907.785) [-899.352] (-897.981) * (-899.971) (-898.889) (-898.040) [-898.542] -- 0:00:57

      Average standard deviation of split frequencies: 0.028758

      50500 -- [-898.549] (-907.612) (-899.863) (-898.619) * (-901.249) (-899.531) (-898.923) [-900.807] -- 0:00:56
      51000 -- (-898.373) [-906.498] (-897.151) (-898.942) * (-900.484) (-900.941) [-897.448] (-902.011) -- 0:00:55
      51500 -- [-899.011] (-905.790) (-901.213) (-900.759) * (-901.387) (-898.324) [-897.931] (-904.879) -- 0:01:13
      52000 -- (-897.977) (-913.712) (-901.581) [-901.402] * (-903.053) [-899.080] (-897.296) (-898.195) -- 0:01:12
      52500 -- (-899.626) (-915.202) [-899.036] (-899.044) * [-902.936] (-897.715) (-897.231) (-899.656) -- 0:01:12
      53000 -- (-898.683) (-909.970) [-898.144] (-898.706) * [-897.717] (-897.837) (-897.490) (-900.430) -- 0:01:11
      53500 -- (-899.575) (-907.285) (-899.519) [-898.344] * (-899.542) (-899.482) [-897.384] (-897.755) -- 0:01:10
      54000 -- (-899.897) [-903.749] (-901.499) (-901.743) * (-899.980) [-897.716] (-899.764) (-897.610) -- 0:01:10
      54500 -- (-897.850) (-912.038) [-900.291] (-898.027) * (-900.327) (-900.008) [-899.084] (-898.874) -- 0:01:09
      55000 -- (-897.728) [-908.208] (-899.079) (-901.806) * [-900.406] (-898.413) (-900.603) (-897.575) -- 0:01:08

      Average standard deviation of split frequencies: 0.029884

      55500 -- (-899.530) (-919.597) [-900.461] (-899.372) * (-901.000) (-901.202) (-897.646) [-898.747] -- 0:01:08
      56000 -- (-897.862) (-910.095) [-898.812] (-897.154) * (-901.779) (-900.667) (-899.895) [-897.285] -- 0:01:07
      56500 -- [-897.418] (-908.179) (-898.427) (-897.619) * (-900.759) (-898.507) (-897.362) [-899.001] -- 0:01:06
      57000 -- (-899.550) (-900.019) (-901.487) [-897.578] * [-900.145] (-899.657) (-899.395) (-900.844) -- 0:01:06
      57500 -- (-897.972) (-907.508) (-904.165) [-897.288] * [-901.978] (-899.362) (-900.275) (-898.439) -- 0:01:05
      58000 -- (-899.028) (-914.146) [-897.228] (-899.116) * [-897.764] (-897.929) (-899.588) (-899.002) -- 0:01:04
      58500 -- (-898.563) [-910.102] (-897.158) (-900.762) * [-898.972] (-898.449) (-900.142) (-901.543) -- 0:01:04
      59000 -- (-898.559) [-908.641] (-899.349) (-900.005) * (-899.555) [-898.101] (-898.813) (-897.857) -- 0:01:03
      59500 -- (-901.442) (-908.715) [-897.261] (-898.417) * (-898.301) (-897.529) [-903.041] (-897.675) -- 0:01:03
      60000 -- (-899.482) (-906.030) [-900.399] (-897.813) * (-904.855) (-901.778) (-900.714) [-897.618] -- 0:01:02

      Average standard deviation of split frequencies: 0.028750

      60500 -- (-899.226) (-920.535) (-899.779) [-898.299] * (-901.708) (-899.816) [-903.766] (-903.926) -- 0:01:02
      61000 -- (-901.744) (-906.618) (-900.905) [-899.541] * (-899.526) [-901.373] (-898.821) (-902.441) -- 0:01:01
      61500 -- [-901.804] (-905.647) (-901.368) (-904.559) * [-897.984] (-898.896) (-902.821) (-899.597) -- 0:01:01
      62000 -- (-898.979) (-906.585) [-897.633] (-899.211) * [-899.741] (-902.649) (-898.488) (-898.821) -- 0:01:00
      62500 -- (-898.898) [-909.337] (-897.952) (-900.837) * (-899.685) (-899.661) (-900.910) [-898.361] -- 0:01:00
      63000 -- [-903.682] (-913.530) (-899.211) (-901.368) * (-898.628) (-899.661) (-900.896) [-898.863] -- 0:00:59
      63500 -- [-899.816] (-907.536) (-900.693) (-904.851) * [-898.470] (-899.375) (-899.599) (-898.112) -- 0:00:58
      64000 -- (-899.016) [-908.178] (-899.972) (-899.441) * (-897.643) (-898.415) (-899.445) [-899.185] -- 0:00:58
      64500 -- (-903.376) (-907.489) (-901.093) [-899.331] * (-903.145) [-901.526] (-902.861) (-901.050) -- 0:00:58
      65000 -- [-898.538] (-917.366) (-900.379) (-902.292) * (-900.854) [-903.868] (-902.848) (-897.690) -- 0:00:57

      Average standard deviation of split frequencies: 0.026070

      65500 -- (-899.872) [-912.035] (-898.833) (-903.408) * (-898.790) (-897.441) [-898.639] (-900.665) -- 0:00:57
      66000 -- (-898.405) [-909.358] (-900.195) (-898.596) * [-899.563] (-897.900) (-905.415) (-900.286) -- 0:00:56
      66500 -- [-898.772] (-909.298) (-899.204) (-901.557) * (-898.520) [-899.060] (-902.890) (-898.565) -- 0:01:10
      67000 -- (-897.540) [-908.356] (-903.743) (-897.963) * (-900.068) (-898.705) [-904.519] (-898.392) -- 0:01:09
      67500 -- (-897.797) (-912.234) (-899.986) [-897.963] * (-899.848) [-899.009] (-899.695) (-900.400) -- 0:01:09
      68000 -- (-899.442) (-908.154) [-897.690] (-897.197) * (-903.132) (-898.466) (-900.673) [-897.909] -- 0:01:08
      68500 -- (-902.104) (-908.654) (-899.220) [-899.662] * (-900.581) [-899.971] (-898.433) (-900.470) -- 0:01:07
      69000 -- [-897.848] (-911.758) (-899.010) (-899.391) * (-902.273) [-898.944] (-898.639) (-898.441) -- 0:01:07
      69500 -- (-897.846) [-906.739] (-903.344) (-898.781) * (-902.950) [-899.245] (-897.644) (-897.044) -- 0:01:06
      70000 -- [-902.743] (-911.563) (-897.859) (-902.016) * (-906.115) [-899.258] (-899.584) (-897.302) -- 0:01:06

      Average standard deviation of split frequencies: 0.030019

      70500 -- (-903.449) (-908.794) [-898.681] (-898.112) * (-898.863) [-899.012] (-898.984) (-897.108) -- 0:01:05
      71000 -- (-899.021) [-904.538] (-900.965) (-899.787) * [-897.747] (-900.429) (-898.100) (-899.542) -- 0:01:05
      71500 -- (-899.403) (-908.542) (-898.534) [-898.799] * (-898.046) (-901.828) (-900.759) [-902.004] -- 0:01:04
      72000 -- (-899.938) (-906.848) (-897.951) [-899.735] * (-898.293) (-898.879) [-898.076] (-901.166) -- 0:01:04
      72500 -- (-899.984) [-916.455] (-898.731) (-899.462) * [-902.899] (-900.725) (-899.860) (-901.528) -- 0:01:03
      73000 -- (-897.500) (-909.366) [-897.899] (-898.179) * (-898.187) [-897.998] (-897.693) (-903.288) -- 0:01:03
      73500 -- (-899.258) (-909.316) (-897.909) [-897.523] * (-898.565) [-898.113] (-898.845) (-897.721) -- 0:01:03
      74000 -- (-899.897) (-907.095) [-898.941] (-898.047) * (-899.177) (-901.372) (-899.690) [-899.227] -- 0:01:02
      74500 -- (-901.001) (-920.394) [-897.789] (-898.124) * (-899.225) (-901.055) (-898.943) [-898.880] -- 0:01:02
      75000 -- (-900.320) [-904.554] (-900.392) (-898.124) * [-898.944] (-899.185) (-898.590) (-901.009) -- 0:01:01

      Average standard deviation of split frequencies: 0.028946

      75500 -- (-900.816) [-909.496] (-898.162) (-898.285) * (-898.944) [-899.974] (-897.747) (-901.334) -- 0:01:01
      76000 -- (-899.199) [-906.169] (-903.636) (-897.911) * (-898.863) (-899.181) [-902.155] (-899.723) -- 0:01:00
      76500 -- (-902.706) (-909.388) (-899.389) [-897.880] * [-897.660] (-901.531) (-897.293) (-902.757) -- 0:01:00
      77000 -- [-902.338] (-906.064) (-898.644) (-898.330) * [-897.789] (-898.739) (-900.246) (-898.206) -- 0:00:59
      77500 -- (-901.666) (-913.564) [-898.925] (-899.231) * (-900.477) (-897.922) (-898.642) [-900.960] -- 0:00:59
      78000 -- (-899.903) (-909.327) (-898.380) [-898.015] * (-900.284) (-900.947) (-899.449) [-901.801] -- 0:00:59
      78500 -- [-897.912] (-911.187) (-898.294) (-898.913) * (-897.727) (-899.825) [-898.884] (-900.188) -- 0:00:58
      79000 -- (-900.191) (-914.434) (-900.498) [-897.339] * (-897.530) (-897.504) [-897.792] (-899.085) -- 0:00:58
      79500 -- (-898.645) [-904.842] (-900.779) (-897.317) * [-899.139] (-900.098) (-897.179) (-899.239) -- 0:00:57
      80000 -- (-901.101) (-907.139) (-898.960) [-899.365] * (-899.847) (-901.548) (-897.441) [-898.409] -- 0:00:57

      Average standard deviation of split frequencies: 0.028663

      80500 -- [-898.180] (-898.418) (-900.659) (-900.704) * [-900.408] (-902.366) (-897.745) (-898.498) -- 0:00:57
      81000 -- [-898.332] (-899.313) (-899.700) (-900.502) * (-902.335) (-906.982) (-899.792) [-898.574] -- 0:00:56
      81500 -- (-901.295) (-897.400) [-899.814] (-899.303) * [-900.310] (-898.013) (-900.942) (-899.252) -- 0:00:56
      82000 -- (-897.560) [-898.356] (-900.616) (-901.159) * (-898.406) (-898.249) (-902.279) [-898.619] -- 0:01:07
      82500 -- (-899.148) (-898.106) (-898.330) [-900.334] * (-899.065) (-901.678) [-899.456] (-898.874) -- 0:01:06
      83000 -- (-902.591) [-898.540] (-898.592) (-906.078) * (-899.478) (-896.983) [-899.677] (-897.797) -- 0:01:06
      83500 -- (-901.116) (-897.951) (-900.513) [-901.697] * [-898.981] (-898.656) (-897.519) (-898.103) -- 0:01:05
      84000 -- (-900.965) (-901.451) (-900.093) [-906.719] * (-898.005) [-899.345] (-899.116) (-898.693) -- 0:01:05
      84500 -- (-898.692) (-900.156) [-899.799] (-903.759) * (-899.164) (-898.579) [-898.116] (-898.456) -- 0:01:05
      85000 -- (-901.697) (-900.706) [-899.121] (-899.418) * [-898.803] (-899.766) (-900.065) (-899.026) -- 0:01:04

      Average standard deviation of split frequencies: 0.029234

      85500 -- (-899.263) (-899.485) [-900.623] (-898.505) * (-898.146) (-899.150) [-899.090] (-899.058) -- 0:01:04
      86000 -- (-899.193) [-899.805] (-900.219) (-900.645) * (-898.356) (-898.460) [-904.365] (-898.256) -- 0:01:03
      86500 -- [-899.536] (-902.820) (-900.563) (-897.624) * (-897.339) (-900.407) [-900.596] (-900.150) -- 0:01:03
      87000 -- [-898.095] (-900.788) (-898.345) (-897.295) * (-898.704) (-897.270) [-897.543] (-901.033) -- 0:01:02
      87500 -- (-900.180) [-899.676] (-898.984) (-900.997) * (-897.740) (-898.035) [-900.252] (-897.509) -- 0:01:02
      88000 -- [-898.808] (-898.470) (-901.214) (-899.846) * [-897.528] (-898.340) (-899.167) (-900.670) -- 0:01:02
      88500 -- [-899.878] (-901.535) (-897.588) (-900.042) * (-897.937) (-899.173) [-899.746] (-900.185) -- 0:01:01
      89000 -- [-900.234] (-904.707) (-898.257) (-900.808) * (-899.452) (-901.135) [-898.410] (-898.901) -- 0:01:01
      89500 -- (-900.826) [-899.203] (-897.982) (-900.338) * [-897.249] (-898.432) (-899.911) (-897.589) -- 0:01:01
      90000 -- (-898.951) [-900.873] (-900.818) (-901.507) * [-897.740] (-900.174) (-900.002) (-899.821) -- 0:01:00

      Average standard deviation of split frequencies: 0.032378

      90500 -- (-899.539) (-898.547) [-897.522] (-904.628) * (-898.893) (-899.436) (-901.134) [-901.492] -- 0:01:00
      91000 -- (-899.851) [-898.922] (-902.420) (-900.553) * (-897.875) [-897.381] (-900.215) (-903.843) -- 0:00:59
      91500 -- (-900.213) [-900.402] (-902.748) (-898.654) * (-898.406) (-899.342) [-900.414] (-897.928) -- 0:00:59
      92000 -- [-902.370] (-900.315) (-899.002) (-898.588) * (-897.668) [-897.463] (-901.411) (-897.565) -- 0:00:59
      92500 -- (-899.296) (-901.660) [-899.645] (-899.841) * (-899.732) (-897.786) [-899.019] (-900.940) -- 0:00:58
      93000 -- (-898.319) [-898.402] (-900.008) (-899.505) * (-900.606) (-897.671) [-899.310] (-899.989) -- 0:00:58
      93500 -- (-898.721) [-899.630] (-899.190) (-900.798) * (-897.963) (-900.628) (-897.855) [-899.177] -- 0:00:58
      94000 -- [-898.617] (-897.956) (-897.684) (-899.513) * [-899.461] (-900.640) (-897.067) (-897.350) -- 0:00:57
      94500 -- (-898.486) (-897.570) [-898.124] (-901.263) * [-898.403] (-899.427) (-898.313) (-898.784) -- 0:00:57
      95000 -- [-897.612] (-898.005) (-899.771) (-902.303) * (-897.686) [-900.929] (-900.522) (-899.367) -- 0:00:57

      Average standard deviation of split frequencies: 0.029686

      95500 -- (-898.845) [-897.448] (-898.215) (-898.867) * [-900.066] (-900.400) (-898.355) (-901.385) -- 0:00:56
      96000 -- (-898.820) [-898.014] (-898.413) (-898.321) * [-897.991] (-901.936) (-897.016) (-901.295) -- 0:00:56
      96500 -- (-898.520) (-898.482) [-900.604] (-898.528) * (-898.636) [-900.813] (-902.342) (-898.501) -- 0:00:56
      97000 -- (-898.876) (-899.014) [-899.982] (-898.764) * (-904.699) (-902.959) [-897.993] (-899.311) -- 0:01:05
      97500 -- (-897.997) (-898.659) [-901.646] (-897.637) * (-898.553) (-902.324) [-898.645] (-898.235) -- 0:01:04
      98000 -- (-898.309) (-898.229) (-900.518) [-897.004] * [-897.954] (-904.569) (-896.955) (-903.358) -- 0:01:04
      98500 -- [-897.402] (-898.226) (-899.413) (-899.493) * [-898.441] (-902.522) (-901.322) (-899.060) -- 0:01:04
      99000 -- (-900.141) (-898.040) (-899.534) [-897.107] * [-898.159] (-902.817) (-900.537) (-900.197) -- 0:01:03
      99500 -- [-899.577] (-900.381) (-904.806) (-898.217) * (-899.007) [-902.321] (-897.951) (-898.897) -- 0:01:03
      100000 -- (-897.732) [-898.049] (-899.116) (-901.806) * (-901.528) (-902.715) [-898.485] (-905.068) -- 0:01:02

      Average standard deviation of split frequencies: 0.029435

      100500 -- (-898.139) (-897.500) (-897.556) [-902.098] * (-903.447) [-898.448] (-897.154) (-903.390) -- 0:01:02
      101000 -- (-899.324) [-898.132] (-897.925) (-901.205) * (-902.485) (-897.891) (-897.435) [-901.937] -- 0:01:02
      101500 -- [-898.543] (-899.181) (-902.368) (-900.202) * (-897.912) (-898.999) [-897.671] (-899.009) -- 0:01:01
      102000 -- (-900.019) [-901.132] (-899.678) (-898.745) * (-897.680) [-902.048] (-904.342) (-898.790) -- 0:01:01
      102500 -- [-897.744] (-901.114) (-900.509) (-898.543) * (-898.359) [-904.127] (-898.471) (-898.789) -- 0:01:01
      103000 -- (-899.964) (-900.154) [-900.366] (-898.665) * (-899.220) [-898.829] (-899.288) (-897.630) -- 0:01:00
      103500 -- (-898.872) (-900.458) (-900.705) [-899.545] * (-903.406) (-897.481) [-898.981] (-897.719) -- 0:01:00
      104000 -- [-897.793] (-900.189) (-898.719) (-900.289) * [-900.395] (-901.577) (-898.284) (-899.779) -- 0:01:00
      104500 -- (-898.344) (-899.192) [-897.496] (-901.540) * (-904.471) [-901.959] (-898.398) (-900.235) -- 0:00:59
      105000 -- (-897.387) (-899.923) [-898.555] (-899.482) * (-900.591) (-898.207) [-897.556] (-898.597) -- 0:00:59

      Average standard deviation of split frequencies: 0.027107

      105500 -- (-900.176) (-900.817) [-897.791] (-897.520) * (-898.110) (-901.713) (-900.008) [-898.359] -- 0:00:59
      106000 -- (-905.851) (-898.534) (-898.910) [-897.455] * (-897.253) (-899.243) [-900.512] (-898.099) -- 0:00:59
      106500 -- (-900.023) (-900.606) [-899.179] (-902.061) * [-899.375] (-904.608) (-898.715) (-903.679) -- 0:00:58
      107000 -- (-899.081) (-907.703) (-904.237) [-898.695] * (-897.212) [-898.590] (-898.764) (-899.057) -- 0:00:58
      107500 -- (-899.639) (-899.897) (-898.051) [-899.474] * (-900.103) (-897.070) [-900.684] (-905.029) -- 0:00:58
      108000 -- (-900.306) [-898.635] (-897.373) (-899.099) * (-899.300) [-898.581] (-900.538) (-898.737) -- 0:00:57
      108500 -- [-900.053] (-900.286) (-897.864) (-902.811) * (-899.966) (-898.796) [-898.033] (-898.452) -- 0:00:57
      109000 -- (-898.876) [-900.761] (-905.026) (-898.948) * (-898.848) (-899.262) (-897.839) [-898.395] -- 0:00:57
      109500 -- [-898.049] (-900.258) (-900.323) (-901.477) * (-900.659) (-899.083) [-900.539] (-898.591) -- 0:00:56
      110000 -- [-897.592] (-903.271) (-898.656) (-899.261) * (-901.279) [-898.983] (-898.211) (-900.910) -- 0:00:56

      Average standard deviation of split frequencies: 0.024747

      110500 -- (-897.877) (-899.373) [-897.177] (-897.498) * [-897.424] (-897.690) (-901.801) (-900.100) -- 0:00:56
      111000 -- [-897.984] (-897.023) (-898.192) (-898.568) * (-897.884) [-897.561] (-899.257) (-901.977) -- 0:00:56
      111500 -- [-900.069] (-897.074) (-900.197) (-899.873) * (-901.972) (-897.978) [-903.433] (-903.879) -- 0:00:55
      112000 -- (-898.062) (-898.040) (-899.097) [-897.877] * (-901.614) [-896.920] (-899.674) (-901.893) -- 0:00:55
      112500 -- [-897.276] (-899.289) (-897.929) (-898.666) * (-902.283) (-902.259) [-898.973] (-898.447) -- 0:01:03
      113000 -- (-897.552) (-898.483) [-897.555] (-898.172) * (-900.584) (-898.777) (-900.600) [-899.089] -- 0:01:02
      113500 -- [-899.429] (-901.262) (-899.235) (-898.778) * (-898.489) (-899.896) (-902.382) [-898.131] -- 0:01:02
      114000 -- [-897.909] (-901.432) (-899.374) (-898.022) * (-900.701) [-897.462] (-902.656) (-902.651) -- 0:01:02
      114500 -- (-898.083) (-897.903) (-898.752) [-899.845] * (-898.548) (-898.822) (-902.223) [-900.496] -- 0:01:01
      115000 -- (-902.168) (-898.422) (-906.008) [-898.771] * (-899.669) [-898.309] (-900.275) (-901.430) -- 0:01:01

      Average standard deviation of split frequencies: 0.023367

      115500 -- (-901.052) [-897.425] (-902.467) (-898.839) * [-897.984] (-899.606) (-899.266) (-898.555) -- 0:01:01
      116000 -- (-900.260) [-901.752] (-899.134) (-900.162) * [-897.120] (-900.323) (-898.068) (-898.066) -- 0:01:00
      116500 -- (-898.619) (-902.158) (-899.513) [-897.923] * (-899.389) [-900.067] (-900.636) (-897.318) -- 0:01:00
      117000 -- [-897.560] (-898.657) (-899.951) (-900.666) * [-898.677] (-900.065) (-901.613) (-901.079) -- 0:01:00
      117500 -- (-899.417) [-897.408] (-898.635) (-897.003) * (-899.326) (-902.001) (-903.987) [-901.706] -- 0:01:00
      118000 -- (-898.663) [-898.212] (-898.170) (-900.572) * (-899.258) [-901.026] (-902.475) (-903.554) -- 0:00:59
      118500 -- (-900.972) [-900.201] (-899.066) (-900.752) * [-898.488] (-899.062) (-905.214) (-901.456) -- 0:00:59
      119000 -- [-897.672] (-900.447) (-901.818) (-900.051) * [-899.879] (-898.842) (-900.870) (-899.918) -- 0:00:59
      119500 -- (-897.635) [-899.873] (-898.058) (-901.690) * [-901.676] (-901.584) (-901.369) (-899.281) -- 0:00:58
      120000 -- [-901.604] (-898.903) (-898.179) (-898.818) * (-899.750) (-899.268) (-900.594) [-901.428] -- 0:00:58

      Average standard deviation of split frequencies: 0.024026

      120500 -- (-901.453) (-898.553) (-899.479) [-898.003] * [-899.335] (-899.144) (-899.150) (-901.720) -- 0:00:58
      121000 -- [-899.181] (-902.471) (-899.384) (-900.384) * (-900.989) (-898.862) (-897.907) [-899.778] -- 0:00:58
      121500 -- (-900.095) (-901.991) (-899.221) [-898.734] * (-900.788) (-897.650) [-897.472] (-898.512) -- 0:00:57
      122000 -- (-898.165) (-899.911) [-897.714] (-899.395) * (-898.619) (-898.950) (-897.395) [-899.496] -- 0:00:57
      122500 -- (-898.971) [-898.856] (-897.647) (-897.758) * [-901.889] (-900.021) (-902.394) (-902.690) -- 0:00:57
      123000 -- [-900.486] (-899.788) (-898.179) (-898.216) * (-901.369) (-899.736) [-903.802] (-901.672) -- 0:00:57
      123500 -- [-900.031] (-897.556) (-899.860) (-898.650) * (-900.258) (-899.852) [-899.069] (-900.316) -- 0:00:56
      124000 -- (-901.432) (-901.391) (-897.485) [-898.611] * (-901.430) (-901.128) [-897.920] (-898.332) -- 0:00:56
      124500 -- [-899.531] (-900.557) (-897.441) (-899.174) * (-900.098) [-901.465] (-905.142) (-900.235) -- 0:00:56
      125000 -- (-897.715) (-898.712) (-897.900) [-897.272] * [-902.242] (-903.085) (-902.683) (-898.184) -- 0:00:56

      Average standard deviation of split frequencies: 0.023757

      125500 -- [-900.280] (-898.905) (-897.493) (-897.769) * (-901.969) (-901.774) (-899.501) [-898.420] -- 0:00:55
      126000 -- (-897.241) (-901.253) (-901.181) [-898.121] * (-900.002) [-901.259] (-899.272) (-897.638) -- 0:00:55
      126500 -- [-898.111] (-902.098) (-902.824) (-899.034) * [-901.852] (-901.098) (-900.225) (-902.185) -- 0:00:55
      127000 -- (-898.085) (-900.268) (-900.784) [-898.860] * [-899.960] (-899.692) (-899.840) (-901.910) -- 0:00:54
      127500 -- (-898.649) (-900.404) (-899.384) [-899.117] * (-901.519) (-899.843) [-898.464] (-899.610) -- 0:00:54
      128000 -- (-900.144) [-898.861] (-904.766) (-899.338) * (-897.890) (-902.657) [-900.112] (-898.636) -- 0:01:01
      128500 -- (-898.680) (-898.300) [-897.070] (-900.478) * (-902.558) (-900.523) (-898.806) [-899.286] -- 0:01:01
      129000 -- (-906.486) (-898.258) (-898.586) [-898.712] * (-898.446) (-902.620) (-899.044) [-899.286] -- 0:01:00
      129500 -- (-899.387) (-899.621) (-904.811) [-900.376] * (-899.729) (-901.005) [-903.989] (-899.108) -- 0:01:00
      130000 -- (-900.348) [-897.774] (-901.220) (-898.094) * (-899.081) (-900.482) (-903.053) [-898.937] -- 0:01:00

      Average standard deviation of split frequencies: 0.023250

      130500 -- (-899.466) [-897.503] (-900.873) (-899.678) * (-897.665) (-902.729) (-900.907) [-898.878] -- 0:00:59
      131000 -- [-898.973] (-898.948) (-898.398) (-898.955) * [-898.947] (-899.677) (-900.030) (-898.803) -- 0:00:59
      131500 -- (-900.376) (-897.797) [-900.592] (-900.778) * (-902.999) [-898.847] (-900.539) (-898.888) -- 0:00:59
      132000 -- [-898.281] (-902.159) (-903.517) (-899.215) * (-903.347) (-897.837) [-898.848] (-898.892) -- 0:00:59
      132500 -- (-898.537) [-902.730] (-901.187) (-898.646) * (-897.441) [-898.581] (-898.832) (-899.679) -- 0:00:58
      133000 -- [-900.107] (-902.870) (-898.120) (-901.450) * (-899.290) (-901.233) [-899.190] (-897.987) -- 0:00:58
      133500 -- [-897.642] (-904.418) (-900.029) (-899.056) * (-897.166) [-899.519] (-898.536) (-898.728) -- 0:00:58
      134000 -- (-898.047) [-898.333] (-899.769) (-899.756) * [-897.160] (-902.496) (-898.392) (-900.037) -- 0:00:58
      134500 -- [-897.748] (-896.977) (-899.192) (-898.504) * (-897.567) (-899.915) [-899.212] (-902.734) -- 0:00:57
      135000 -- (-899.346) (-898.298) [-900.749] (-899.296) * (-899.861) [-903.041] (-898.203) (-900.404) -- 0:00:57

      Average standard deviation of split frequencies: 0.021568

      135500 -- (-897.774) (-899.760) (-903.439) [-898.534] * (-901.826) (-898.056) (-900.079) [-899.060] -- 0:00:57
      136000 -- (-902.131) (-899.071) [-905.419] (-899.595) * (-902.108) (-899.331) (-899.030) [-899.318] -- 0:00:57
      136500 -- (-898.513) (-898.031) [-899.503] (-898.998) * (-902.501) (-897.757) (-899.429) [-900.510] -- 0:00:56
      137000 -- (-900.229) [-899.970] (-899.266) (-898.466) * (-900.194) (-897.630) [-899.873] (-898.758) -- 0:00:56
      137500 -- (-907.156) [-899.395] (-899.465) (-898.960) * (-900.739) [-898.637] (-901.472) (-901.576) -- 0:00:56
      138000 -- (-903.868) [-901.778] (-898.417) (-900.468) * (-900.692) (-898.883) (-899.117) [-900.209] -- 0:00:56
      138500 -- [-896.938] (-901.120) (-898.159) (-898.775) * [-898.450] (-899.866) (-897.344) (-904.003) -- 0:00:55
      139000 -- (-900.552) (-900.948) (-898.065) [-898.653] * (-897.787) [-898.738] (-899.609) (-900.065) -- 0:00:55
      139500 -- (-902.824) [-897.615] (-897.360) (-900.468) * (-897.833) (-904.776) [-897.511] (-899.827) -- 0:00:55
      140000 -- [-899.605] (-899.524) (-897.324) (-899.866) * (-902.611) (-898.669) [-897.721] (-900.337) -- 0:00:55

      Average standard deviation of split frequencies: 0.019735

      140500 -- [-904.549] (-904.195) (-899.641) (-899.464) * (-898.694) (-898.078) [-898.330] (-899.743) -- 0:00:55
      141000 -- [-903.739] (-901.857) (-898.743) (-897.423) * (-899.226) (-898.520) [-897.955] (-899.151) -- 0:00:54
      141500 -- (-898.860) (-899.047) [-899.695] (-900.940) * (-900.162) (-900.468) [-897.234] (-897.974) -- 0:00:54
      142000 -- (-897.474) [-898.148] (-900.236) (-900.970) * [-898.983] (-900.285) (-897.713) (-898.164) -- 0:00:54
      142500 -- [-897.433] (-899.889) (-903.234) (-902.338) * (-898.731) (-901.044) [-898.157] (-899.393) -- 0:00:54
      143000 -- [-899.243] (-899.868) (-899.573) (-901.768) * (-899.799) (-901.201) [-899.446] (-899.178) -- 0:00:59
      143500 -- (-901.168) (-897.331) (-903.943) [-898.743] * (-898.984) (-897.864) (-902.879) [-898.280] -- 0:00:59
      144000 -- (-900.243) [-898.400] (-900.925) (-898.558) * (-898.686) (-899.023) [-900.945] (-898.465) -- 0:00:59
      144500 -- (-901.099) (-904.080) (-897.594) [-899.686] * (-900.727) (-897.761) [-900.106] (-899.245) -- 0:00:59
      145000 -- (-904.668) (-901.066) (-898.343) [-898.182] * (-899.083) (-897.044) [-898.088] (-898.863) -- 0:00:58

      Average standard deviation of split frequencies: 0.021346

      145500 -- [-898.530] (-899.800) (-897.471) (-900.728) * (-898.509) [-902.837] (-901.418) (-900.010) -- 0:00:58
      146000 -- (-897.454) [-898.524] (-900.707) (-900.073) * (-898.417) (-902.397) (-899.927) [-900.190] -- 0:00:58
      146500 -- (-897.995) (-898.632) (-900.740) [-897.862] * [-898.644] (-898.872) (-899.395) (-903.006) -- 0:00:58
      147000 -- (-901.915) (-898.470) [-897.897] (-900.103) * [-899.999] (-899.433) (-900.715) (-900.160) -- 0:00:58
      147500 -- [-904.613] (-899.104) (-903.447) (-899.228) * (-898.836) (-901.791) [-899.149] (-899.560) -- 0:00:57
      148000 -- (-898.881) (-898.879) (-901.649) [-898.074] * (-900.244) (-897.675) (-898.924) [-899.512] -- 0:00:57
      148500 -- (-900.697) (-899.273) [-898.753] (-897.167) * [-901.163] (-897.936) (-900.361) (-900.308) -- 0:00:57
      149000 -- (-902.105) (-900.687) (-901.433) [-898.724] * [-900.064] (-899.235) (-901.264) (-899.465) -- 0:00:57
      149500 -- [-897.987] (-902.372) (-901.856) (-899.502) * (-899.732) (-900.500) (-898.274) [-897.249] -- 0:00:56
      150000 -- (-900.690) (-898.291) (-906.113) [-900.087] * (-901.875) (-900.313) [-898.561] (-897.771) -- 0:00:56

      Average standard deviation of split frequencies: 0.019120

      150500 -- (-897.957) [-900.094] (-903.232) (-897.610) * [-900.513] (-900.010) (-897.901) (-897.938) -- 0:00:56
      151000 -- (-897.359) (-901.855) (-897.703) [-898.481] * (-900.599) (-899.370) (-899.908) [-900.198] -- 0:00:56
      151500 -- (-900.688) (-902.326) (-896.883) [-897.302] * (-899.769) (-897.799) (-900.678) [-897.603] -- 0:00:56
      152000 -- (-899.571) [-901.484] (-900.925) (-897.708) * (-898.089) [-902.545] (-898.614) (-903.646) -- 0:00:55
      152500 -- (-898.285) (-901.881) [-897.888] (-901.694) * (-898.347) [-902.343] (-899.307) (-898.978) -- 0:00:55
      153000 -- (-899.074) (-903.985) (-900.709) [-898.910] * [-898.227] (-899.136) (-900.571) (-898.371) -- 0:00:55
      153500 -- [-897.551] (-901.173) (-900.310) (-898.914) * (-899.769) (-902.182) (-899.297) [-899.602] -- 0:00:55
      154000 -- (-897.635) (-898.748) [-899.827] (-898.099) * (-900.762) [-901.373] (-897.869) (-897.118) -- 0:00:54
      154500 -- (-898.620) [-900.505] (-899.117) (-898.307) * (-899.667) (-901.446) (-898.450) [-902.858] -- 0:00:54
      155000 -- (-898.559) (-899.163) [-897.960] (-898.933) * (-899.877) (-901.987) (-898.514) [-898.230] -- 0:00:54

      Average standard deviation of split frequencies: 0.019721

      155500 -- (-898.949) (-898.608) (-903.025) [-899.423] * (-900.661) (-900.585) (-898.964) [-898.159] -- 0:00:54
      156000 -- [-897.163] (-902.005) (-899.206) (-897.448) * (-899.361) (-897.716) [-903.287] (-900.501) -- 0:00:54
      156500 -- (-903.931) (-898.018) (-898.215) [-897.448] * [-897.637] (-897.448) (-900.361) (-902.017) -- 0:00:53
      157000 -- (-900.897) [-898.059] (-898.181) (-898.174) * (-899.165) (-899.592) [-898.142] (-900.389) -- 0:00:53
      157500 -- [-900.109] (-898.940) (-898.223) (-901.624) * [-899.876] (-897.770) (-897.518) (-899.305) -- 0:00:53
      158000 -- (-898.348) [-898.023] (-898.886) (-900.505) * (-898.527) (-897.825) [-898.098] (-900.081) -- 0:00:58
      158500 -- [-898.504] (-898.831) (-904.595) (-899.086) * (-903.487) [-897.115] (-901.378) (-898.039) -- 0:00:58
      159000 -- (-900.624) [-897.041] (-900.869) (-901.073) * (-904.662) (-902.522) [-901.773] (-899.046) -- 0:00:58
      159500 -- [-899.211] (-897.201) (-903.547) (-902.665) * (-903.043) (-901.813) [-902.359] (-899.672) -- 0:00:57
      160000 -- (-901.018) (-897.201) [-899.988] (-900.147) * (-900.734) [-898.888] (-902.025) (-899.622) -- 0:00:57

      Average standard deviation of split frequencies: 0.016914

      160500 -- (-900.677) (-898.684) (-899.499) [-899.961] * [-899.189] (-899.799) (-898.217) (-898.679) -- 0:00:57
      161000 -- (-899.644) (-901.689) [-897.389] (-898.415) * [-898.776] (-898.488) (-898.871) (-898.970) -- 0:00:57
      161500 -- [-903.417] (-901.223) (-899.046) (-900.754) * (-898.350) (-901.039) (-901.049) [-897.935] -- 0:00:57
      162000 -- (-901.741) (-899.458) [-898.689] (-900.548) * (-897.517) (-900.048) (-902.070) [-897.906] -- 0:00:56
      162500 -- (-900.093) (-898.679) [-898.734] (-898.706) * (-898.946) [-898.334] (-898.200) (-897.236) -- 0:00:56
      163000 -- (-902.306) [-900.438] (-909.754) (-899.506) * [-900.695] (-900.123) (-899.964) (-898.638) -- 0:00:56
      163500 -- (-902.312) [-900.114] (-897.738) (-900.317) * (-901.468) (-899.318) [-899.606] (-907.250) -- 0:00:56
      164000 -- (-901.494) [-900.448] (-897.674) (-899.157) * (-901.374) (-899.547) [-899.126] (-901.737) -- 0:00:56
      164500 -- (-899.668) (-900.227) [-899.355] (-899.146) * (-897.007) (-898.979) [-898.879] (-897.613) -- 0:00:55
      165000 -- [-897.895] (-900.237) (-903.691) (-900.455) * (-898.754) (-898.429) [-896.979] (-897.613) -- 0:00:55

      Average standard deviation of split frequencies: 0.017039

      165500 -- (-899.983) (-898.362) (-902.865) [-901.238] * (-899.071) (-902.774) (-898.775) [-898.440] -- 0:00:55
      166000 -- (-899.997) (-901.637) (-898.128) [-897.420] * (-900.482) [-899.834] (-901.036) (-900.801) -- 0:00:55
      166500 -- (-898.699) (-902.920) [-898.476] (-903.020) * [-899.193] (-897.880) (-902.356) (-901.085) -- 0:00:55
      167000 -- (-899.702) (-908.714) [-901.040] (-897.354) * (-900.725) (-898.596) [-898.665] (-897.003) -- 0:00:54
      167500 -- (-899.854) [-899.827] (-899.546) (-901.521) * (-900.026) (-900.944) [-898.379] (-898.172) -- 0:00:54
      168000 -- (-899.272) [-898.346] (-897.779) (-900.334) * (-905.801) (-901.558) [-897.574] (-897.374) -- 0:00:54
      168500 -- (-900.545) (-898.231) [-898.849] (-902.196) * (-900.559) (-900.394) [-901.006] (-896.959) -- 0:00:54
      169000 -- (-900.747) (-897.981) [-897.479] (-899.189) * (-901.170) [-899.624] (-898.174) (-899.694) -- 0:00:54
      169500 -- (-899.104) [-897.221] (-897.802) (-897.888) * [-898.630] (-898.740) (-899.183) (-901.052) -- 0:00:53
      170000 -- (-901.021) (-897.854) [-897.649] (-897.060) * (-898.322) (-899.263) [-898.998] (-902.487) -- 0:00:53

      Average standard deviation of split frequencies: 0.014578

      170500 -- [-900.368] (-898.537) (-899.680) (-900.427) * (-898.385) (-899.898) [-897.264] (-898.506) -- 0:00:53
      171000 -- (-898.274) (-901.128) (-898.381) [-897.980] * [-899.163] (-900.835) (-897.279) (-897.722) -- 0:00:53
      171500 -- [-897.992] (-898.375) (-897.983) (-899.099) * (-898.011) (-900.143) [-897.159] (-898.969) -- 0:00:53
      172000 -- [-898.192] (-897.657) (-899.259) (-900.755) * (-898.700) [-900.444] (-898.214) (-898.257) -- 0:00:52
      172500 -- (-901.829) [-900.543] (-897.227) (-898.754) * (-899.081) [-899.042] (-903.885) (-902.759) -- 0:00:52
      173000 -- (-898.330) (-900.692) [-899.012] (-897.847) * [-898.442] (-898.086) (-899.023) (-898.332) -- 0:00:57
      173500 -- (-898.145) (-901.297) (-899.055) [-899.210] * [-899.250] (-897.730) (-898.335) (-897.465) -- 0:00:57
      174000 -- (-898.688) (-898.275) [-901.080] (-899.512) * (-898.675) [-899.665] (-897.424) (-897.049) -- 0:00:56
      174500 -- [-897.851] (-902.585) (-898.240) (-899.624) * (-902.243) [-899.853] (-901.247) (-897.083) -- 0:00:56
      175000 -- [-901.170] (-898.497) (-898.391) (-899.883) * (-900.268) [-898.729] (-899.474) (-898.562) -- 0:00:56

      Average standard deviation of split frequencies: 0.014583

      175500 -- (-901.067) (-900.014) (-902.423) [-900.802] * (-897.430) (-898.182) [-897.406] (-900.320) -- 0:00:56
      176000 -- [-897.862] (-900.526) (-904.713) (-901.172) * (-899.425) (-897.197) [-898.019] (-899.477) -- 0:00:56
      176500 -- (-898.251) (-899.806) [-899.062] (-899.319) * [-897.771] (-898.612) (-898.688) (-897.524) -- 0:00:55
      177000 -- (-900.394) (-903.003) [-901.670] (-902.299) * (-898.506) [-898.450] (-899.913) (-897.504) -- 0:00:55
      177500 -- (-901.532) (-898.081) [-899.584] (-904.111) * (-899.687) (-898.420) (-900.484) [-898.596] -- 0:00:55
      178000 -- (-899.831) (-899.471) (-900.120) [-900.495] * (-900.604) (-898.105) (-902.030) [-898.616] -- 0:00:55
      178500 -- (-898.562) (-901.813) [-899.658] (-898.001) * [-898.753] (-899.230) (-899.459) (-901.895) -- 0:00:55
      179000 -- (-898.673) (-898.397) [-903.046] (-897.898) * (-897.708) [-901.355] (-901.124) (-901.408) -- 0:00:55
      179500 -- (-899.885) [-898.593] (-902.273) (-898.913) * (-906.482) [-897.530] (-897.996) (-899.047) -- 0:00:54
      180000 -- [-898.066] (-897.995) (-900.408) (-900.328) * (-905.037) [-898.814] (-901.476) (-897.033) -- 0:00:54

      Average standard deviation of split frequencies: 0.014735

      180500 -- [-900.993] (-899.473) (-897.522) (-898.823) * [-898.577] (-901.010) (-902.375) (-897.852) -- 0:00:54
      181000 -- (-898.316) (-897.908) [-898.409] (-898.956) * (-900.097) (-899.800) (-901.460) [-897.769] -- 0:00:54
      181500 -- (-898.163) [-897.455] (-898.753) (-900.532) * (-899.263) (-899.933) (-900.424) [-899.390] -- 0:00:54
      182000 -- [-902.997] (-898.783) (-899.654) (-899.544) * (-899.848) (-898.399) (-899.692) [-897.886] -- 0:00:53
      182500 -- (-898.448) (-903.367) (-901.330) [-898.525] * (-899.424) [-899.615] (-899.331) (-898.316) -- 0:00:53
      183000 -- (-898.901) [-898.837] (-898.804) (-898.105) * (-898.804) [-902.402] (-900.943) (-900.667) -- 0:00:53
      183500 -- (-899.619) [-898.356] (-898.907) (-898.789) * (-899.253) (-898.637) [-899.338] (-904.963) -- 0:00:53
      184000 -- (-901.424) (-897.064) [-897.776] (-899.960) * [-900.265] (-899.283) (-899.441) (-901.105) -- 0:00:53
      184500 -- (-898.525) [-896.937] (-898.849) (-900.545) * [-899.191] (-898.664) (-897.389) (-898.704) -- 0:00:53
      185000 -- (-899.588) [-897.807] (-897.181) (-898.403) * [-899.809] (-900.963) (-901.317) (-899.693) -- 0:00:52

      Average standard deviation of split frequencies: 0.014139

      185500 -- [-901.270] (-898.358) (-897.269) (-901.416) * [-904.894] (-899.659) (-901.203) (-898.635) -- 0:00:52
      186000 -- [-898.603] (-900.390) (-897.123) (-899.733) * [-900.921] (-897.461) (-905.247) (-898.617) -- 0:00:52
      186500 -- (-899.150) (-900.225) (-897.364) [-899.098] * (-902.083) [-898.513] (-902.235) (-898.043) -- 0:00:52
      187000 -- (-898.663) (-900.390) [-896.929] (-903.463) * (-900.756) (-897.884) (-899.372) [-897.752] -- 0:00:52
      187500 -- [-897.282] (-899.537) (-899.194) (-900.106) * (-898.326) (-900.031) (-897.757) [-897.940] -- 0:00:52
      188000 -- [-899.718] (-899.566) (-898.516) (-907.421) * [-902.797] (-900.032) (-898.338) (-901.468) -- 0:00:51
      188500 -- (-897.208) [-899.354] (-898.063) (-909.260) * (-901.706) [-902.328] (-897.692) (-898.186) -- 0:00:55
      189000 -- (-898.499) (-899.786) [-898.417] (-903.285) * (-901.378) [-902.380] (-899.061) (-899.607) -- 0:00:55
      189500 -- (-897.371) (-899.458) [-897.648] (-897.214) * [-898.725] (-899.478) (-899.533) (-898.389) -- 0:00:55
      190000 -- (-904.115) (-898.971) [-900.068] (-898.457) * (-900.209) (-898.544) [-897.776] (-902.783) -- 0:00:55

      Average standard deviation of split frequencies: 0.012499

      190500 -- [-898.931] (-902.226) (-900.369) (-897.302) * (-899.245) [-898.375] (-900.608) (-900.173) -- 0:00:55
      191000 -- [-897.061] (-902.081) (-900.458) (-898.410) * [-900.281] (-900.729) (-898.729) (-899.631) -- 0:00:55
      191500 -- (-898.658) (-899.226) [-898.270] (-898.179) * (-900.235) (-898.234) (-898.985) [-902.856] -- 0:00:54
      192000 -- (-898.429) (-899.317) (-902.732) [-899.672] * (-898.760) [-899.301] (-898.420) (-898.652) -- 0:00:54
      192500 -- (-899.900) [-898.070] (-902.567) (-899.200) * (-903.079) (-898.745) [-899.387] (-898.201) -- 0:00:54
      193000 -- (-901.704) (-900.440) [-901.702] (-900.590) * [-898.673] (-899.197) (-898.673) (-898.264) -- 0:00:54
      193500 -- [-899.568] (-903.117) (-900.748) (-904.567) * (-898.116) [-900.194] (-901.063) (-898.056) -- 0:00:54
      194000 -- (-897.251) (-902.334) (-901.819) [-902.026] * (-901.107) (-900.079) [-897.972] (-900.677) -- 0:00:54
      194500 -- (-899.499) (-898.343) [-898.767] (-901.367) * (-899.023) [-898.391] (-899.728) (-899.706) -- 0:00:53
      195000 -- (-899.423) [-899.371] (-897.097) (-901.179) * (-899.005) [-898.200] (-903.832) (-902.831) -- 0:00:53

      Average standard deviation of split frequencies: 0.012450

      195500 -- (-899.318) (-900.981) (-897.899) [-898.509] * [-904.111] (-898.105) (-898.824) (-900.419) -- 0:00:53
      196000 -- (-899.611) [-901.200] (-900.608) (-902.124) * (-899.055) (-899.388) [-902.764] (-900.878) -- 0:00:53
      196500 -- [-899.330] (-897.904) (-897.603) (-898.961) * (-899.766) (-904.273) [-899.978] (-900.322) -- 0:00:53
      197000 -- (-901.352) [-898.087] (-901.807) (-899.295) * [-901.232] (-905.479) (-903.015) (-901.928) -- 0:00:52
      197500 -- (-899.552) [-901.160] (-901.375) (-898.794) * [-901.560] (-905.042) (-898.361) (-901.917) -- 0:00:52
      198000 -- (-898.980) (-898.572) (-902.228) [-899.574] * (-901.010) [-901.047] (-899.544) (-900.297) -- 0:00:52
      198500 -- [-898.945] (-898.180) (-903.024) (-898.169) * (-900.569) (-898.612) (-899.024) [-899.609] -- 0:00:52
      199000 -- (-902.826) (-898.087) [-898.386] (-900.640) * (-898.097) (-898.009) [-896.889] (-899.585) -- 0:00:52
      199500 -- (-903.481) [-898.649] (-901.284) (-898.839) * [-898.356] (-898.284) (-898.523) (-899.397) -- 0:00:52
      200000 -- (-901.831) (-901.005) [-899.321] (-900.628) * (-901.569) (-902.810) [-898.954] (-900.067) -- 0:00:51

      Average standard deviation of split frequencies: 0.012437

      200500 -- (-902.712) (-899.365) [-897.341] (-899.457) * (-902.080) [-897.358] (-898.337) (-899.002) -- 0:00:51
      201000 -- (-900.507) (-904.654) [-897.601] (-901.531) * (-901.747) (-898.798) [-899.889] (-899.550) -- 0:00:51
      201500 -- [-903.332] (-901.543) (-897.077) (-898.407) * [-898.480] (-899.604) (-899.776) (-898.538) -- 0:00:51
      202000 -- (-902.165) (-903.701) (-897.613) [-896.805] * (-902.008) [-899.800] (-899.525) (-898.917) -- 0:00:51
      202500 -- (-901.735) (-898.149) (-897.093) [-896.793] * [-903.604] (-898.852) (-897.250) (-901.892) -- 0:00:51
      203000 -- (-897.775) (-897.679) [-898.178] (-897.127) * [-897.941] (-898.126) (-899.877) (-899.961) -- 0:00:51
      203500 -- (-899.514) [-897.157] (-900.440) (-898.994) * [-899.491] (-901.243) (-900.220) (-899.961) -- 0:00:50
      204000 -- (-902.243) [-896.811] (-899.469) (-898.241) * (-900.100) (-899.686) (-901.446) [-900.199] -- 0:00:54
      204500 -- (-898.124) (-896.808) (-898.146) [-897.549] * (-897.858) (-897.577) (-901.571) [-897.723] -- 0:00:54
      205000 -- (-903.295) (-897.699) (-898.368) [-897.288] * (-899.719) (-900.002) [-897.777] (-898.421) -- 0:00:54

      Average standard deviation of split frequencies: 0.011980

      205500 -- (-902.744) (-899.286) [-898.415] (-899.176) * [-898.102] (-899.219) (-898.286) (-897.951) -- 0:00:54
      206000 -- (-898.431) [-899.394] (-898.227) (-897.894) * (-900.323) (-899.950) [-898.394] (-901.950) -- 0:00:53
      206500 -- [-897.916] (-899.676) (-897.734) (-899.965) * (-900.046) [-900.548] (-897.654) (-897.312) -- 0:00:53
      207000 -- (-898.318) [-899.374] (-898.891) (-899.164) * [-897.596] (-898.424) (-898.523) (-898.961) -- 0:00:53
      207500 -- [-901.040] (-903.710) (-900.886) (-898.507) * (-900.971) [-904.547] (-898.591) (-899.451) -- 0:00:53
      208000 -- (-899.856) [-897.793] (-903.107) (-899.561) * (-899.012) (-898.988) [-899.086] (-903.542) -- 0:00:53
      208500 -- (-901.158) (-897.392) (-902.746) [-902.306] * (-898.350) (-897.463) [-899.127] (-898.298) -- 0:00:53
      209000 -- (-901.900) (-898.121) (-900.320) [-899.824] * (-906.541) (-899.619) [-899.899] (-898.078) -- 0:00:52
      209500 -- (-903.118) (-897.763) (-897.906) [-898.196] * (-900.713) (-898.091) [-898.689] (-901.930) -- 0:00:52
      210000 -- [-898.197] (-897.103) (-899.444) (-901.401) * (-900.664) (-897.825) (-902.809) [-897.978] -- 0:00:52

      Average standard deviation of split frequencies: 0.011057

      210500 -- (-898.458) (-898.072) [-899.930] (-902.841) * [-899.423] (-897.199) (-901.621) (-899.220) -- 0:00:52
      211000 -- (-902.368) (-899.983) [-900.137] (-902.238) * (-904.070) (-898.447) [-899.726] (-899.995) -- 0:00:52
      211500 -- [-900.741] (-898.082) (-901.456) (-902.960) * (-899.946) [-898.455] (-901.221) (-896.881) -- 0:00:52
      212000 -- (-900.663) [-898.489] (-901.777) (-901.109) * (-899.275) (-897.922) [-902.536] (-898.215) -- 0:00:52
      212500 -- (-902.686) [-899.036] (-898.234) (-899.361) * (-899.812) (-897.264) [-897.384] (-898.684) -- 0:00:51
      213000 -- (-899.230) (-898.413) (-897.486) [-900.739] * (-902.190) (-899.199) [-898.045] (-897.616) -- 0:00:51
      213500 -- (-898.613) [-897.794] (-898.032) (-901.899) * (-903.803) (-898.198) [-898.425] (-897.199) -- 0:00:51
      214000 -- (-898.898) (-899.125) [-897.379] (-897.805) * (-902.076) [-899.944] (-898.266) (-899.620) -- 0:00:51
      214500 -- (-898.770) [-898.602] (-897.195) (-900.522) * [-899.657] (-900.757) (-899.966) (-899.241) -- 0:00:51
      215000 -- (-899.558) (-899.674) (-898.791) [-899.031] * (-899.507) [-902.287] (-900.673) (-899.276) -- 0:00:51

      Average standard deviation of split frequencies: 0.011882

      215500 -- [-899.297] (-898.345) (-897.228) (-899.121) * [-900.880] (-901.597) (-898.719) (-902.001) -- 0:00:50
      216000 -- (-902.617) (-902.278) [-898.147] (-903.384) * (-900.138) [-899.866] (-900.868) (-897.717) -- 0:00:50
      216500 -- (-905.370) (-901.985) [-897.922] (-899.674) * (-897.918) (-898.517) (-900.546) [-897.268] -- 0:00:50
      217000 -- (-899.863) [-900.679] (-898.000) (-901.450) * (-899.157) (-897.702) (-898.606) [-897.242] -- 0:00:50
      217500 -- [-899.071] (-898.946) (-898.261) (-901.803) * (-904.527) [-904.059] (-899.674) (-897.168) -- 0:00:50
      218000 -- (-898.051) [-900.820] (-902.370) (-897.390) * (-902.914) (-897.209) (-899.542) [-898.079] -- 0:00:50
      218500 -- (-899.623) (-901.020) [-899.402] (-896.897) * [-905.666] (-902.897) (-896.992) (-901.764) -- 0:00:50
      219000 -- (-897.205) [-897.974] (-899.596) (-898.108) * (-900.853) [-897.204] (-901.338) (-900.018) -- 0:00:49
      219500 -- (-896.983) (-898.256) [-900.033] (-907.148) * (-901.478) (-896.949) [-899.739] (-898.901) -- 0:00:53
      220000 -- (-897.047) (-898.542) [-900.261] (-897.644) * (-900.130) (-897.108) [-898.742] (-898.669) -- 0:00:53

      Average standard deviation of split frequencies: 0.011868

      220500 -- [-897.391] (-899.776) (-899.373) (-897.799) * [-898.548] (-898.386) (-897.647) (-899.504) -- 0:00:53
      221000 -- [-898.195] (-899.168) (-901.756) (-900.320) * (-897.884) [-897.752] (-899.421) (-897.898) -- 0:00:52
      221500 -- (-897.403) (-900.216) (-898.476) [-900.018] * [-900.145] (-898.145) (-899.393) (-903.446) -- 0:00:52
      222000 -- [-897.292] (-897.641) (-902.810) (-899.160) * (-899.753) [-897.352] (-899.218) (-898.950) -- 0:00:52
      222500 -- [-900.911] (-897.570) (-903.539) (-899.536) * (-899.599) (-898.548) [-898.764] (-898.871) -- 0:00:52
      223000 -- (-905.633) (-898.806) [-898.293] (-897.546) * (-899.405) (-900.589) [-898.104] (-900.695) -- 0:00:52
      223500 -- (-899.005) [-900.544] (-898.044) (-904.349) * [-899.558] (-898.810) (-898.483) (-899.285) -- 0:00:52
      224000 -- (-900.707) (-898.637) (-897.574) [-901.468] * (-899.515) (-899.438) [-897.151] (-900.242) -- 0:00:51
      224500 -- (-898.965) (-899.023) (-899.333) [-901.530] * (-898.532) [-899.059] (-904.049) (-897.541) -- 0:00:51
      225000 -- (-900.151) (-901.194) (-900.530) [-901.939] * (-898.602) [-899.622] (-902.356) (-899.613) -- 0:00:51

      Average standard deviation of split frequencies: 0.011820

      225500 -- (-897.764) [-899.745] (-901.516) (-902.332) * (-899.853) (-899.503) (-904.727) [-899.312] -- 0:00:51
      226000 -- [-900.165] (-900.741) (-901.448) (-899.972) * (-898.532) (-898.269) [-902.320] (-898.474) -- 0:00:51
      226500 -- (-899.526) (-909.522) (-898.305) [-898.503] * (-900.918) [-898.297] (-898.134) (-897.940) -- 0:00:51
      227000 -- [-897.887] (-900.321) (-898.410) (-903.769) * (-900.825) (-897.747) (-899.975) [-897.704] -- 0:00:51
      227500 -- (-900.041) (-899.763) (-898.243) [-897.797] * (-899.593) [-900.319] (-900.659) (-899.112) -- 0:00:50
      228000 -- (-896.886) (-898.730) (-898.363) [-897.226] * (-898.581) (-900.740) (-897.462) [-897.946] -- 0:00:50
      228500 -- (-897.986) (-897.886) [-900.452] (-897.565) * (-899.305) [-898.610] (-897.501) (-899.169) -- 0:00:50
      229000 -- [-899.188] (-898.333) (-906.146) (-898.587) * (-901.978) (-897.891) [-897.901] (-899.244) -- 0:00:50
      229500 -- (-899.926) (-897.978) (-898.023) [-899.695] * (-898.283) (-900.071) (-896.950) [-900.657] -- 0:00:50
      230000 -- (-905.767) [-897.751] (-899.660) (-899.565) * (-901.565) (-901.750) (-899.386) [-898.951] -- 0:00:50

      Average standard deviation of split frequencies: 0.010579

      230500 -- [-902.935] (-897.831) (-901.825) (-900.010) * (-901.139) [-898.627] (-898.089) (-897.976) -- 0:00:50
      231000 -- (-898.539) (-897.669) (-897.953) [-899.934] * (-899.200) (-899.002) [-899.352] (-897.705) -- 0:00:49
      231500 -- [-898.312] (-899.498) (-897.927) (-903.202) * [-899.093] (-899.247) (-899.170) (-897.663) -- 0:00:49
      232000 -- [-898.184] (-899.088) (-897.852) (-899.685) * (-902.105) (-899.164) [-897.996] (-898.775) -- 0:00:49
      232500 -- [-898.914] (-902.517) (-900.178) (-901.441) * (-899.676) (-899.739) [-898.199] (-897.613) -- 0:00:49
      233000 -- (-898.070) (-902.075) (-900.312) [-897.558] * (-902.719) (-897.929) [-897.640] (-896.935) -- 0:00:49
      233500 -- (-898.418) (-903.313) (-897.455) [-897.807] * (-897.498) (-900.734) (-898.190) [-897.848] -- 0:00:49
      234000 -- (-898.571) (-898.080) (-897.497) [-900.125] * [-902.150] (-902.564) (-900.768) (-897.494) -- 0:00:49
      234500 -- (-898.599) (-901.099) [-897.606] (-900.381) * (-898.152) (-899.200) [-899.087] (-901.489) -- 0:00:52
      235000 -- (-900.188) [-900.688] (-898.162) (-900.865) * (-900.570) (-898.470) [-898.735] (-899.123) -- 0:00:52

      Average standard deviation of split frequencies: 0.010340

      235500 -- (-901.306) [-901.502] (-900.903) (-899.620) * [-899.623] (-900.464) (-898.045) (-901.577) -- 0:00:51
      236000 -- (-900.387) (-899.438) [-900.575] (-897.666) * [-898.854] (-898.972) (-898.579) (-899.189) -- 0:00:51
      236500 -- (-897.340) (-900.964) (-898.377) [-899.561] * (-903.247) (-898.716) [-897.991] (-897.894) -- 0:00:51
      237000 -- (-897.570) (-900.220) [-899.711] (-903.721) * (-899.751) [-898.172] (-899.191) (-897.965) -- 0:00:51
      237500 -- (-898.989) [-897.920] (-898.053) (-899.361) * (-904.486) (-898.749) [-897.962] (-899.621) -- 0:00:51
      238000 -- (-901.533) (-898.437) [-898.973] (-903.038) * (-900.119) (-901.151) [-897.659] (-900.650) -- 0:00:51
      238500 -- (-901.316) [-901.953] (-901.555) (-900.290) * [-897.986] (-901.649) (-897.965) (-901.181) -- 0:00:51
      239000 -- (-899.033) (-897.300) (-899.774) [-897.184] * (-899.142) [-901.486] (-905.557) (-902.320) -- 0:00:50
      239500 -- [-897.829] (-904.996) (-899.873) (-897.361) * [-898.427] (-897.887) (-900.011) (-897.930) -- 0:00:50
      240000 -- [-899.413] (-904.153) (-900.528) (-905.346) * (-901.273) [-899.148] (-899.191) (-906.890) -- 0:00:50

      Average standard deviation of split frequencies: 0.011752

      240500 -- (-898.880) (-899.802) [-899.804] (-901.689) * (-899.713) [-899.427] (-899.605) (-903.290) -- 0:00:50
      241000 -- (-905.021) (-901.158) [-899.289] (-897.777) * (-899.289) [-898.769] (-898.811) (-901.283) -- 0:00:50
      241500 -- [-901.086] (-899.691) (-900.847) (-901.718) * [-899.562] (-902.119) (-900.389) (-897.008) -- 0:00:50
      242000 -- (-900.933) (-898.413) (-902.590) [-898.887] * (-898.734) (-902.864) [-897.158] (-897.225) -- 0:00:50
      242500 -- (-900.522) (-898.095) [-900.377] (-897.564) * (-899.188) (-901.420) (-899.439) [-898.297] -- 0:00:49
      243000 -- (-897.617) (-898.461) (-899.100) [-896.969] * (-899.405) [-901.634] (-900.008) (-897.617) -- 0:00:49
      243500 -- (-897.608) [-901.051] (-901.403) (-898.714) * (-897.541) [-898.285] (-900.467) (-897.120) -- 0:00:49
      244000 -- (-898.686) [-900.585] (-900.684) (-900.817) * [-897.170] (-898.733) (-898.405) (-897.065) -- 0:00:49
      244500 -- (-898.684) (-900.646) [-904.852] (-898.536) * [-898.306] (-898.728) (-899.187) (-900.603) -- 0:00:49
      245000 -- (-897.751) (-900.897) [-897.769] (-901.029) * [-897.417] (-897.915) (-900.416) (-904.440) -- 0:00:49

      Average standard deviation of split frequencies: 0.011617

      245500 -- (-898.553) (-898.847) (-901.375) [-898.738] * (-897.759) [-898.162] (-900.356) (-898.873) -- 0:00:49
      246000 -- (-898.968) [-897.502] (-900.195) (-901.540) * (-899.149) [-900.316] (-900.757) (-899.765) -- 0:00:49
      246500 -- (-901.531) (-901.855) [-904.450] (-900.757) * (-899.433) (-900.774) [-900.405] (-901.955) -- 0:00:48
      247000 -- [-900.794] (-902.242) (-898.671) (-900.877) * (-898.011) (-900.271) [-897.335] (-898.627) -- 0:00:48
      247500 -- (-901.661) (-897.547) [-898.352] (-900.753) * (-902.407) (-902.608) [-898.338] (-900.349) -- 0:00:48
      248000 -- (-901.919) [-898.747] (-898.379) (-898.158) * (-901.370) [-900.680] (-899.089) (-899.996) -- 0:00:48
      248500 -- [-899.679] (-898.292) (-897.960) (-898.158) * (-900.374) (-902.171) [-897.588] (-901.093) -- 0:00:48
      249000 -- (-897.923) [-897.706] (-897.515) (-898.096) * (-899.369) [-899.374] (-901.195) (-897.891) -- 0:00:48
      249500 -- (-896.951) [-898.112] (-897.601) (-898.446) * [-897.653] (-897.190) (-899.413) (-899.369) -- 0:00:48
      250000 -- (-898.780) (-898.240) (-897.987) [-899.269] * (-899.592) (-898.814) (-899.606) [-898.296] -- 0:00:51

      Average standard deviation of split frequencies: 0.012106

      250500 -- [-897.875] (-898.499) (-897.877) (-898.586) * (-901.150) [-898.077] (-901.476) (-899.335) -- 0:00:50
      251000 -- (-897.565) (-898.540) [-898.287] (-898.709) * (-901.159) (-898.583) [-898.165] (-904.048) -- 0:00:50
      251500 -- (-900.946) (-900.777) [-897.738] (-898.333) * (-900.294) (-899.496) [-898.132] (-899.200) -- 0:00:50
      252000 -- (-898.996) (-901.180) [-898.415] (-902.271) * [-897.501] (-901.528) (-901.003) (-899.904) -- 0:00:50
      252500 -- (-898.001) (-898.701) (-899.951) [-899.798] * [-901.620] (-901.671) (-897.479) (-900.402) -- 0:00:50
      253000 -- (-903.635) (-902.203) (-898.346) [-897.670] * [-898.023] (-899.301) (-897.983) (-900.961) -- 0:00:50
      253500 -- [-898.359] (-899.740) (-899.132) (-903.030) * (-897.824) (-902.190) [-897.737] (-902.744) -- 0:00:50
      254000 -- (-900.605) (-899.949) (-900.811) [-902.823] * (-897.824) [-899.150] (-899.615) (-900.493) -- 0:00:49
      254500 -- (-898.982) (-898.709) (-903.162) [-900.248] * (-898.675) (-901.235) [-897.499] (-897.876) -- 0:00:49
      255000 -- (-898.467) [-901.039] (-899.831) (-901.524) * (-897.263) [-898.539] (-901.576) (-898.223) -- 0:00:49

      Average standard deviation of split frequencies: 0.013465

      255500 -- (-899.452) [-897.384] (-898.359) (-900.598) * (-899.609) [-897.621] (-897.398) (-898.273) -- 0:00:49
      256000 -- [-900.749] (-903.596) (-897.950) (-902.117) * (-900.050) [-898.918] (-897.750) (-901.661) -- 0:00:49
      256500 -- (-899.047) (-903.801) [-898.132] (-900.625) * (-899.522) (-897.356) (-901.180) [-898.416] -- 0:00:49
      257000 -- (-898.028) (-899.172) (-898.454) [-900.505] * [-897.917] (-897.909) (-897.830) (-898.346) -- 0:00:49
      257500 -- [-899.542] (-898.664) (-898.748) (-900.014) * (-902.168) [-897.279] (-901.108) (-898.359) -- 0:00:49
      258000 -- (-902.220) [-900.347] (-899.880) (-898.706) * (-901.893) [-897.606] (-897.631) (-898.876) -- 0:00:48
      258500 -- (-903.581) (-898.186) [-898.301] (-898.624) * [-899.287] (-897.605) (-899.580) (-899.436) -- 0:00:48
      259000 -- [-900.859] (-900.718) (-901.179) (-905.725) * (-897.984) (-901.302) [-899.231] (-897.970) -- 0:00:48
      259500 -- (-903.099) (-901.380) (-899.440) [-900.181] * (-899.101) (-903.669) [-897.994] (-901.975) -- 0:00:48
      260000 -- (-900.821) (-898.827) [-900.603] (-897.873) * (-901.363) (-901.320) [-899.836] (-898.339) -- 0:00:48

      Average standard deviation of split frequencies: 0.014242

      260500 -- [-899.068] (-900.043) (-899.806) (-901.583) * (-899.198) (-902.581) (-898.900) [-897.928] -- 0:00:48
      261000 -- (-900.727) [-899.419] (-898.704) (-899.543) * (-900.777) [-903.787] (-900.371) (-900.589) -- 0:00:48
      261500 -- (-898.134) [-898.009] (-898.346) (-898.982) * (-900.059) [-897.675] (-901.003) (-898.172) -- 0:00:48
      262000 -- [-898.872] (-897.241) (-898.542) (-898.752) * (-897.585) (-898.775) (-898.731) [-897.737] -- 0:00:47
      262500 -- (-899.835) (-900.276) [-899.040] (-900.665) * (-897.228) [-898.556] (-899.773) (-899.243) -- 0:00:47
      263000 -- [-897.980] (-898.142) (-900.998) (-897.947) * (-897.701) (-900.745) (-900.542) [-902.292] -- 0:00:47
      263500 -- (-900.207) (-898.269) [-901.030] (-901.519) * (-903.164) (-900.286) (-900.259) [-901.444] -- 0:00:47
      264000 -- (-897.976) (-897.157) (-901.143) [-898.006] * (-904.767) [-900.491] (-900.546) (-900.002) -- 0:00:47
      264500 -- (-902.934) (-898.700) [-898.071] (-900.765) * [-899.901] (-897.534) (-899.840) (-900.348) -- 0:00:47
      265000 -- (-903.475) [-897.952] (-897.861) (-900.931) * [-897.627] (-898.811) (-899.257) (-900.902) -- 0:00:47

      Average standard deviation of split frequencies: 0.013735

      265500 -- (-902.497) [-900.976] (-899.088) (-904.857) * (-900.367) (-901.197) [-898.864] (-900.277) -- 0:00:49
      266000 -- (-898.800) [-897.507] (-900.575) (-899.876) * (-903.807) (-901.177) [-900.085] (-902.739) -- 0:00:49
      266500 -- [-901.921] (-898.472) (-899.460) (-900.267) * [-902.156] (-902.513) (-904.877) (-899.997) -- 0:00:49
      267000 -- (-898.235) [-898.746] (-900.318) (-899.620) * (-904.077) [-899.089] (-901.554) (-899.930) -- 0:00:49
      267500 -- [-898.692] (-897.247) (-902.495) (-897.671) * (-902.644) [-900.098] (-897.936) (-898.272) -- 0:00:49
      268000 -- (-897.743) (-898.567) [-899.290] (-897.628) * (-905.926) [-900.420] (-898.210) (-897.880) -- 0:00:49
      268500 -- (-898.507) (-898.001) [-898.691] (-897.956) * (-901.537) (-899.676) [-899.552] (-898.133) -- 0:00:49
      269000 -- (-897.388) (-900.066) [-899.305] (-898.220) * (-901.946) (-898.894) [-897.923] (-899.422) -- 0:00:48
      269500 -- (-899.456) (-899.585) (-899.127) [-898.323] * (-902.657) (-900.197) (-900.521) [-899.006] -- 0:00:48
      270000 -- (-899.625) [-897.811] (-899.827) (-897.704) * (-898.907) (-898.697) [-898.825] (-898.855) -- 0:00:48

      Average standard deviation of split frequencies: 0.013607

      270500 -- (-899.071) [-897.796] (-903.485) (-900.526) * (-897.768) [-898.621] (-898.228) (-898.647) -- 0:00:48
      271000 -- (-901.985) [-899.147] (-898.299) (-898.624) * (-901.618) [-898.131] (-904.328) (-897.489) -- 0:00:48
      271500 -- (-899.515) (-900.051) (-900.689) [-899.195] * (-902.352) [-897.132] (-899.422) (-898.573) -- 0:00:48
      272000 -- (-899.517) [-898.286] (-900.281) (-908.106) * [-897.931] (-897.485) (-900.335) (-897.748) -- 0:00:48
      272500 -- [-898.478] (-897.964) (-898.993) (-902.352) * (-899.064) [-898.200] (-900.217) (-900.051) -- 0:00:48
      273000 -- (-902.150) (-899.653) (-897.723) [-897.630] * (-900.679) [-896.854] (-899.900) (-899.025) -- 0:00:47
      273500 -- (-898.664) (-897.403) (-898.625) [-898.489] * (-897.935) (-899.269) (-900.369) [-898.357] -- 0:00:47
      274000 -- (-898.210) [-899.807] (-899.551) (-897.767) * (-898.138) [-899.779] (-899.803) (-898.530) -- 0:00:47
      274500 -- (-897.316) (-899.528) [-898.541] (-901.616) * [-899.529] (-899.115) (-900.393) (-898.761) -- 0:00:47
      275000 -- (-897.060) (-901.443) [-899.007] (-901.481) * [-897.361] (-901.727) (-897.933) (-898.197) -- 0:00:47

      Average standard deviation of split frequencies: 0.014091

      275500 -- (-898.253) [-900.941] (-899.115) (-903.864) * (-899.000) [-899.933] (-899.635) (-899.236) -- 0:00:47
      276000 -- (-897.646) (-900.379) [-897.232] (-904.201) * (-899.804) [-898.989] (-898.611) (-900.076) -- 0:00:47
      276500 -- (-899.183) (-904.090) (-898.006) [-899.305] * (-900.557) [-902.987] (-897.275) (-899.124) -- 0:00:47
      277000 -- (-898.996) [-906.438] (-899.675) (-900.577) * (-899.774) (-902.938) [-900.112] (-898.777) -- 0:00:46
      277500 -- (-898.481) (-902.396) (-900.625) [-899.541] * (-902.156) (-897.161) [-898.369] (-903.179) -- 0:00:46
      278000 -- (-898.798) (-901.568) (-897.510) [-902.632] * (-899.425) (-899.299) (-898.343) [-900.723] -- 0:00:46
      278500 -- (-897.413) (-902.474) (-899.315) [-897.869] * (-902.566) [-900.410] (-898.411) (-899.499) -- 0:00:46
      279000 -- [-897.930] (-900.144) (-898.924) (-898.106) * (-902.131) (-900.577) (-899.590) [-897.563] -- 0:00:46
      279500 -- (-897.716) [-897.899] (-897.908) (-898.707) * [-900.136] (-901.027) (-899.902) (-902.290) -- 0:00:46
      280000 -- (-897.490) [-900.104] (-897.748) (-900.817) * (-898.125) [-898.319] (-898.909) (-899.868) -- 0:00:46

      Average standard deviation of split frequencies: 0.013647

      280500 -- (-899.146) [-899.969] (-897.745) (-900.681) * (-899.138) [-899.887] (-899.046) (-898.206) -- 0:00:46
      281000 -- (-899.254) (-900.313) (-899.754) [-897.959] * (-900.457) (-897.436) [-898.739] (-905.978) -- 0:00:48
      281500 -- (-902.507) [-899.101] (-897.522) (-900.734) * (-901.536) (-897.506) (-897.715) [-898.680] -- 0:00:48
      282000 -- [-897.828] (-897.855) (-898.946) (-898.683) * (-898.284) (-899.556) [-897.063] (-899.750) -- 0:00:48
      282500 -- [-899.673] (-897.255) (-897.618) (-898.961) * [-897.199] (-899.615) (-897.185) (-900.659) -- 0:00:48
      283000 -- (-899.575) (-899.937) [-897.931] (-898.999) * (-899.929) (-898.146) (-897.782) [-900.049] -- 0:00:48
      283500 -- (-897.706) (-900.286) [-897.964] (-901.065) * (-898.735) (-899.720) [-897.180] (-902.928) -- 0:00:48
      284000 -- (-897.660) (-901.634) (-899.287) [-898.060] * (-900.409) (-897.914) [-897.467] (-900.934) -- 0:00:47
      284500 -- (-899.927) [-899.110] (-898.124) (-897.479) * (-897.125) (-897.742) [-897.644] (-898.857) -- 0:00:47
      285000 -- [-902.757] (-898.612) (-900.065) (-897.102) * (-897.897) (-897.645) [-897.634] (-898.967) -- 0:00:47

      Average standard deviation of split frequencies: 0.014216

      285500 -- (-901.939) (-903.326) [-900.500] (-897.140) * (-899.175) [-897.892] (-903.269) (-898.058) -- 0:00:47
      286000 -- [-898.324] (-901.934) (-898.717) (-897.990) * (-900.413) (-897.384) (-901.131) [-900.240] -- 0:00:47
      286500 -- (-898.952) (-904.825) [-898.620] (-899.006) * (-903.841) (-898.515) [-898.303] (-901.322) -- 0:00:47
      287000 -- (-900.237) (-903.476) [-898.225] (-898.693) * (-900.199) [-900.514] (-903.474) (-900.331) -- 0:00:47
      287500 -- (-903.811) (-903.165) [-898.624] (-901.724) * (-897.821) (-898.625) (-901.980) [-899.503] -- 0:00:47
      288000 -- (-899.185) (-898.608) (-900.568) [-900.139] * [-899.068] (-898.746) (-904.504) (-899.263) -- 0:00:46
      288500 -- [-902.129] (-901.872) (-898.060) (-898.315) * (-897.672) [-900.625] (-899.007) (-898.265) -- 0:00:46
      289000 -- [-897.930] (-902.046) (-900.325) (-897.618) * (-899.497) (-897.702) [-897.680] (-899.787) -- 0:00:46
      289500 -- (-897.796) (-899.118) [-899.943] (-897.492) * (-897.903) [-899.000] (-901.672) (-897.307) -- 0:00:46
      290000 -- (-898.770) [-898.233] (-902.055) (-898.071) * (-901.665) (-901.563) [-899.560] (-898.608) -- 0:00:46

      Average standard deviation of split frequencies: 0.014495

      290500 -- (-898.829) (-897.007) [-900.538] (-901.090) * (-898.109) [-902.076] (-898.897) (-898.649) -- 0:00:46
      291000 -- (-898.603) [-896.932] (-900.766) (-901.612) * (-898.426) (-899.689) [-897.861] (-898.656) -- 0:00:46
      291500 -- (-901.025) [-900.563] (-903.778) (-899.624) * (-902.898) (-900.495) [-898.593] (-898.545) -- 0:00:46
      292000 -- (-898.573) [-897.882] (-898.076) (-903.567) * [-900.988] (-901.137) (-898.521) (-904.017) -- 0:00:46
      292500 -- (-899.762) [-897.989] (-897.810) (-899.568) * (-899.823) [-900.104] (-899.121) (-898.592) -- 0:00:45
      293000 -- (-899.870) (-899.746) (-900.666) [-901.008] * (-899.235) (-898.803) (-899.604) [-898.092] -- 0:00:45
      293500 -- [-899.519] (-897.294) (-900.523) (-897.266) * (-901.403) (-898.407) (-900.131) [-898.527] -- 0:00:45
      294000 -- (-897.181) (-897.904) (-899.566) [-897.818] * (-902.432) (-897.054) (-899.729) [-897.047] -- 0:00:45
      294500 -- (-901.067) (-898.634) (-898.949) [-897.302] * (-902.194) (-898.099) [-899.293] (-899.334) -- 0:00:45
      295000 -- (-900.435) (-901.718) (-900.784) [-898.217] * (-898.510) (-900.776) (-909.249) [-898.089] -- 0:00:45

      Average standard deviation of split frequencies: 0.013736

      295500 -- [-903.158] (-900.940) (-900.538) (-898.577) * (-899.236) (-899.092) (-906.938) [-898.298] -- 0:00:45
      296000 -- (-898.080) [-897.880] (-899.987) (-897.663) * (-899.800) (-898.772) [-902.068] (-898.450) -- 0:00:47
      296500 -- (-898.002) (-898.330) [-897.920] (-910.499) * [-900.785] (-898.954) (-908.198) (-900.139) -- 0:00:47
      297000 -- (-900.239) (-897.523) [-898.326] (-907.250) * (-900.240) (-899.869) [-905.513] (-901.431) -- 0:00:47
      297500 -- (-898.305) (-899.111) [-900.686] (-913.204) * (-899.679) [-899.864] (-901.078) (-901.557) -- 0:00:47
      298000 -- [-898.499] (-899.069) (-899.346) (-907.363) * (-901.031) [-899.899] (-899.359) (-898.008) -- 0:00:47
      298500 -- (-898.605) (-899.814) [-901.619] (-904.084) * (-899.475) (-898.103) [-900.444] (-907.285) -- 0:00:47
      299000 -- (-902.494) (-900.621) [-900.002] (-898.015) * (-900.796) (-898.724) [-898.174] (-899.258) -- 0:00:46
      299500 -- (-899.984) [-901.192] (-898.499) (-897.993) * (-898.652) (-897.536) (-897.623) [-900.381] -- 0:00:46
      300000 -- [-901.641] (-899.404) (-897.210) (-904.152) * [-898.636] (-899.336) (-899.047) (-898.807) -- 0:00:46

      Average standard deviation of split frequencies: 0.012641

      300500 -- (-899.716) (-898.267) (-899.217) [-897.526] * [-899.691] (-898.202) (-905.201) (-902.837) -- 0:00:46
      301000 -- (-900.367) (-898.907) (-901.852) [-897.376] * [-897.188] (-898.837) (-899.488) (-898.492) -- 0:00:46
      301500 -- (-898.901) (-898.515) [-897.586] (-902.509) * (-898.087) [-897.655] (-897.984) (-899.826) -- 0:00:46
      302000 -- [-897.624] (-899.330) (-897.869) (-899.625) * (-900.473) [-897.651] (-899.936) (-898.688) -- 0:00:46
      302500 -- [-898.032] (-899.050) (-901.078) (-897.963) * (-901.699) (-900.002) [-898.153] (-897.492) -- 0:00:46
      303000 -- (-902.607) (-907.114) (-898.659) [-899.068] * (-900.281) [-900.938] (-898.994) (-898.269) -- 0:00:46
      303500 -- [-899.629] (-906.249) (-898.384) (-899.788) * [-898.358] (-901.282) (-899.318) (-898.149) -- 0:00:45
      304000 -- (-901.567) [-898.679] (-897.248) (-898.652) * [-897.656] (-901.582) (-898.905) (-899.478) -- 0:00:45
      304500 -- (-899.467) (-897.984) (-899.022) [-898.541] * (-899.535) (-900.362) [-898.031] (-898.915) -- 0:00:45
      305000 -- (-901.860) (-897.633) (-903.771) [-901.866] * (-900.920) (-897.386) [-900.389] (-897.898) -- 0:00:45

      Average standard deviation of split frequencies: 0.012959

      305500 -- [-899.412] (-898.360) (-898.698) (-899.967) * [-897.845] (-897.181) (-897.535) (-898.914) -- 0:00:45
      306000 -- (-897.915) (-899.538) [-899.699] (-900.275) * (-899.774) (-897.513) (-901.187) [-898.771] -- 0:00:45
      306500 -- (-899.589) (-900.157) (-900.753) [-901.837] * (-899.403) [-899.144] (-902.482) (-904.012) -- 0:00:45
      307000 -- [-901.438] (-899.588) (-902.755) (-902.254) * [-897.674] (-900.809) (-901.654) (-901.986) -- 0:00:45
      307500 -- [-901.596] (-897.778) (-898.743) (-902.997) * (-898.073) (-897.577) (-901.523) [-898.991] -- 0:00:45
      308000 -- (-900.418) [-897.867] (-898.606) (-901.801) * (-903.153) [-897.981] (-900.968) (-899.855) -- 0:00:44
      308500 -- (-897.949) [-897.802] (-899.544) (-899.220) * (-903.818) [-899.352] (-899.180) (-896.882) -- 0:00:44
      309000 -- (-898.818) (-899.712) (-900.422) [-898.056] * (-898.103) (-899.329) [-898.566] (-898.870) -- 0:00:44
      309500 -- (-897.203) (-898.444) [-899.411] (-900.294) * (-901.635) (-898.283) [-900.103] (-900.906) -- 0:00:44
      310000 -- (-897.392) (-899.102) [-902.534] (-900.502) * [-902.128] (-898.595) (-899.971) (-903.873) -- 0:00:44

      Average standard deviation of split frequencies: 0.010811

      310500 -- (-900.557) [-899.619] (-902.476) (-898.985) * (-899.589) (-899.844) [-899.329] (-902.885) -- 0:00:44
      311000 -- [-900.058] (-898.649) (-898.584) (-901.266) * (-899.515) [-898.767] (-898.243) (-902.207) -- 0:00:46
      311500 -- (-900.106) [-901.546] (-902.056) (-899.482) * (-896.888) [-903.143] (-898.529) (-908.739) -- 0:00:46
      312000 -- (-897.537) (-902.729) [-901.936] (-899.826) * (-898.219) (-901.539) (-899.902) [-898.657] -- 0:00:46
      312500 -- [-898.200] (-902.219) (-897.080) (-901.713) * (-898.785) [-899.397] (-898.931) (-899.879) -- 0:00:46
      313000 -- [-900.554] (-902.781) (-897.752) (-903.879) * (-899.678) [-898.907] (-898.381) (-904.481) -- 0:00:46
      313500 -- (-901.032) (-900.813) (-903.145) [-904.167] * [-898.459] (-899.047) (-898.679) (-898.036) -- 0:00:45
      314000 -- (-900.817) (-899.535) (-898.612) [-900.950] * (-899.347) (-900.861) [-897.471] (-898.260) -- 0:00:45
      314500 -- (-898.445) (-899.778) [-898.707] (-897.631) * (-899.315) [-900.508] (-900.535) (-898.045) -- 0:00:45
      315000 -- (-899.521) [-898.919] (-902.339) (-898.768) * (-898.251) (-900.291) (-899.551) [-899.326] -- 0:00:45

      Average standard deviation of split frequencies: 0.011841

      315500 -- [-898.403] (-897.552) (-898.391) (-901.637) * (-897.163) (-901.558) [-898.920] (-900.647) -- 0:00:45
      316000 -- (-897.309) [-899.926] (-899.332) (-903.179) * [-899.551] (-898.942) (-905.121) (-898.101) -- 0:00:45
      316500 -- [-897.566] (-899.881) (-898.539) (-897.397) * [-900.984] (-899.228) (-906.507) (-899.379) -- 0:00:45
      317000 -- (-897.860) [-900.094] (-898.698) (-897.261) * (-900.289) [-899.085] (-901.724) (-896.928) -- 0:00:45
      317500 -- [-898.865] (-900.140) (-899.539) (-897.754) * (-899.750) [-902.170] (-898.042) (-898.307) -- 0:00:45
      318000 -- [-898.866] (-897.517) (-899.834) (-897.735) * (-897.188) [-900.588] (-898.437) (-897.096) -- 0:00:45
      318500 -- (-898.621) [-898.661] (-900.879) (-898.712) * [-898.473] (-898.841) (-897.953) (-904.746) -- 0:00:44
      319000 -- (-898.616) (-897.771) [-897.491] (-898.543) * (-904.655) (-901.723) [-897.800] (-898.830) -- 0:00:44
      319500 -- (-898.447) (-898.501) [-900.586] (-900.757) * (-899.827) (-900.880) [-897.561] (-899.056) -- 0:00:44
      320000 -- (-897.688) (-897.468) [-898.547] (-898.959) * (-899.985) [-897.760] (-899.201) (-898.130) -- 0:00:44

      Average standard deviation of split frequencies: 0.012220

      320500 -- (-897.938) (-898.786) (-897.289) [-901.161] * (-903.250) (-897.616) [-901.051] (-897.792) -- 0:00:44
      321000 -- (-897.345) (-897.124) [-900.304] (-899.951) * (-900.413) [-899.337] (-900.381) (-898.538) -- 0:00:44
      321500 -- (-898.966) [-897.409] (-900.089) (-898.259) * (-905.663) [-900.107] (-901.011) (-901.341) -- 0:00:44
      322000 -- (-896.901) (-897.537) (-898.127) [-901.262] * (-899.397) (-898.916) (-901.331) [-899.027] -- 0:00:44
      322500 -- [-897.117] (-898.226) (-902.306) (-904.894) * (-898.078) (-899.098) (-902.556) [-901.781] -- 0:00:44
      323000 -- (-897.375) [-898.575] (-897.301) (-899.761) * (-899.184) (-898.677) [-899.453] (-901.046) -- 0:00:44
      323500 -- [-897.921] (-898.887) (-897.301) (-897.991) * (-898.690) (-898.368) (-898.387) [-898.806] -- 0:00:43
      324000 -- [-898.957] (-899.372) (-898.136) (-897.625) * (-900.112) (-897.843) (-903.511) [-897.430] -- 0:00:43
      324500 -- (-900.991) (-900.730) (-897.965) [-897.391] * (-901.493) [-897.936] (-900.187) (-905.022) -- 0:00:43
      325000 -- (-901.032) (-903.402) [-899.047] (-899.137) * (-898.352) (-897.149) (-897.602) [-904.012] -- 0:00:43

      Average standard deviation of split frequencies: 0.012653

      325500 -- (-897.883) (-898.187) (-900.214) [-897.899] * [-899.180] (-898.109) (-902.658) (-897.342) -- 0:00:43
      326000 -- (-897.509) (-898.488) (-900.422) [-903.092] * (-901.535) (-900.395) (-898.657) [-899.002] -- 0:00:43
      326500 -- [-898.448] (-900.270) (-899.438) (-899.001) * (-899.487) (-904.288) (-897.225) [-898.439] -- 0:00:45
      327000 -- (-900.273) [-899.544] (-900.069) (-899.081) * (-900.950) (-900.506) (-900.700) [-897.999] -- 0:00:45
      327500 -- (-900.067) (-897.662) (-900.339) [-898.171] * [-899.636] (-898.248) (-898.789) (-900.443) -- 0:00:45
      328000 -- (-898.873) [-898.913] (-899.079) (-900.635) * (-897.541) (-897.524) (-899.885) [-902.558] -- 0:00:45
      328500 -- (-897.307) [-897.986] (-899.837) (-902.161) * (-897.755) (-901.417) (-900.664) [-899.985] -- 0:00:44
      329000 -- [-897.308] (-897.908) (-900.107) (-899.241) * (-898.347) (-899.522) (-902.614) [-898.906] -- 0:00:44
      329500 -- (-897.906) [-899.548] (-899.148) (-899.618) * [-899.129] (-898.817) (-899.168) (-901.516) -- 0:00:44
      330000 -- (-897.969) (-900.857) [-898.324] (-904.907) * (-899.479) (-899.897) (-899.962) [-899.201] -- 0:00:44

      Average standard deviation of split frequencies: 0.013276

      330500 -- (-902.252) (-904.076) [-897.841] (-898.591) * (-899.784) [-897.040] (-901.019) (-901.236) -- 0:00:44
      331000 -- (-900.028) (-900.099) (-899.836) [-897.659] * (-901.194) [-897.339] (-903.349) (-898.893) -- 0:00:44
      331500 -- [-899.500] (-898.428) (-898.528) (-901.709) * (-898.476) [-897.493] (-898.326) (-901.288) -- 0:00:44
      332000 -- (-900.770) (-898.382) [-899.057] (-899.984) * [-898.591] (-897.604) (-897.669) (-898.503) -- 0:00:44
      332500 -- (-900.277) (-901.935) [-897.990] (-900.061) * [-899.046] (-902.531) (-899.526) (-898.944) -- 0:00:44
      333000 -- (-899.249) (-897.681) [-898.862] (-904.510) * (-901.233) [-898.527] (-901.581) (-899.744) -- 0:00:44
      333500 -- [-897.774] (-899.960) (-898.945) (-901.530) * (-899.376) (-908.785) [-899.271] (-901.660) -- 0:00:43
      334000 -- [-900.808] (-902.308) (-897.470) (-905.378) * (-897.800) (-898.797) [-898.862] (-898.306) -- 0:00:43
      334500 -- [-898.556] (-899.713) (-897.457) (-901.564) * [-897.935] (-898.731) (-901.859) (-897.990) -- 0:00:43
      335000 -- [-899.067] (-899.056) (-899.211) (-897.659) * [-898.436] (-897.461) (-897.141) (-899.660) -- 0:00:43

      Average standard deviation of split frequencies: 0.012544

      335500 -- (-898.325) (-898.992) [-898.089] (-898.006) * [-898.801] (-898.707) (-898.699) (-900.075) -- 0:00:43
      336000 -- [-899.570] (-905.331) (-900.278) (-899.643) * (-898.681) (-898.376) (-899.424) [-900.157] -- 0:00:43
      336500 -- (-897.718) (-898.974) (-898.350) [-900.854] * [-897.875] (-899.093) (-899.332) (-896.800) -- 0:00:43
      337000 -- (-899.319) [-897.658] (-897.651) (-898.870) * (-899.371) [-900.990] (-897.512) (-898.619) -- 0:00:43
      337500 -- (-897.821) (-898.151) [-897.701] (-898.072) * (-900.722) (-899.468) [-898.391] (-898.177) -- 0:00:43
      338000 -- (-898.745) (-900.829) (-901.548) [-897.725] * (-903.787) [-899.665] (-901.029) (-898.581) -- 0:00:43
      338500 -- (-899.156) (-899.155) (-899.386) [-902.258] * (-900.540) (-903.540) (-899.639) [-897.884] -- 0:00:42
      339000 -- (-898.648) (-897.973) [-898.023] (-898.285) * (-904.337) (-899.864) (-902.327) [-898.793] -- 0:00:42
      339500 -- (-897.825) [-899.620] (-900.171) (-899.316) * (-899.257) (-902.892) (-898.885) [-898.307] -- 0:00:42
      340000 -- [-898.995] (-897.116) (-899.733) (-899.186) * (-903.567) [-899.346] (-899.394) (-898.172) -- 0:00:42

      Average standard deviation of split frequencies: 0.012886

      340500 -- (-898.767) [-898.121] (-898.748) (-899.676) * (-897.870) (-898.394) (-901.173) [-903.606] -- 0:00:42
      341000 -- (-898.326) [-898.902] (-899.421) (-899.881) * [-897.536] (-897.233) (-901.129) (-898.527) -- 0:00:42
      341500 -- [-898.036] (-899.246) (-901.897) (-897.754) * (-897.201) [-899.109] (-899.049) (-898.184) -- 0:00:42
      342000 -- (-897.988) (-900.743) (-899.222) [-898.146] * (-897.267) (-899.281) [-898.014] (-905.213) -- 0:00:44
      342500 -- (-900.212) [-898.792] (-899.800) (-903.147) * (-899.639) [-898.303] (-901.495) (-900.049) -- 0:00:44
      343000 -- (-901.056) (-900.521) [-899.395] (-899.733) * (-898.226) (-903.296) (-903.841) [-898.371] -- 0:00:44
      343500 -- (-901.066) (-899.561) (-897.867) [-898.845] * (-898.198) (-898.073) (-899.356) [-901.864] -- 0:00:43
      344000 -- (-899.309) [-899.287] (-899.568) (-900.007) * [-898.926] (-902.468) (-900.069) (-899.409) -- 0:00:43
      344500 -- [-897.877] (-898.982) (-899.551) (-899.008) * (-897.853) [-898.541] (-899.495) (-898.305) -- 0:00:43
      345000 -- [-898.622] (-898.478) (-898.666) (-898.153) * (-898.379) [-903.346] (-899.645) (-900.575) -- 0:00:43

      Average standard deviation of split frequencies: 0.012773

      345500 -- (-899.141) (-902.460) [-899.903] (-899.551) * [-898.144] (-900.388) (-905.549) (-902.321) -- 0:00:43
      346000 -- (-897.776) (-905.435) (-899.879) [-898.988] * (-898.843) (-906.190) (-901.703) [-899.117] -- 0:00:43
      346500 -- (-899.990) (-900.591) (-898.252) [-899.561] * (-901.159) (-903.443) (-898.607) [-897.140] -- 0:00:43
      347000 -- (-897.970) (-896.892) [-901.747] (-899.057) * (-898.708) (-898.784) (-899.819) [-898.589] -- 0:00:43
      347500 -- (-898.636) [-898.976] (-903.058) (-900.258) * (-900.692) [-899.292] (-897.333) (-897.742) -- 0:00:43
      348000 -- (-899.971) (-899.456) [-898.157] (-903.155) * (-898.692) [-897.868] (-900.177) (-900.542) -- 0:00:43
      348500 -- (-899.110) (-897.699) (-897.985) [-898.335] * (-899.452) (-900.004) (-898.143) [-900.266] -- 0:00:42
      349000 -- (-898.519) (-899.641) [-900.343] (-897.822) * [-899.592] (-900.759) (-900.322) (-899.268) -- 0:00:42
      349500 -- (-897.174) (-901.481) (-900.809) [-898.973] * [-898.216] (-902.891) (-901.645) (-897.027) -- 0:00:42
      350000 -- [-897.942] (-900.542) (-900.162) (-899.811) * (-906.732) (-901.410) (-901.196) [-899.337] -- 0:00:42

      Average standard deviation of split frequencies: 0.012183

      350500 -- (-898.074) (-901.260) [-901.439] (-897.405) * (-900.062) (-898.084) (-899.250) [-897.772] -- 0:00:42
      351000 -- (-898.816) [-900.154] (-900.204) (-899.116) * (-899.147) [-897.105] (-899.184) (-897.830) -- 0:00:42
      351500 -- [-899.198] (-898.659) (-898.117) (-897.736) * (-899.529) (-897.700) [-900.366] (-907.640) -- 0:00:42
      352000 -- (-898.778) (-903.588) [-898.973] (-898.021) * (-897.747) (-898.083) (-898.686) [-900.355] -- 0:00:42
      352500 -- [-897.130] (-900.019) (-904.053) (-898.562) * (-897.553) (-899.061) [-900.364] (-897.830) -- 0:00:42
      353000 -- (-900.001) (-898.107) (-906.119) [-898.814] * (-898.393) (-898.813) (-898.828) [-902.952] -- 0:00:42
      353500 -- (-899.489) (-897.252) (-898.028) [-898.193] * [-897.320] (-899.614) (-898.779) (-900.504) -- 0:00:42
      354000 -- [-900.363] (-900.528) (-897.201) (-897.670) * [-899.197] (-901.174) (-900.650) (-901.590) -- 0:00:41
      354500 -- (-899.401) (-897.573) [-898.636] (-897.366) * [-904.383] (-907.995) (-897.922) (-898.395) -- 0:00:41
      355000 -- [-897.167] (-898.819) (-899.001) (-899.057) * (-899.782) (-901.206) (-901.382) [-898.838] -- 0:00:41

      Average standard deviation of split frequencies: 0.013330

      355500 -- (-900.670) (-903.453) [-897.329] (-897.671) * (-900.740) [-900.074] (-903.272) (-898.441) -- 0:00:41
      356000 -- (-900.540) (-902.897) [-897.869] (-898.566) * (-902.055) (-899.919) [-900.520] (-899.779) -- 0:00:41
      356500 -- [-900.090] (-902.707) (-899.609) (-898.687) * (-899.462) (-898.590) (-898.770) [-900.062] -- 0:00:41
      357000 -- (-900.417) (-899.450) (-899.354) [-897.924] * [-898.939] (-900.725) (-897.897) (-899.903) -- 0:00:43
      357500 -- (-899.449) (-899.240) (-897.635) [-899.068] * [-900.024] (-899.341) (-898.486) (-901.277) -- 0:00:43
      358000 -- [-901.732] (-898.935) (-897.593) (-898.837) * (-902.090) [-900.102] (-898.137) (-897.287) -- 0:00:43
      358500 -- [-898.715] (-898.955) (-898.888) (-906.070) * (-902.011) [-900.947] (-899.006) (-899.111) -- 0:00:42
      359000 -- (-898.834) [-899.381] (-898.469) (-899.849) * [-901.304] (-901.798) (-898.893) (-899.388) -- 0:00:42
      359500 -- (-900.996) (-899.305) (-897.429) [-898.186] * (-904.245) [-902.536] (-899.716) (-900.575) -- 0:00:42
      360000 -- (-899.951) (-897.651) (-898.050) [-898.443] * (-900.707) (-898.708) [-898.362] (-897.499) -- 0:00:42

      Average standard deviation of split frequencies: 0.013506

      360500 -- (-899.281) (-898.572) (-898.739) [-898.427] * (-898.324) (-899.837) [-898.232] (-898.900) -- 0:00:42
      361000 -- (-900.416) [-897.934] (-902.002) (-898.179) * (-898.006) (-898.189) (-897.930) [-898.496] -- 0:00:42
      361500 -- (-897.624) (-897.829) (-899.081) [-899.934] * (-898.423) (-901.085) [-897.772] (-902.208) -- 0:00:42
      362000 -- [-898.243] (-898.225) (-900.644) (-899.033) * (-900.227) [-901.312] (-897.164) (-898.733) -- 0:00:42
      362500 -- (-899.000) (-899.105) (-899.990) [-898.469] * (-899.664) (-898.956) [-896.938] (-901.525) -- 0:00:42
      363000 -- (-898.426) (-900.590) [-900.979] (-899.360) * (-901.264) (-900.244) (-898.048) [-900.800] -- 0:00:42
      363500 -- (-901.216) (-898.525) (-899.978) [-901.823] * (-899.741) (-899.692) (-900.434) [-901.574] -- 0:00:42
      364000 -- (-899.815) (-899.166) [-898.032] (-898.437) * [-900.681] (-903.830) (-902.048) (-899.316) -- 0:00:41
      364500 -- (-897.802) (-899.385) (-899.167) [-897.742] * (-897.824) (-900.317) [-898.058] (-899.603) -- 0:00:41
      365000 -- [-900.327] (-898.811) (-899.095) (-897.390) * (-897.988) (-901.720) (-899.449) [-899.364] -- 0:00:41

      Average standard deviation of split frequencies: 0.013765

      365500 -- (-899.430) [-897.905] (-901.109) (-898.195) * (-900.212) (-901.771) [-899.684] (-898.395) -- 0:00:41
      366000 -- [-902.248] (-903.610) (-898.235) (-900.020) * (-899.643) (-906.099) (-898.802) [-897.046] -- 0:00:41
      366500 -- (-899.361) (-900.473) [-899.481] (-898.930) * [-899.516] (-901.578) (-898.557) (-900.354) -- 0:00:41
      367000 -- (-900.346) (-898.424) (-901.418) [-901.332] * (-898.806) (-899.535) [-898.885] (-901.135) -- 0:00:41
      367500 -- (-902.373) (-899.367) [-898.298] (-898.543) * (-898.370) (-899.364) (-899.996) [-901.079] -- 0:00:41
      368000 -- (-898.605) [-899.371] (-899.365) (-902.225) * [-897.171] (-901.032) (-899.201) (-899.509) -- 0:00:41
      368500 -- (-897.613) [-897.581] (-898.908) (-898.592) * (-897.021) (-902.675) (-899.363) [-900.865] -- 0:00:41
      369000 -- [-900.348] (-899.844) (-900.436) (-900.624) * [-899.803] (-898.742) (-900.364) (-900.606) -- 0:00:41
      369500 -- (-898.601) (-903.112) (-900.112) [-899.430] * (-897.392) [-897.232] (-898.071) (-898.552) -- 0:00:40
      370000 -- [-899.106] (-901.878) (-898.745) (-898.045) * (-900.002) (-898.903) (-900.926) [-900.287] -- 0:00:40

      Average standard deviation of split frequencies: 0.014387

      370500 -- (-898.164) (-899.592) (-900.350) [-897.743] * (-901.981) (-898.009) [-898.362] (-899.413) -- 0:00:40
      371000 -- (-903.321) (-901.841) [-898.553] (-904.070) * (-905.879) (-899.384) [-897.638] (-899.958) -- 0:00:40
      371500 -- (-900.088) (-900.443) [-897.580] (-901.142) * (-902.712) (-898.869) [-901.860] (-899.065) -- 0:00:40
      372000 -- [-900.207] (-898.898) (-900.318) (-898.627) * (-899.727) (-897.495) [-898.967] (-897.839) -- 0:00:42
      372500 -- (-899.421) (-898.536) [-899.979] (-898.758) * (-898.584) (-897.811) (-898.356) [-899.623] -- 0:00:42
      373000 -- (-898.662) (-900.759) (-897.393) [-897.234] * (-900.933) [-897.195] (-897.941) (-899.595) -- 0:00:42
      373500 -- (-898.594) (-898.294) [-897.367] (-897.770) * [-898.362] (-897.727) (-897.459) (-900.164) -- 0:00:41
      374000 -- (-900.483) (-900.880) (-899.496) [-898.302] * [-898.311] (-897.364) (-899.207) (-902.241) -- 0:00:41
      374500 -- (-901.017) (-898.991) (-898.716) [-896.848] * (-899.722) (-897.201) (-897.170) [-903.650] -- 0:00:41
      375000 -- (-897.423) [-899.100] (-898.340) (-900.046) * [-900.875] (-897.871) (-898.714) (-900.478) -- 0:00:41

      Average standard deviation of split frequencies: 0.014653

      375500 -- (-900.980) (-901.735) (-898.382) [-897.227] * (-901.060) [-900.081] (-899.623) (-899.370) -- 0:00:41
      376000 -- (-902.862) (-898.808) (-898.595) [-899.329] * (-899.219) (-899.071) [-899.449] (-898.673) -- 0:00:41
      376500 -- (-903.469) (-902.585) [-900.107] (-900.862) * (-898.167) (-899.276) (-902.100) [-898.824] -- 0:00:41
      377000 -- (-898.395) (-901.327) [-897.670] (-899.667) * (-898.422) (-899.632) [-898.672] (-897.638) -- 0:00:41
      377500 -- (-900.224) (-902.240) (-899.959) [-898.399] * (-899.667) [-900.057] (-897.782) (-899.633) -- 0:00:41
      378000 -- (-899.798) (-903.871) [-899.970] (-899.137) * (-899.639) [-903.761] (-899.115) (-899.487) -- 0:00:41
      378500 -- (-898.207) (-900.749) (-899.814) [-899.721] * (-898.877) (-905.764) (-898.222) [-898.368] -- 0:00:41
      379000 -- (-902.396) (-899.274) [-903.992] (-899.998) * [-900.467] (-902.121) (-898.572) (-899.586) -- 0:00:40
      379500 -- (-898.921) (-898.482) (-900.445) [-899.411] * (-900.832) (-899.212) (-899.550) [-900.848] -- 0:00:40
      380000 -- [-898.264] (-900.547) (-899.565) (-901.661) * (-899.713) (-897.912) (-898.143) [-898.244] -- 0:00:40

      Average standard deviation of split frequencies: 0.014319

      380500 -- (-902.237) (-900.274) (-903.237) [-897.960] * (-900.557) (-898.212) (-900.323) [-898.379] -- 0:00:40
      381000 -- (-898.829) (-898.709) [-899.444] (-898.511) * (-901.852) (-899.758) (-897.305) [-898.127] -- 0:00:40
      381500 -- (-899.188) (-898.914) (-898.829) [-901.794] * (-899.107) (-900.406) [-899.743] (-903.882) -- 0:00:40
      382000 -- (-899.422) [-903.171] (-905.862) (-898.263) * (-899.110) [-898.031] (-898.733) (-900.197) -- 0:00:40
      382500 -- [-899.374] (-898.119) (-899.141) (-898.995) * [-898.470] (-897.685) (-901.329) (-901.863) -- 0:00:40
      383000 -- (-900.755) (-899.880) (-899.951) [-902.068] * [-898.454] (-898.999) (-898.439) (-898.094) -- 0:00:40
      383500 -- (-898.256) (-904.146) [-898.547] (-901.339) * (-910.194) (-898.718) [-897.687] (-903.750) -- 0:00:40
      384000 -- (-900.478) (-900.198) (-899.446) [-897.767] * (-900.470) [-899.050] (-899.486) (-899.743) -- 0:00:40
      384500 -- (-898.023) (-899.368) (-900.599) [-900.184] * (-900.029) (-900.010) (-898.259) [-899.027] -- 0:00:40
      385000 -- [-897.657] (-900.732) (-899.375) (-902.723) * [-898.253] (-901.622) (-898.481) (-903.138) -- 0:00:39

      Average standard deviation of split frequencies: 0.014044

      385500 -- (-899.430) (-898.689) [-898.075] (-900.254) * (-897.588) (-899.194) (-900.664) [-901.341] -- 0:00:39
      386000 -- (-900.752) (-900.018) [-900.238] (-898.769) * (-897.328) (-898.135) [-897.376] (-899.724) -- 0:00:39
      386500 -- (-898.203) [-899.743] (-901.014) (-898.957) * (-897.896) (-899.237) (-900.977) [-900.027] -- 0:00:39
      387000 -- (-901.945) [-901.099] (-898.512) (-898.712) * (-905.042) (-903.698) (-902.529) [-898.808] -- 0:00:41
      387500 -- (-899.932) (-901.744) (-898.245) [-897.460] * (-898.826) (-899.649) [-899.698] (-901.725) -- 0:00:41
      388000 -- (-900.412) [-898.484] (-899.463) (-897.749) * (-898.415) [-899.326] (-900.558) (-897.907) -- 0:00:41
      388500 -- (-899.953) (-904.932) (-898.818) [-898.370] * (-900.618) [-898.310] (-902.329) (-897.383) -- 0:00:40
      389000 -- (-897.469) [-897.957] (-898.534) (-899.018) * (-900.122) (-898.686) (-899.206) [-899.188] -- 0:00:40
      389500 -- (-901.850) (-900.899) (-902.251) [-898.790] * (-897.212) (-898.365) [-902.740] (-899.407) -- 0:00:40
      390000 -- (-899.680) [-901.699] (-904.532) (-899.406) * (-897.258) (-898.521) [-900.584] (-901.419) -- 0:00:40

      Average standard deviation of split frequencies: 0.014631

      390500 -- (-901.449) (-899.849) [-902.843] (-898.690) * (-898.297) [-900.249] (-898.775) (-899.632) -- 0:00:40
      391000 -- (-898.582) (-897.204) (-899.597) [-899.365] * (-899.010) (-899.245) [-899.654] (-900.968) -- 0:00:40
      391500 -- (-898.830) (-898.215) [-898.115] (-898.076) * (-899.242) (-901.717) (-900.594) [-900.380] -- 0:00:40
      392000 -- (-898.652) [-899.974] (-899.260) (-901.046) * (-897.296) (-901.003) [-897.341] (-902.050) -- 0:00:40
      392500 -- (-897.826) [-898.037] (-901.665) (-901.596) * [-897.236] (-897.617) (-898.962) (-897.533) -- 0:00:40
      393000 -- (-898.111) (-897.482) [-898.326] (-899.921) * (-898.203) [-900.052] (-898.887) (-898.216) -- 0:00:40
      393500 -- [-897.213] (-900.502) (-900.099) (-898.716) * (-900.770) [-899.190] (-899.200) (-898.594) -- 0:00:40
      394000 -- (-897.232) [-899.547] (-898.464) (-897.834) * [-898.314] (-898.659) (-899.633) (-898.761) -- 0:00:39
      394500 -- (-897.950) (-899.694) [-901.179] (-897.985) * [-898.102] (-899.364) (-898.977) (-897.704) -- 0:00:39
      395000 -- (-897.561) (-899.667) [-899.799] (-897.516) * [-898.351] (-896.857) (-898.092) (-899.099) -- 0:00:39

      Average standard deviation of split frequencies: 0.014285

      395500 -- (-897.378) (-898.099) (-902.787) [-897.516] * (-908.499) (-897.300) [-899.698] (-900.033) -- 0:00:39
      396000 -- [-899.353] (-899.562) (-898.526) (-897.654) * (-901.706) (-899.904) [-897.622] (-901.544) -- 0:00:39
      396500 -- (-903.671) [-899.525] (-898.472) (-901.646) * (-900.940) (-897.491) [-902.407] (-902.913) -- 0:00:39
      397000 -- [-902.832] (-901.194) (-898.827) (-901.835) * (-902.568) [-901.508] (-899.338) (-899.219) -- 0:00:39
      397500 -- (-900.221) [-899.447] (-900.254) (-899.470) * [-898.345] (-902.256) (-900.424) (-901.708) -- 0:00:39
      398000 -- (-900.681) (-898.740) [-900.264] (-899.154) * [-900.601] (-898.022) (-904.042) (-897.166) -- 0:00:39
      398500 -- [-900.055] (-898.629) (-901.703) (-902.164) * [-899.738] (-897.318) (-900.823) (-897.777) -- 0:00:39
      399000 -- [-897.148] (-903.201) (-902.775) (-900.279) * (-899.571) (-900.205) [-900.377] (-897.763) -- 0:00:39
      399500 -- [-897.167] (-898.398) (-899.566) (-899.115) * (-899.005) (-899.479) (-902.129) [-897.852] -- 0:00:39
      400000 -- (-899.472) (-899.334) [-899.547] (-901.836) * (-905.531) (-897.986) [-897.102] (-897.154) -- 0:00:39

      Average standard deviation of split frequencies: 0.014119

      400500 -- (-899.183) [-901.353] (-899.227) (-902.284) * (-901.411) (-902.096) [-900.925] (-897.515) -- 0:00:40
      401000 -- [-901.504] (-897.273) (-899.230) (-899.295) * (-905.486) (-900.086) [-899.282] (-897.511) -- 0:00:40
      401500 -- (-902.152) [-897.632] (-901.767) (-898.695) * [-899.082] (-899.231) (-898.427) (-897.335) -- 0:00:40
      402000 -- (-898.548) (-898.200) (-899.140) [-899.054] * [-898.242] (-900.494) (-898.383) (-898.192) -- 0:00:40
      402500 -- (-898.803) (-899.028) [-899.840] (-900.165) * (-900.925) [-897.991] (-898.861) (-900.187) -- 0:00:40
      403000 -- [-898.129] (-900.870) (-900.393) (-899.264) * (-901.789) (-898.620) [-897.744] (-898.113) -- 0:00:39
      403500 -- [-899.159] (-898.550) (-902.360) (-898.836) * (-901.754) (-899.982) (-897.513) [-899.082] -- 0:00:39
      404000 -- (-900.316) [-899.556] (-903.362) (-899.249) * (-900.603) (-898.192) (-899.867) [-897.164] -- 0:00:39
      404500 -- (-901.906) (-899.569) [-898.318] (-898.465) * (-900.933) (-899.681) (-898.630) [-897.704] -- 0:00:39
      405000 -- (-897.884) [-898.464] (-898.697) (-902.526) * [-901.088] (-903.696) (-898.523) (-898.398) -- 0:00:39

      Average standard deviation of split frequencies: 0.013933

      405500 -- (-900.549) (-897.411) (-899.085) [-897.891] * (-899.529) (-904.057) (-899.143) [-900.128] -- 0:00:39
      406000 -- (-898.888) (-902.942) (-899.586) [-899.321] * (-901.404) (-900.059) [-899.134] (-903.636) -- 0:00:39
      406500 -- (-897.562) (-899.232) [-898.963] (-901.320) * (-900.186) (-898.453) [-898.968] (-901.191) -- 0:00:39
      407000 -- (-898.395) (-898.612) (-900.198) [-897.672] * (-899.178) (-900.214) (-899.206) [-897.522] -- 0:00:39
      407500 -- (-897.687) (-905.417) (-897.762) [-899.529] * (-898.485) (-899.125) (-898.209) [-897.980] -- 0:00:39
      408000 -- [-899.739] (-908.600) (-897.676) (-899.500) * (-900.896) (-900.585) [-900.746] (-899.419) -- 0:00:39
      408500 -- [-900.709] (-900.229) (-900.086) (-899.253) * (-897.723) (-898.292) (-899.211) [-901.049] -- 0:00:39
      409000 -- (-901.214) (-897.889) [-898.924] (-898.305) * (-899.023) [-900.258] (-899.048) (-900.275) -- 0:00:39
      409500 -- (-900.747) [-898.891] (-899.846) (-898.256) * (-900.702) (-898.265) [-898.488] (-898.826) -- 0:00:38
      410000 -- [-900.702] (-903.084) (-902.295) (-897.617) * (-899.392) [-897.213] (-897.605) (-899.461) -- 0:00:38

      Average standard deviation of split frequencies: 0.014045

      410500 -- [-901.352] (-903.738) (-897.855) (-898.058) * [-901.287] (-897.733) (-898.121) (-900.021) -- 0:00:38
      411000 -- [-899.448] (-901.068) (-898.834) (-900.308) * (-899.714) [-905.672] (-898.502) (-898.371) -- 0:00:38
      411500 -- (-898.162) (-899.318) [-900.856] (-901.185) * (-897.615) (-902.197) (-897.619) [-898.619] -- 0:00:38
      412000 -- [-898.166] (-898.965) (-899.664) (-898.063) * (-898.639) (-899.667) [-897.358] (-898.714) -- 0:00:38
      412500 -- (-899.634) [-899.815] (-901.672) (-898.099) * (-901.349) (-898.453) [-897.064] (-897.379) -- 0:00:38
      413000 -- (-902.791) (-902.145) (-897.839) [-897.225] * [-897.978] (-898.482) (-900.899) (-899.694) -- 0:00:38
      413500 -- (-898.825) (-900.661) (-897.814) [-897.256] * [-901.120] (-903.012) (-898.131) (-901.378) -- 0:00:38
      414000 -- (-900.036) [-900.821] (-898.345) (-898.436) * (-896.922) [-901.868] (-909.611) (-898.463) -- 0:00:38
      414500 -- (-899.974) (-900.760) (-900.254) [-901.262] * (-896.970) (-899.027) [-907.700] (-898.005) -- 0:00:38
      415000 -- [-900.541] (-897.597) (-899.807) (-899.467) * (-897.907) (-896.933) [-898.956] (-897.673) -- 0:00:38

      Average standard deviation of split frequencies: 0.013386

      415500 -- [-899.078] (-899.080) (-897.149) (-900.741) * [-898.678] (-897.762) (-898.577) (-898.686) -- 0:00:37
      416000 -- (-900.370) (-900.767) (-903.689) [-899.487] * (-898.562) [-897.476] (-899.596) (-900.017) -- 0:00:37
      416500 -- (-898.627) (-899.384) [-899.150] (-897.943) * (-903.165) (-897.583) (-898.824) [-902.774] -- 0:00:39
      417000 -- [-898.509] (-898.505) (-897.205) (-899.617) * (-898.520) (-897.611) [-900.366] (-901.184) -- 0:00:39
      417500 -- (-899.076) (-898.232) [-897.205] (-899.967) * (-899.808) (-897.958) (-900.553) [-899.919] -- 0:00:39
      418000 -- (-903.225) [-898.521] (-898.154) (-900.415) * [-899.434] (-897.858) (-904.991) (-897.393) -- 0:00:38
      418500 -- (-898.728) [-902.449] (-899.347) (-898.395) * (-900.112) [-897.865] (-901.742) (-898.406) -- 0:00:38
      419000 -- [-897.971] (-898.857) (-902.100) (-898.704) * [-899.795] (-897.380) (-900.707) (-899.582) -- 0:00:38
      419500 -- (-897.192) (-899.809) (-905.223) [-898.062] * (-900.823) [-897.380] (-901.477) (-898.573) -- 0:00:38
      420000 -- (-897.583) (-901.576) [-900.566] (-903.217) * (-898.153) [-897.380] (-901.642) (-897.977) -- 0:00:38

      Average standard deviation of split frequencies: 0.013868

      420500 -- (-897.580) (-903.175) [-899.467] (-899.074) * (-898.186) (-898.654) [-899.283] (-897.776) -- 0:00:38
      421000 -- (-898.163) (-897.715) [-901.341] (-900.490) * (-903.821) (-900.444) [-900.019] (-899.671) -- 0:00:38
      421500 -- (-899.724) [-897.804] (-899.081) (-902.057) * (-899.761) (-898.095) (-900.611) [-900.503] -- 0:00:38
      422000 -- (-898.768) (-897.680) [-898.836] (-900.380) * (-897.679) [-899.584] (-898.163) (-898.516) -- 0:00:38
      422500 -- (-899.361) [-897.242] (-899.515) (-898.085) * (-899.786) (-900.312) (-897.870) [-900.628] -- 0:00:38
      423000 -- [-900.450] (-902.739) (-899.708) (-898.034) * [-901.402] (-898.608) (-896.973) (-900.292) -- 0:00:38
      423500 -- (-900.355) [-900.002] (-904.178) (-899.112) * (-901.629) (-897.866) [-898.676] (-897.514) -- 0:00:38
      424000 -- (-899.125) [-898.598] (-902.465) (-899.309) * [-900.035] (-897.450) (-898.626) (-899.519) -- 0:00:38
      424500 -- (-898.461) [-899.326] (-901.835) (-898.796) * [-903.249] (-900.446) (-899.138) (-898.991) -- 0:00:37
      425000 -- [-897.541] (-899.950) (-900.680) (-900.771) * [-899.837] (-897.316) (-899.517) (-898.771) -- 0:00:37

      Average standard deviation of split frequencies: 0.012933

      425500 -- [-897.453] (-900.161) (-897.657) (-900.576) * (-899.932) (-897.641) (-899.801) [-903.224] -- 0:00:37
      426000 -- (-897.366) (-904.847) [-899.279] (-901.485) * [-898.763] (-900.799) (-903.290) (-908.701) -- 0:00:37
      426500 -- (-898.359) (-901.676) [-899.268] (-900.633) * (-897.893) (-900.690) [-901.979] (-899.304) -- 0:00:37
      427000 -- (-902.725) (-898.877) (-899.288) [-898.061] * (-898.383) (-898.496) [-899.763] (-899.523) -- 0:00:37
      427500 -- (-902.706) [-898.697] (-898.153) (-898.740) * (-897.746) (-898.162) (-898.111) [-897.647] -- 0:00:37
      428000 -- (-899.058) [-898.739] (-898.383) (-898.970) * (-899.005) [-899.357] (-897.450) (-897.813) -- 0:00:37
      428500 -- (-900.854) (-899.334) [-900.899] (-898.411) * [-898.520] (-898.574) (-898.052) (-901.571) -- 0:00:37
      429000 -- (-904.104) [-900.009] (-899.402) (-898.736) * (-899.862) (-897.078) (-897.691) [-899.595] -- 0:00:37
      429500 -- (-902.516) [-898.576] (-899.619) (-901.758) * [-898.362] (-896.903) (-899.085) (-898.386) -- 0:00:37
      430000 -- (-899.210) (-899.839) [-898.227] (-901.666) * (-899.409) [-897.379] (-899.138) (-899.823) -- 0:00:37

      Average standard deviation of split frequencies: 0.013272

      430500 -- (-898.825) (-899.038) (-897.347) [-898.004] * [-899.169] (-897.430) (-899.706) (-898.316) -- 0:00:37
      431000 -- [-900.042] (-900.875) (-897.618) (-904.194) * (-898.527) [-897.529] (-901.647) (-898.425) -- 0:00:36
      431500 -- [-898.158] (-903.811) (-897.593) (-898.414) * (-897.755) (-898.701) (-899.326) [-899.754] -- 0:00:36
      432000 -- [-898.440] (-898.584) (-898.640) (-898.756) * [-898.337] (-901.597) (-899.144) (-899.043) -- 0:00:36
      432500 -- (-903.434) (-898.498) (-897.198) [-899.308] * (-899.653) [-899.370] (-897.686) (-897.858) -- 0:00:36
      433000 -- [-901.417] (-898.698) (-898.572) (-898.641) * [-898.399] (-902.724) (-900.700) (-898.311) -- 0:00:37
      433500 -- [-903.599] (-897.754) (-897.961) (-900.801) * (-898.503) [-900.180] (-897.817) (-897.595) -- 0:00:37
      434000 -- (-903.009) [-899.669] (-897.878) (-900.049) * (-897.474) [-898.594] (-898.607) (-897.163) -- 0:00:37
      434500 -- (-897.405) [-900.689] (-897.782) (-898.242) * (-897.135) (-899.298) [-899.930] (-897.145) -- 0:00:37
      435000 -- (-898.591) [-897.883] (-897.546) (-897.636) * [-899.191] (-897.981) (-898.759) (-899.428) -- 0:00:37

      Average standard deviation of split frequencies: 0.013447

      435500 -- (-899.118) (-898.000) (-903.001) [-897.634] * [-897.616] (-899.090) (-898.397) (-898.694) -- 0:00:37
      436000 -- (-898.120) [-897.283] (-901.552) (-899.211) * [-897.948] (-897.955) (-902.002) (-900.066) -- 0:00:37
      436500 -- (-899.699) [-897.273] (-898.594) (-897.254) * [-899.639] (-901.442) (-899.503) (-899.681) -- 0:00:37
      437000 -- (-898.187) [-896.886] (-898.471) (-902.879) * (-897.876) (-899.603) (-898.342) [-906.403] -- 0:00:37
      437500 -- [-902.371] (-898.249) (-897.979) (-901.172) * [-902.142] (-901.541) (-898.630) (-900.861) -- 0:00:37
      438000 -- (-898.683) (-900.943) [-898.705] (-898.041) * (-900.924) (-900.206) [-899.648] (-900.329) -- 0:00:37
      438500 -- (-897.786) (-901.286) [-899.301] (-897.128) * (-897.709) [-900.107] (-899.246) (-898.413) -- 0:00:37
      439000 -- (-899.304) (-899.722) (-897.309) [-899.106] * (-901.066) (-898.861) [-898.848] (-900.447) -- 0:00:37
      439500 -- [-897.975] (-899.618) (-897.190) (-898.711) * (-901.015) (-901.551) [-899.024] (-899.761) -- 0:00:36
      440000 -- (-903.743) (-898.358) [-897.111] (-900.085) * (-898.943) (-899.057) [-901.617] (-900.681) -- 0:00:36

      Average standard deviation of split frequencies: 0.013974

      440500 -- (-898.701) (-898.792) (-901.733) [-898.711] * (-898.071) (-898.228) (-897.061) [-899.709] -- 0:00:36
      441000 -- (-898.916) (-898.764) (-899.402) [-897.883] * [-903.384] (-898.209) (-904.647) (-900.048) -- 0:00:36
      441500 -- [-897.926] (-898.883) (-900.650) (-898.532) * (-902.258) (-898.190) [-904.638] (-900.917) -- 0:00:36
      442000 -- (-900.122) (-900.278) (-901.019) [-898.717] * [-898.288] (-897.549) (-898.622) (-898.914) -- 0:00:36
      442500 -- (-899.609) (-897.818) [-899.962] (-898.547) * (-898.833) (-898.237) [-898.644] (-898.845) -- 0:00:36
      443000 -- (-902.462) (-899.891) (-907.675) [-900.370] * [-899.057] (-897.625) (-898.823) (-900.820) -- 0:00:36
      443500 -- [-898.055] (-898.961) (-901.178) (-897.601) * (-898.421) (-899.210) (-902.412) [-903.960] -- 0:00:36
      444000 -- (-897.858) (-897.715) (-900.552) [-897.824] * [-899.573] (-898.172) (-898.962) (-902.779) -- 0:00:36
      444500 -- (-898.308) [-898.294] (-899.344) (-899.275) * (-900.508) (-903.824) (-899.002) [-900.419] -- 0:00:36
      445000 -- [-901.374] (-905.824) (-899.500) (-903.386) * (-900.244) [-897.725] (-898.806) (-898.478) -- 0:00:36

      Average standard deviation of split frequencies: 0.014467

      445500 -- (-902.739) (-903.083) [-898.747] (-900.703) * (-897.723) [-898.136] (-898.377) (-898.518) -- 0:00:36
      446000 -- (-899.964) (-904.899) [-897.230] (-899.603) * (-898.775) [-898.342] (-899.228) (-899.678) -- 0:00:36
      446500 -- (-899.168) (-899.823) [-898.237] (-898.882) * (-899.834) (-898.405) [-897.766] (-900.536) -- 0:00:35
      447000 -- (-898.649) (-903.232) [-899.692] (-898.412) * (-900.818) (-900.934) (-897.902) [-901.293] -- 0:00:35
      447500 -- (-897.825) [-899.187] (-901.607) (-899.706) * (-900.051) [-898.065] (-899.109) (-899.619) -- 0:00:35
      448000 -- (-900.700) (-898.958) (-901.179) [-901.473] * [-900.339] (-898.629) (-898.631) (-897.004) -- 0:00:35
      448500 -- (-904.139) (-897.673) [-897.460] (-900.418) * (-899.651) [-898.211] (-897.613) (-898.846) -- 0:00:35
      449000 -- (-898.555) (-897.349) [-897.403] (-903.330) * (-901.576) [-898.457] (-905.320) (-898.378) -- 0:00:35
      449500 -- [-898.924] (-898.058) (-898.525) (-897.391) * [-898.457] (-901.512) (-900.375) (-899.634) -- 0:00:36
      450000 -- [-897.771] (-900.803) (-896.794) (-901.401) * (-898.099) (-899.702) [-899.608] (-899.109) -- 0:00:36

      Average standard deviation of split frequencies: 0.015136

      450500 -- (-898.497) (-904.826) [-897.368] (-901.781) * (-898.188) [-900.779] (-901.019) (-897.446) -- 0:00:36
      451000 -- (-897.882) (-902.008) [-899.338] (-897.852) * [-900.105] (-897.804) (-897.712) (-899.682) -- 0:00:36
      451500 -- (-900.722) (-903.785) (-899.313) [-902.687] * (-900.113) (-898.872) (-902.102) [-898.397] -- 0:00:36
      452000 -- (-899.619) (-900.386) [-897.647] (-900.270) * (-901.855) (-897.661) [-901.360] (-898.654) -- 0:00:36
      452500 -- (-903.447) [-899.092] (-897.169) (-900.034) * (-903.499) [-898.718] (-906.095) (-900.090) -- 0:00:36
      453000 -- [-900.943] (-897.320) (-904.143) (-896.905) * [-901.978] (-900.573) (-901.312) (-899.697) -- 0:00:36
      453500 -- [-899.449] (-899.833) (-899.938) (-902.389) * [-900.613] (-900.503) (-902.788) (-902.548) -- 0:00:36
      454000 -- (-898.730) [-898.820] (-899.543) (-903.388) * (-900.401) (-899.491) [-900.114] (-899.481) -- 0:00:36
      454500 -- (-898.741) [-897.892] (-899.407) (-903.966) * (-900.592) (-898.993) (-897.175) [-905.031] -- 0:00:36
      455000 -- (-898.456) [-898.836] (-899.582) (-900.796) * [-899.870] (-903.406) (-898.182) (-900.445) -- 0:00:35

      Average standard deviation of split frequencies: 0.015203

      455500 -- (-898.528) (-899.223) [-898.892] (-899.765) * [-897.463] (-905.764) (-898.222) (-899.131) -- 0:00:35
      456000 -- (-897.798) [-900.759] (-898.730) (-898.559) * [-898.752] (-899.819) (-898.874) (-898.727) -- 0:00:35
      456500 -- (-898.480) (-899.012) [-898.811] (-897.614) * [-901.268] (-900.423) (-902.208) (-899.404) -- 0:00:35
      457000 -- (-899.402) (-898.984) [-897.565] (-898.735) * (-899.334) (-899.420) (-898.631) [-901.050] -- 0:00:35
      457500 -- [-902.794] (-897.291) (-906.504) (-900.661) * (-897.947) (-899.433) (-902.041) [-898.678] -- 0:00:35
      458000 -- [-899.409] (-899.131) (-898.785) (-902.232) * (-898.207) [-900.633] (-897.960) (-899.335) -- 0:00:35
      458500 -- (-900.733) [-899.500] (-904.252) (-898.158) * (-897.094) [-899.844] (-900.581) (-899.948) -- 0:00:35
      459000 -- (-901.111) (-900.417) (-899.351) [-898.522] * (-903.489) (-900.301) [-898.758] (-899.342) -- 0:00:35
      459500 -- (-902.355) [-899.229] (-898.116) (-899.765) * (-899.758) (-898.932) (-901.789) [-898.512] -- 0:00:35
      460000 -- [-897.791] (-899.581) (-898.115) (-898.562) * (-898.988) (-898.989) [-899.221] (-898.276) -- 0:00:35

      Average standard deviation of split frequencies: 0.013965

      460500 -- (-901.652) (-902.924) [-898.535] (-897.946) * [-898.821] (-899.820) (-899.897) (-898.581) -- 0:00:35
      461000 -- (-899.212) [-903.776] (-897.119) (-897.662) * (-901.409) (-901.582) (-900.030) [-897.246] -- 0:00:35
      461500 -- (-897.885) [-897.956] (-898.244) (-898.866) * (-899.048) (-900.942) [-897.904] (-902.617) -- 0:00:35
      462000 -- [-900.257] (-898.127) (-898.841) (-898.309) * (-899.797) (-899.837) (-898.450) [-901.333] -- 0:00:34
      462500 -- (-897.485) [-900.184] (-899.659) (-897.865) * (-904.004) (-900.191) (-897.590) [-902.289] -- 0:00:34
      463000 -- (-899.665) [-900.086] (-897.231) (-898.849) * (-899.205) (-900.275) (-897.992) [-898.268] -- 0:00:34
      463500 -- (-900.930) (-901.750) [-906.888] (-898.880) * (-900.587) (-901.505) [-898.089] (-897.678) -- 0:00:34
      464000 -- (-898.865) (-903.553) [-903.208] (-898.351) * (-897.734) (-898.926) (-897.873) [-898.514] -- 0:00:34
      464500 -- (-900.504) (-899.804) (-905.447) [-899.266] * (-898.198) (-897.520) [-900.016] (-897.087) -- 0:00:34
      465000 -- (-899.148) (-900.309) (-898.763) [-898.339] * (-900.323) [-901.278] (-897.471) (-898.055) -- 0:00:34

      Average standard deviation of split frequencies: 0.014103

      465500 -- (-899.293) (-900.860) (-900.423) [-898.610] * (-898.041) [-897.324] (-901.806) (-897.868) -- 0:00:35
      466000 -- [-900.591] (-897.072) (-897.736) (-898.164) * (-901.536) (-897.545) (-898.864) [-900.540] -- 0:00:35
      466500 -- (-898.059) (-897.400) [-898.191] (-898.788) * [-901.377] (-899.897) (-900.657) (-901.430) -- 0:00:35
      467000 -- (-898.081) (-897.280) (-902.104) [-899.523] * [-904.081] (-898.798) (-898.331) (-898.267) -- 0:00:35
      467500 -- (-898.581) (-898.066) [-903.868] (-898.253) * [-898.899] (-900.243) (-898.224) (-898.226) -- 0:00:35
      468000 -- (-900.231) (-898.222) [-901.406] (-898.659) * (-897.614) [-900.741] (-901.374) (-899.019) -- 0:00:35
      468500 -- [-900.910] (-901.016) (-900.146) (-897.871) * (-898.346) [-897.420] (-900.674) (-899.197) -- 0:00:35
      469000 -- (-898.173) [-900.746] (-899.598) (-898.291) * (-897.130) (-898.604) [-900.235] (-899.030) -- 0:00:35
      469500 -- (-902.552) [-900.331] (-899.989) (-902.256) * (-898.672) (-897.841) (-897.768) [-897.897] -- 0:00:35
      470000 -- (-902.139) [-898.672] (-897.276) (-898.618) * [-898.867] (-898.008) (-903.989) (-897.496) -- 0:00:34

      Average standard deviation of split frequencies: 0.013492

      470500 -- (-899.431) (-897.480) (-898.046) [-899.324] * (-898.726) (-908.911) (-900.167) [-900.415] -- 0:00:34
      471000 -- [-900.566] (-899.217) (-904.149) (-900.598) * (-899.768) [-899.932] (-901.853) (-898.969) -- 0:00:34
      471500 -- [-903.997] (-904.197) (-900.987) (-901.425) * (-899.601) (-900.279) [-899.736] (-898.330) -- 0:00:34
      472000 -- [-897.384] (-901.562) (-899.987) (-903.663) * [-897.077] (-904.141) (-899.159) (-900.268) -- 0:00:34
      472500 -- (-900.664) (-897.682) [-898.587] (-898.785) * (-898.166) (-900.150) (-899.973) [-898.830] -- 0:00:34
      473000 -- (-898.838) (-898.154) [-899.922] (-900.904) * (-899.621) (-899.410) (-905.139) [-900.314] -- 0:00:34
      473500 -- [-900.479] (-897.890) (-897.708) (-901.574) * (-899.271) (-899.933) (-900.156) [-898.261] -- 0:00:34
      474000 -- (-897.177) (-898.558) (-900.409) [-899.641] * (-898.613) [-898.306] (-898.370) (-899.724) -- 0:00:34
      474500 -- [-897.316] (-901.376) (-900.222) (-900.779) * (-903.711) [-901.486] (-902.720) (-899.021) -- 0:00:34
      475000 -- (-897.661) [-900.192] (-898.435) (-898.167) * (-901.145) (-898.160) [-901.078] (-899.356) -- 0:00:34

      Average standard deviation of split frequencies: 0.013923

      475500 -- (-898.195) (-900.225) [-898.351] (-899.180) * (-901.060) (-899.193) [-899.878] (-898.443) -- 0:00:34
      476000 -- (-899.255) (-900.161) (-898.660) [-900.399] * (-897.938) (-898.597) [-898.882] (-896.813) -- 0:00:34
      476500 -- (-898.594) (-899.200) [-898.872] (-900.628) * [-898.381] (-900.939) (-898.728) (-897.429) -- 0:00:34
      477000 -- (-900.798) (-898.364) [-899.016] (-898.348) * (-898.319) (-900.627) [-901.743] (-897.979) -- 0:00:33
      477500 -- (-901.266) (-898.236) (-898.328) [-900.154] * (-898.684) (-898.601) (-898.791) [-897.606] -- 0:00:33
      478000 -- (-899.901) [-898.997] (-899.825) (-896.824) * [-897.073] (-897.904) (-898.327) (-899.823) -- 0:00:33
      478500 -- (-898.429) [-899.085] (-900.996) (-897.072) * (-898.539) [-901.884] (-899.622) (-900.695) -- 0:00:33
      479000 -- (-898.040) (-898.932) [-899.854] (-897.095) * [-897.347] (-898.205) (-899.569) (-898.312) -- 0:00:33
      479500 -- (-898.790) (-904.496) (-901.746) [-898.046] * (-897.348) [-898.283] (-898.665) (-901.856) -- 0:00:33
      480000 -- (-897.767) (-898.548) [-897.399] (-898.598) * (-901.287) [-899.569] (-899.435) (-898.397) -- 0:00:33

      Average standard deviation of split frequencies: 0.012872

      480500 -- [-898.252] (-897.832) (-897.191) (-898.245) * (-901.343) (-899.471) (-898.781) [-898.226] -- 0:00:33
      481000 -- [-904.944] (-898.311) (-901.160) (-897.526) * [-898.783] (-899.177) (-900.315) (-897.875) -- 0:00:33
      481500 -- (-900.655) (-904.394) (-901.336) [-898.088] * (-899.321) (-898.662) (-902.017) [-902.205] -- 0:00:33
      482000 -- (-900.595) (-899.517) [-897.883] (-899.974) * (-899.938) (-897.389) [-903.955] (-899.056) -- 0:00:34
      482500 -- (-899.739) (-901.787) [-904.193] (-898.784) * [-900.241] (-901.764) (-907.086) (-903.475) -- 0:00:34
      483000 -- [-899.115] (-898.955) (-905.038) (-898.923) * (-899.724) (-898.869) [-899.385] (-900.206) -- 0:00:34
      483500 -- (-897.124) [-900.476] (-899.306) (-900.008) * [-900.134] (-900.752) (-899.161) (-897.378) -- 0:00:34
      484000 -- (-897.159) [-899.466] (-898.498) (-905.807) * (-901.685) [-898.351] (-898.300) (-900.232) -- 0:00:34
      484500 -- (-897.968) (-900.730) [-899.568] (-902.141) * [-902.352] (-899.174) (-898.010) (-900.892) -- 0:00:34
      485000 -- (-902.151) (-899.061) [-902.599] (-899.761) * [-900.095] (-898.777) (-897.086) (-899.692) -- 0:00:33

      Average standard deviation of split frequencies: 0.012731

      485500 -- (-900.891) (-905.990) (-902.591) [-897.559] * (-899.599) (-903.037) [-897.193] (-902.378) -- 0:00:33
      486000 -- (-902.752) (-901.845) (-899.025) [-897.397] * (-899.194) (-903.454) [-902.791] (-903.424) -- 0:00:33
      486500 -- (-898.655) (-898.239) (-898.247) [-897.626] * (-897.446) [-897.628] (-900.043) (-898.136) -- 0:00:33
      487000 -- [-897.973] (-900.476) (-899.318) (-897.918) * (-897.863) [-901.034] (-902.924) (-898.353) -- 0:00:33
      487500 -- (-898.174) (-901.307) (-899.655) [-899.529] * [-901.098] (-902.516) (-903.191) (-899.738) -- 0:00:33
      488000 -- (-897.486) [-897.498] (-899.609) (-899.238) * (-900.288) (-897.569) (-899.489) [-900.718] -- 0:00:33
      488500 -- [-898.077] (-898.478) (-897.296) (-899.323) * (-898.672) (-897.998) (-906.391) [-902.797] -- 0:00:33
      489000 -- (-898.110) (-899.235) [-898.067] (-900.884) * [-897.128] (-899.073) (-901.810) (-899.718) -- 0:00:33
      489500 -- (-899.119) (-900.352) (-898.279) [-899.084] * (-897.112) (-901.855) (-899.816) [-897.937] -- 0:00:33
      490000 -- (-898.016) (-898.670) [-898.253] (-899.002) * (-897.750) (-899.458) [-898.526] (-899.337) -- 0:00:33

      Average standard deviation of split frequencies: 0.011465

      490500 -- (-897.225) [-900.666] (-899.221) (-899.898) * [-899.784] (-899.667) (-897.452) (-900.065) -- 0:00:33
      491000 -- (-898.316) (-900.543) (-904.371) [-898.966] * (-899.186) (-899.312) (-901.174) [-901.238] -- 0:00:33
      491500 -- (-899.619) (-899.058) (-901.022) [-898.675] * (-899.430) (-900.409) (-898.470) [-897.249] -- 0:00:33
      492000 -- (-903.646) (-898.974) (-899.303) [-900.516] * (-898.218) (-899.020) [-902.437] (-900.697) -- 0:00:33
      492500 -- (-902.916) [-897.719] (-898.779) (-898.620) * (-898.910) [-897.526] (-897.253) (-903.709) -- 0:00:32
      493000 -- (-900.926) [-899.370] (-899.296) (-901.267) * (-899.735) (-899.708) (-897.347) [-905.026] -- 0:00:32
      493500 -- (-901.435) [-898.239] (-900.879) (-902.256) * (-900.624) (-898.166) [-900.793] (-900.577) -- 0:00:32
      494000 -- [-901.898] (-898.926) (-900.950) (-900.473) * (-900.042) (-897.212) (-901.300) [-898.801] -- 0:00:32
      494500 -- (-901.165) (-904.646) [-900.201] (-904.709) * [-899.535] (-899.523) (-900.965) (-897.886) -- 0:00:32
      495000 -- (-900.970) [-897.096] (-899.848) (-905.063) * [-900.828] (-902.850) (-898.509) (-897.242) -- 0:00:32

      Average standard deviation of split frequencies: 0.010518

      495500 -- (-900.661) [-897.429] (-899.187) (-899.071) * (-899.168) [-897.978] (-898.258) (-898.923) -- 0:00:32
      496000 -- (-897.839) [-898.837] (-899.211) (-899.427) * (-898.227) (-899.583) (-900.313) [-897.837] -- 0:00:32
      496500 -- (-901.564) (-897.615) (-902.063) [-901.559] * (-898.152) (-900.907) (-897.889) [-898.336] -- 0:00:32
      497000 -- (-906.373) (-900.640) [-899.322] (-900.168) * (-898.276) [-898.740] (-899.518) (-900.567) -- 0:00:32
      497500 -- (-902.460) (-901.699) (-898.133) [-899.991] * (-899.554) (-897.991) [-901.092] (-898.630) -- 0:00:33
      498000 -- (-902.257) (-899.035) (-901.646) [-899.916] * (-900.345) (-900.410) (-898.915) [-901.122] -- 0:00:33
      498500 -- (-903.361) (-898.320) [-897.822] (-897.440) * (-901.548) (-899.687) [-898.070] (-900.416) -- 0:00:33
      499000 -- (-897.949) [-899.190] (-899.556) (-905.308) * (-905.818) [-898.994] (-898.907) (-899.152) -- 0:00:33
      499500 -- (-898.191) [-901.676] (-900.099) (-902.301) * (-900.438) (-902.095) [-900.041] (-903.420) -- 0:00:33
      500000 -- (-901.316) (-900.960) (-900.143) [-898.412] * (-897.538) [-897.135] (-900.499) (-900.524) -- 0:00:33

      Average standard deviation of split frequencies: 0.010043

      500500 -- [-900.944] (-897.932) (-898.515) (-905.198) * (-902.898) (-902.603) (-899.224) [-900.912] -- 0:00:32
      501000 -- (-900.664) (-897.579) [-898.553] (-897.907) * (-899.654) (-899.214) [-899.678] (-899.546) -- 0:00:32
      501500 -- (-897.854) (-899.300) (-897.471) [-898.285] * (-897.613) [-898.013] (-902.915) (-899.875) -- 0:00:32
      502000 -- (-902.179) [-898.894] (-897.975) (-898.347) * (-901.834) [-899.068] (-897.917) (-903.651) -- 0:00:32
      502500 -- (-898.475) (-899.293) (-900.376) [-899.221] * [-898.332] (-896.843) (-899.698) (-904.808) -- 0:00:32
      503000 -- (-900.332) [-898.908] (-904.896) (-899.927) * (-898.574) [-899.215] (-897.090) (-901.755) -- 0:00:32
      503500 -- (-903.035) [-897.820] (-906.047) (-901.234) * (-897.857) (-900.086) (-897.304) [-899.470] -- 0:00:32
      504000 -- (-899.301) [-897.314] (-900.072) (-899.732) * [-901.058] (-897.494) (-901.070) (-898.126) -- 0:00:32
      504500 -- (-897.903) [-900.413] (-901.171) (-901.237) * (-902.897) (-906.066) [-898.428] (-897.775) -- 0:00:32
      505000 -- (-898.270) (-899.669) (-899.260) [-897.720] * [-900.215] (-899.186) (-897.783) (-898.484) -- 0:00:32

      Average standard deviation of split frequencies: 0.010621

      505500 -- (-898.153) [-899.636] (-898.795) (-898.082) * (-898.405) (-898.304) (-899.676) [-899.213] -- 0:00:32
      506000 -- (-898.202) (-902.302) [-901.248] (-898.081) * (-898.038) (-899.864) (-902.567) [-897.082] -- 0:00:32
      506500 -- [-899.030] (-901.996) (-901.214) (-897.674) * [-898.516] (-898.313) (-898.225) (-900.120) -- 0:00:32
      507000 -- (-900.537) (-900.844) (-898.158) [-897.340] * (-901.319) (-899.748) [-900.339] (-898.318) -- 0:00:32
      507500 -- (-899.399) [-899.877] (-898.418) (-897.340) * (-899.433) (-900.863) [-899.796] (-899.039) -- 0:00:32
      508000 -- (-899.098) (-898.091) (-898.896) [-899.089] * (-898.635) (-898.189) (-898.657) [-897.891] -- 0:00:31
      508500 -- (-899.995) [-898.320] (-897.646) (-901.111) * (-897.918) (-898.503) [-904.856] (-899.847) -- 0:00:31
      509000 -- (-899.974) (-899.690) [-898.116] (-900.704) * [-898.066] (-900.681) (-900.803) (-898.344) -- 0:00:31
      509500 -- (-900.351) (-899.565) (-896.989) [-897.422] * (-898.077) (-900.970) (-900.449) [-898.180] -- 0:00:31
      510000 -- (-899.165) [-897.482] (-898.893) (-897.397) * (-898.166) [-900.425] (-898.072) (-900.311) -- 0:00:31

      Average standard deviation of split frequencies: 0.011020

      510500 -- [-901.113] (-898.195) (-898.342) (-900.084) * (-899.466) (-900.049) [-899.125] (-901.395) -- 0:00:31
      511000 -- (-899.604) (-899.520) [-897.357] (-898.212) * [-899.777] (-898.197) (-898.498) (-898.427) -- 0:00:31
      511500 -- (-898.812) (-898.798) (-898.250) [-899.994] * (-902.410) [-898.752] (-898.799) (-899.222) -- 0:00:31
      512000 -- (-898.646) (-899.674) [-898.014] (-904.964) * (-900.186) [-899.092] (-900.371) (-898.289) -- 0:00:31
      512500 -- (-901.589) [-900.070] (-899.931) (-901.029) * (-900.520) [-901.816] (-899.370) (-899.196) -- 0:00:31
      513000 -- [-899.753] (-900.945) (-897.695) (-899.070) * (-902.959) [-900.059] (-898.303) (-898.711) -- 0:00:31
      513500 -- (-899.209) (-899.409) [-898.102] (-898.814) * [-901.819] (-902.117) (-898.940) (-901.291) -- 0:00:32
      514000 -- (-898.989) (-899.746) (-897.735) [-897.722] * (-898.536) [-901.373] (-898.055) (-900.782) -- 0:00:32
      514500 -- (-898.551) [-900.815] (-901.287) (-908.846) * (-898.040) (-897.944) (-899.326) [-897.738] -- 0:00:32
      515000 -- [-900.700] (-898.038) (-904.751) (-902.371) * (-898.753) [-898.524] (-902.053) (-899.801) -- 0:00:32

      Average standard deviation of split frequencies: 0.010963

      515500 -- (-906.310) (-899.392) (-906.177) [-900.861] * (-897.056) [-898.721] (-900.337) (-898.876) -- 0:00:31
      516000 -- (-900.521) [-898.788] (-899.455) (-898.420) * (-897.577) (-898.704) [-899.982] (-899.093) -- 0:00:31
      516500 -- (-898.429) [-899.254] (-897.328) (-897.440) * (-900.813) [-898.421] (-897.495) (-899.516) -- 0:00:31
      517000 -- [-898.786] (-904.561) (-902.077) (-898.162) * (-898.869) [-899.686] (-905.576) (-898.530) -- 0:00:31
      517500 -- (-897.377) (-899.284) (-900.602) [-902.538] * (-900.567) (-899.134) (-901.600) [-899.370] -- 0:00:31
      518000 -- (-898.557) [-897.571] (-899.123) (-898.649) * (-900.541) (-899.581) (-902.210) [-900.274] -- 0:00:31
      518500 -- (-898.861) (-897.543) (-899.387) [-899.360] * (-898.048) (-899.053) (-900.117) [-900.432] -- 0:00:31
      519000 -- (-897.654) [-901.371] (-900.411) (-897.742) * (-900.075) (-899.005) (-900.917) [-899.936] -- 0:00:31
      519500 -- (-902.074) (-900.895) [-898.961] (-896.897) * [-897.906] (-898.933) (-900.935) (-902.324) -- 0:00:31
      520000 -- [-899.635] (-902.684) (-901.566) (-898.427) * (-897.626) [-898.798] (-898.600) (-899.507) -- 0:00:31

      Average standard deviation of split frequencies: 0.011131

      520500 -- (-899.910) [-899.497] (-897.819) (-896.916) * (-901.850) (-899.580) (-899.034) [-900.819] -- 0:00:31
      521000 -- [-899.328] (-899.517) (-898.070) (-897.319) * (-903.971) [-901.806] (-899.837) (-897.750) -- 0:00:31
      521500 -- (-898.885) (-898.223) [-897.821] (-897.292) * [-901.407] (-902.000) (-906.793) (-899.064) -- 0:00:31
      522000 -- [-899.306] (-897.773) (-898.369) (-900.954) * (-898.845) (-900.719) [-905.758] (-904.474) -- 0:00:31
      522500 -- (-900.431) (-903.675) [-898.830] (-900.072) * [-898.354] (-902.546) (-899.861) (-899.621) -- 0:00:31
      523000 -- (-898.235) [-900.700] (-898.975) (-897.940) * (-900.175) (-902.867) (-900.310) [-899.270] -- 0:00:31
      523500 -- (-897.979) (-897.380) (-898.796) [-897.998] * (-902.703) (-900.020) (-897.615) [-899.393] -- 0:00:30
      524000 -- (-897.339) [-899.222] (-898.276) (-899.676) * [-900.749] (-899.528) (-899.561) (-897.743) -- 0:00:30
      524500 -- (-899.296) (-899.394) [-900.719] (-898.782) * (-898.537) (-899.888) (-897.277) [-897.169] -- 0:00:30
      525000 -- (-898.787) [-899.432] (-902.007) (-897.853) * (-898.155) (-899.483) [-898.809] (-900.238) -- 0:00:30

      Average standard deviation of split frequencies: 0.011545

      525500 -- (-902.699) (-899.938) (-901.073) [-900.598] * (-901.140) (-899.063) [-898.589] (-898.225) -- 0:00:30
      526000 -- [-900.324] (-897.868) (-902.227) (-897.641) * [-898.697] (-900.746) (-902.975) (-898.976) -- 0:00:30
      526500 -- (-903.056) [-901.398] (-899.546) (-899.578) * (-898.743) (-899.354) (-900.129) [-898.617] -- 0:00:30
      527000 -- (-897.556) [-902.002] (-901.942) (-898.045) * (-899.560) (-898.530) [-899.997] (-899.370) -- 0:00:30
      527500 -- [-897.801] (-898.508) (-900.820) (-897.953) * (-898.129) (-896.811) [-900.150] (-899.367) -- 0:00:30
      528000 -- (-899.103) (-897.579) [-898.711] (-897.760) * (-897.192) (-898.334) (-897.484) [-909.901] -- 0:00:30
      528500 -- [-898.665] (-899.556) (-898.887) (-898.352) * (-898.372) [-898.651] (-899.112) (-899.559) -- 0:00:30
      529000 -- (-902.937) (-899.822) (-898.892) [-897.120] * (-898.439) [-899.377] (-903.857) (-898.161) -- 0:00:30
      529500 -- (-901.774) (-898.135) [-900.582] (-898.242) * (-902.026) [-897.907] (-897.970) (-897.750) -- 0:00:30
      530000 -- (-900.944) (-899.211) (-898.574) [-899.323] * (-897.176) (-902.253) [-899.929] (-899.009) -- 0:00:31

      Average standard deviation of split frequencies: 0.011235

      530500 -- (-899.045) [-901.194] (-897.628) (-900.055) * (-898.085) (-899.172) (-901.059) [-898.517] -- 0:00:30
      531000 -- (-898.496) [-898.592] (-897.611) (-898.962) * (-898.420) (-898.508) [-898.987] (-900.185) -- 0:00:30
      531500 -- (-899.231) [-897.992] (-901.192) (-899.839) * (-898.885) (-898.165) [-902.312] (-898.210) -- 0:00:30
      532000 -- [-901.816] (-898.871) (-901.023) (-901.331) * (-898.469) (-901.291) [-898.449] (-904.320) -- 0:00:30
      532500 -- [-901.381] (-900.494) (-904.121) (-900.852) * (-899.984) (-901.238) (-898.325) [-898.637] -- 0:00:30
      533000 -- (-897.563) (-901.824) (-900.416) [-900.624] * (-898.906) (-901.885) (-901.206) [-898.943] -- 0:00:30
      533500 -- (-903.558) (-901.779) (-899.539) [-899.281] * (-900.439) [-899.084] (-899.350) (-897.580) -- 0:00:30
      534000 -- [-899.617] (-900.592) (-897.233) (-898.545) * (-900.567) (-898.551) [-898.273] (-900.636) -- 0:00:30
      534500 -- (-903.965) [-900.484] (-898.572) (-898.125) * [-900.439] (-900.211) (-898.461) (-897.927) -- 0:00:30
      535000 -- (-899.787) [-897.947] (-899.995) (-897.607) * (-897.762) (-898.948) (-899.477) [-898.625] -- 0:00:30

      Average standard deviation of split frequencies: 0.010761

      535500 -- (-900.554) (-898.438) [-897.707] (-898.691) * (-899.440) (-899.262) (-902.505) [-898.329] -- 0:00:30
      536000 -- (-898.275) (-897.939) (-900.795) [-897.861] * (-898.094) (-898.956) [-899.054] (-899.141) -- 0:00:30
      536500 -- (-897.772) (-898.186) [-897.870] (-904.662) * (-899.058) (-898.931) [-898.987] (-897.492) -- 0:00:30
      537000 -- (-900.849) [-899.224] (-898.346) (-899.250) * [-900.218] (-899.734) (-900.778) (-899.922) -- 0:00:30
      537500 -- (-900.419) [-897.151] (-897.491) (-899.439) * (-900.302) [-899.347] (-899.006) (-900.313) -- 0:00:30
      538000 -- (-900.354) [-899.343] (-897.183) (-898.627) * [-899.965] (-906.038) (-902.935) (-899.729) -- 0:00:30
      538500 -- (-898.875) (-902.001) [-898.606] (-902.041) * (-900.546) (-902.761) [-897.475] (-898.325) -- 0:00:29
      539000 -- (-899.211) (-898.915) [-899.224] (-897.953) * [-903.999] (-898.273) (-897.502) (-901.025) -- 0:00:29
      539500 -- (-899.791) [-898.809] (-898.840) (-898.425) * (-899.458) (-899.263) (-897.272) [-899.111] -- 0:00:29
      540000 -- [-898.344] (-899.687) (-898.112) (-897.901) * (-898.320) (-901.670) [-899.813] (-901.917) -- 0:00:29

      Average standard deviation of split frequencies: 0.010408

      540500 -- (-904.256) [-899.222] (-899.256) (-898.740) * [-899.962] (-900.666) (-897.201) (-901.528) -- 0:00:29
      541000 -- (-898.311) [-898.587] (-899.153) (-903.662) * (-899.321) [-898.791] (-901.940) (-899.208) -- 0:00:29
      541500 -- (-899.197) (-897.664) [-897.731] (-898.723) * (-901.910) (-901.086) (-901.295) [-897.670] -- 0:00:29
      542000 -- (-900.786) (-898.512) [-897.069] (-898.069) * (-900.897) (-898.772) (-897.251) [-898.684] -- 0:00:29
      542500 -- (-901.008) (-900.496) (-897.446) [-897.838] * [-898.949] (-898.627) (-897.753) (-898.460) -- 0:00:29
      543000 -- (-901.008) (-902.325) [-897.215] (-897.930) * (-899.696) [-899.170] (-900.769) (-899.234) -- 0:00:29
      543500 -- (-900.957) (-898.548) [-898.404] (-898.246) * [-899.497] (-900.326) (-897.674) (-900.145) -- 0:00:29
      544000 -- (-898.013) (-898.009) (-898.606) [-897.912] * [-898.992] (-897.740) (-900.833) (-902.473) -- 0:00:29
      544500 -- (-899.694) (-898.062) (-901.444) [-898.113] * (-899.123) (-899.417) (-901.116) [-899.641] -- 0:00:29
      545000 -- (-898.060) (-901.849) (-903.795) [-897.534] * [-897.951] (-900.811) (-906.157) (-899.322) -- 0:00:29

      Average standard deviation of split frequencies: 0.011376

      545500 -- [-898.219] (-899.694) (-900.800) (-899.930) * (-902.358) (-898.482) [-902.250] (-898.377) -- 0:00:29
      546000 -- (-898.114) (-898.705) (-902.020) [-897.158] * [-901.913] (-899.966) (-899.433) (-898.854) -- 0:00:29
      546500 -- (-898.674) [-902.925] (-899.223) (-899.560) * (-898.794) (-897.461) (-899.925) [-898.546] -- 0:00:29
      547000 -- [-898.974] (-899.404) (-898.441) (-898.425) * (-900.478) [-898.171] (-898.830) (-902.548) -- 0:00:29
      547500 -- (-901.182) (-898.410) [-897.349] (-898.425) * (-897.938) (-898.952) [-898.290] (-899.463) -- 0:00:29
      548000 -- [-903.059] (-898.756) (-897.838) (-900.840) * (-906.121) (-898.902) [-898.175] (-899.054) -- 0:00:29
      548500 -- [-902.637] (-903.557) (-898.649) (-898.101) * [-898.198] (-898.068) (-900.493) (-897.725) -- 0:00:29
      549000 -- [-901.709] (-902.529) (-906.050) (-898.141) * [-898.422] (-898.575) (-900.235) (-898.072) -- 0:00:29
      549500 -- (-897.754) (-905.434) (-906.840) [-898.182] * [-897.555] (-901.332) (-899.611) (-897.968) -- 0:00:29
      550000 -- [-897.359] (-901.461) (-897.596) (-904.022) * [-898.688] (-899.851) (-901.463) (-898.938) -- 0:00:29

      Average standard deviation of split frequencies: 0.011431

      550500 -- [-897.457] (-903.214) (-898.697) (-899.752) * (-898.443) [-898.724] (-901.290) (-903.937) -- 0:00:29
      551000 -- (-898.127) (-900.311) (-898.697) [-900.258] * (-899.980) [-897.567] (-897.866) (-899.731) -- 0:00:29
      551500 -- (-902.199) [-898.557] (-897.761) (-899.209) * (-898.137) [-900.714] (-898.428) (-900.878) -- 0:00:29
      552000 -- (-901.962) (-899.177) [-898.015] (-899.862) * (-899.332) [-899.412] (-897.353) (-898.785) -- 0:00:29
      552500 -- (-901.784) (-897.817) (-901.200) [-898.436] * (-897.153) (-899.253) [-897.113] (-900.632) -- 0:00:29
      553000 -- (-905.277) (-897.508) (-899.876) [-898.803] * (-897.529) (-900.572) [-897.720] (-903.962) -- 0:00:29
      553500 -- (-899.674) [-899.117] (-901.776) (-902.578) * (-899.278) [-901.094] (-899.087) (-898.991) -- 0:00:29
      554000 -- (-902.516) (-898.088) (-898.294) [-901.775] * (-898.366) (-903.700) [-897.085] (-904.457) -- 0:00:28
      554500 -- [-898.791] (-901.703) (-899.459) (-899.786) * (-899.370) (-901.151) (-900.553) [-898.903] -- 0:00:28
      555000 -- [-900.178] (-897.342) (-898.240) (-897.981) * (-897.854) (-899.654) [-899.058] (-900.431) -- 0:00:28

      Average standard deviation of split frequencies: 0.011552

      555500 -- (-902.522) (-902.720) [-899.388] (-898.847) * (-897.232) (-898.895) (-902.083) [-900.138] -- 0:00:28
      556000 -- [-899.729] (-898.922) (-899.557) (-899.572) * (-901.586) (-900.003) (-901.585) [-902.035] -- 0:00:28
      556500 -- (-899.633) (-899.802) (-900.287) [-897.739] * (-901.340) [-897.944] (-898.484) (-898.650) -- 0:00:28
      557000 -- (-903.219) (-899.329) (-902.239) [-898.017] * (-900.794) (-898.834) [-897.842] (-899.017) -- 0:00:28
      557500 -- (-904.015) (-898.501) (-898.379) [-897.252] * (-899.500) [-897.672] (-897.592) (-898.704) -- 0:00:28
      558000 -- (-901.366) [-898.683] (-902.208) (-902.536) * (-898.348) [-897.845] (-897.589) (-900.211) -- 0:00:28
      558500 -- [-897.392] (-900.050) (-898.564) (-899.509) * [-897.759] (-906.263) (-898.103) (-900.771) -- 0:00:28
      559000 -- (-898.654) (-898.374) [-898.036] (-898.871) * (-899.116) [-898.035] (-897.667) (-897.872) -- 0:00:28
      559500 -- (-900.362) (-900.819) [-899.844] (-899.229) * (-899.655) (-899.901) [-897.908] (-898.294) -- 0:00:28
      560000 -- (-907.594) [-898.520] (-899.534) (-897.565) * (-901.529) (-899.896) (-902.634) [-898.966] -- 0:00:28

      Average standard deviation of split frequencies: 0.010650

      560500 -- [-902.818] (-899.667) (-897.756) (-900.497) * (-899.520) [-898.464] (-898.604) (-897.405) -- 0:00:28
      561000 -- (-900.513) [-901.062] (-897.339) (-901.033) * [-901.053] (-899.885) (-900.071) (-898.615) -- 0:00:28
      561500 -- (-903.560) (-899.774) (-897.913) [-900.470] * (-900.782) [-903.416] (-898.053) (-898.898) -- 0:00:28
      562000 -- (-898.780) [-897.508] (-897.794) (-900.196) * [-899.530] (-903.036) (-897.810) (-899.851) -- 0:00:28
      562500 -- [-899.394] (-898.561) (-897.194) (-899.154) * (-900.856) (-897.120) (-897.424) [-904.487] -- 0:00:28
      563000 -- [-899.651] (-898.139) (-901.200) (-897.119) * (-900.686) (-897.441) (-899.675) [-899.056] -- 0:00:28
      563500 -- (-897.783) (-898.874) (-902.273) [-898.989] * (-898.989) [-897.244] (-903.667) (-898.875) -- 0:00:28
      564000 -- (-897.635) [-897.944] (-897.402) (-901.453) * (-898.629) [-897.537] (-898.960) (-898.493) -- 0:00:28
      564500 -- (-901.231) (-900.550) [-897.217] (-898.189) * (-897.915) (-900.196) [-900.764] (-903.417) -- 0:00:28
      565000 -- (-898.870) [-901.705] (-898.625) (-900.166) * (-900.003) (-900.437) (-900.697) [-901.057] -- 0:00:28

      Average standard deviation of split frequencies: 0.010328

      565500 -- (-898.332) (-902.837) (-899.377) [-897.607] * (-899.703) [-897.914] (-900.996) (-899.285) -- 0:00:28
      566000 -- (-898.737) [-898.124] (-900.217) (-901.522) * (-900.506) [-896.950] (-899.198) (-899.170) -- 0:00:28
      566500 -- (-900.511) (-898.340) [-899.304] (-899.436) * [-899.010] (-896.987) (-904.064) (-898.758) -- 0:00:28
      567000 -- (-899.853) (-897.279) [-899.040] (-898.144) * (-898.828) (-901.815) [-903.030] (-898.655) -- 0:00:28
      567500 -- (-899.447) (-902.600) (-898.718) [-899.413] * (-898.699) (-901.256) (-899.156) [-902.088] -- 0:00:28
      568000 -- [-901.655] (-898.739) (-899.328) (-898.036) * (-903.583) (-899.474) [-899.642] (-899.650) -- 0:00:28
      568500 -- (-900.703) [-898.036] (-898.810) (-898.232) * (-899.006) (-897.936) [-904.874] (-899.253) -- 0:00:28
      569000 -- (-900.225) [-898.048] (-901.868) (-900.261) * (-897.481) (-900.669) (-898.393) [-899.292] -- 0:00:28
      569500 -- (-899.299) (-899.930) [-897.679] (-900.958) * (-897.115) (-900.930) [-897.667] (-898.560) -- 0:00:27
      570000 -- [-898.930] (-901.773) (-899.779) (-897.503) * (-899.986) (-900.088) (-898.187) [-899.941] -- 0:00:27

      Average standard deviation of split frequencies: 0.009858

      570500 -- (-898.728) (-899.528) (-899.169) [-898.524] * (-899.615) [-899.066] (-897.804) (-900.104) -- 0:00:27
      571000 -- (-898.113) [-898.024] (-901.386) (-899.280) * (-900.249) [-897.982] (-899.427) (-897.759) -- 0:00:27
      571500 -- (-898.478) (-899.434) (-898.709) [-897.550] * (-898.939) (-898.304) [-899.709] (-902.717) -- 0:00:27
      572000 -- (-898.554) (-899.440) [-900.039] (-900.962) * [-898.036] (-897.859) (-898.945) (-900.117) -- 0:00:27
      572500 -- (-900.671) (-897.667) (-900.218) [-899.340] * (-903.650) [-899.328] (-898.035) (-898.754) -- 0:00:27
      573000 -- (-902.495) (-900.049) [-897.188] (-897.185) * (-900.251) (-902.076) (-910.086) [-900.764] -- 0:00:27
      573500 -- [-898.631] (-898.999) (-898.295) (-897.737) * (-899.215) [-899.612] (-901.486) (-899.249) -- 0:00:27
      574000 -- (-899.461) (-898.424) [-898.394] (-901.704) * (-898.236) (-899.653) (-901.711) [-898.408] -- 0:00:27
      574500 -- [-900.502] (-901.169) (-898.858) (-902.184) * (-900.631) (-899.249) (-903.114) [-898.305] -- 0:00:27
      575000 -- (-899.078) (-903.902) [-898.393] (-902.987) * [-898.556] (-899.452) (-898.142) (-897.696) -- 0:00:27

      Average standard deviation of split frequencies: 0.009207

      575500 -- (-898.872) (-899.667) [-898.119] (-900.764) * (-897.587) (-897.811) [-899.083] (-898.006) -- 0:00:27
      576000 -- (-901.005) (-899.886) [-898.723] (-900.960) * (-899.779) [-902.111] (-899.483) (-898.389) -- 0:00:27
      576500 -- (-898.472) (-899.748) [-903.829] (-898.048) * (-897.381) [-900.256] (-899.194) (-902.050) -- 0:00:27
      577000 -- (-898.523) (-898.838) [-901.108] (-901.227) * (-897.377) [-900.069] (-897.871) (-899.947) -- 0:00:27
      577500 -- (-900.682) (-898.860) [-897.416] (-902.346) * (-898.097) (-901.595) [-897.289] (-903.037) -- 0:00:27
      578000 -- [-898.787] (-898.922) (-898.308) (-899.347) * (-898.514) (-901.601) [-899.876] (-899.980) -- 0:00:27
      578500 -- (-897.543) (-899.573) (-899.430) [-898.604] * [-899.474] (-899.235) (-898.661) (-900.473) -- 0:00:27
      579000 -- (-897.387) (-904.359) [-899.104] (-897.991) * (-901.204) [-900.785] (-898.896) (-899.634) -- 0:00:27
      579500 -- (-897.284) [-899.315] (-898.863) (-901.048) * (-903.110) [-898.455] (-898.139) (-897.684) -- 0:00:27
      580000 -- [-899.531] (-898.578) (-899.601) (-900.246) * [-897.578] (-897.600) (-898.347) (-898.482) -- 0:00:27

      Average standard deviation of split frequencies: 0.009438

      580500 -- [-900.108] (-898.848) (-897.721) (-899.149) * (-897.996) (-901.448) (-898.087) [-898.123] -- 0:00:27
      581000 -- (-901.281) [-897.942] (-898.453) (-898.287) * (-899.687) [-900.118] (-899.704) (-900.566) -- 0:00:27
      581500 -- (-898.812) (-898.045) (-899.003) [-901.714] * (-901.058) (-901.392) [-899.178] (-899.081) -- 0:00:27
      582000 -- (-902.606) (-898.335) [-900.353] (-900.207) * (-903.335) [-898.739] (-898.507) (-899.281) -- 0:00:27
      582500 -- (-901.378) (-901.384) [-898.316] (-900.318) * (-900.481) (-899.822) (-899.253) [-900.034] -- 0:00:27
      583000 -- (-898.332) (-899.741) (-899.271) [-898.295] * (-899.255) (-901.001) [-901.930] (-898.588) -- 0:00:27
      583500 -- (-900.208) [-902.488] (-899.296) (-897.447) * (-899.948) (-898.251) (-898.667) [-898.924] -- 0:00:27
      584000 -- (-898.992) (-898.804) [-897.392] (-897.081) * [-897.682] (-899.647) (-901.635) (-903.251) -- 0:00:27
      584500 -- [-897.824] (-897.935) (-897.516) (-902.333) * [-897.840] (-898.180) (-898.545) (-907.630) -- 0:00:27
      585000 -- [-897.887] (-898.309) (-899.570) (-901.381) * [-900.957] (-898.088) (-901.467) (-901.848) -- 0:00:26

      Average standard deviation of split frequencies: 0.009600

      585500 -- (-897.026) (-898.625) (-899.761) [-897.509] * (-902.354) (-897.621) (-898.986) [-900.250] -- 0:00:26
      586000 -- [-897.157] (-898.342) (-900.006) (-901.786) * [-901.596] (-899.459) (-901.783) (-905.954) -- 0:00:26
      586500 -- (-897.355) (-903.670) [-900.303] (-902.563) * [-902.425] (-899.248) (-900.399) (-904.839) -- 0:00:26
      587000 -- (-901.461) (-901.668) (-900.265) [-900.732] * (-900.780) [-900.371] (-901.186) (-903.565) -- 0:00:26
      587500 -- [-900.007] (-898.314) (-899.554) (-900.772) * (-900.572) (-903.212) [-898.326] (-898.808) -- 0:00:26
      588000 -- [-897.444] (-898.021) (-899.095) (-901.514) * [-900.871] (-900.295) (-898.562) (-899.194) -- 0:00:26
      588500 -- (-897.256) [-897.719] (-898.794) (-898.885) * (-901.919) (-900.859) (-898.232) [-899.289] -- 0:00:26
      589000 -- (-900.244) [-899.066] (-897.208) (-900.363) * [-901.473] (-899.781) (-900.180) (-902.285) -- 0:00:26
      589500 -- (-902.933) (-900.273) (-897.659) [-899.621] * (-900.873) [-900.443] (-900.783) (-900.990) -- 0:00:26
      590000 -- [-899.219] (-901.567) (-897.916) (-899.707) * (-899.633) (-901.505) [-898.779] (-898.983) -- 0:00:26

      Average standard deviation of split frequencies: 0.009471

      590500 -- [-899.329] (-897.276) (-898.613) (-899.515) * (-898.239) [-898.898] (-900.691) (-899.398) -- 0:00:26
      591000 -- (-898.578) [-899.930] (-898.456) (-899.688) * (-899.198) [-899.692] (-900.347) (-900.195) -- 0:00:26
      591500 -- [-897.226] (-897.184) (-901.460) (-900.612) * (-901.174) [-897.891] (-900.170) (-900.976) -- 0:00:26
      592000 -- [-898.037] (-897.212) (-901.364) (-898.542) * (-897.964) (-898.865) (-900.261) [-899.855] -- 0:00:26
      592500 -- [-897.663] (-899.578) (-902.208) (-901.228) * (-898.061) (-897.727) (-899.630) [-898.176] -- 0:00:26
      593000 -- (-899.510) (-899.280) [-897.643] (-901.766) * [-898.642] (-897.948) (-903.770) (-898.491) -- 0:00:26
      593500 -- (-899.971) (-899.641) [-898.760] (-898.726) * (-899.881) (-897.821) [-898.602] (-901.060) -- 0:00:26
      594000 -- [-899.661] (-899.607) (-899.231) (-904.389) * (-897.310) (-898.182) [-900.002] (-898.753) -- 0:00:25
      594500 -- [-896.982] (-899.106) (-898.388) (-902.813) * (-900.906) (-899.285) [-899.325] (-899.835) -- 0:00:25
      595000 -- [-896.959] (-897.620) (-899.815) (-902.770) * (-901.327) [-904.999] (-897.487) (-898.438) -- 0:00:26

      Average standard deviation of split frequencies: 0.009491

      595500 -- (-898.144) (-898.213) (-898.277) [-900.542] * (-897.652) (-900.776) (-900.477) [-899.343] -- 0:00:26
      596000 -- (-897.936) (-898.275) (-897.506) [-900.520] * (-899.613) (-897.620) [-899.499] (-897.893) -- 0:00:26
      596500 -- (-897.304) (-900.454) (-898.757) [-901.003] * (-901.866) (-898.159) [-898.887] (-898.605) -- 0:00:26
      597000 -- [-897.496] (-899.939) (-899.759) (-901.963) * (-903.197) [-898.947] (-899.556) (-897.627) -- 0:00:26
      597500 -- (-899.764) [-898.253] (-898.378) (-899.639) * (-906.265) [-897.145] (-899.877) (-897.526) -- 0:00:26
      598000 -- (-900.460) [-899.953] (-896.967) (-901.022) * (-898.355) [-897.793] (-899.074) (-897.493) -- 0:00:26
      598500 -- (-902.006) (-901.155) [-897.590] (-898.044) * [-899.276] (-901.379) (-899.263) (-897.838) -- 0:00:26
      599000 -- (-899.680) (-898.072) (-897.718) [-899.938] * (-898.687) (-898.917) (-898.438) [-897.628] -- 0:00:26
      599500 -- (-898.442) [-899.774] (-899.517) (-902.391) * (-898.084) (-899.075) [-899.383] (-900.519) -- 0:00:26
      600000 -- (-898.828) (-899.433) [-899.514] (-899.724) * (-898.582) [-899.502] (-898.355) (-900.016) -- 0:00:25

      Average standard deviation of split frequencies: 0.009679

      600500 -- [-903.555] (-898.891) (-897.662) (-900.970) * (-898.467) (-899.739) (-899.847) [-899.068] -- 0:00:25
      601000 -- (-902.434) (-897.301) (-900.532) [-901.417] * (-898.357) (-898.959) [-898.245] (-898.694) -- 0:00:25
      601500 -- (-905.081) [-898.742] (-903.606) (-901.207) * (-897.642) [-897.564] (-898.700) (-901.667) -- 0:00:25
      602000 -- (-898.890) (-899.572) (-901.536) [-898.123] * (-901.075) (-898.682) (-897.937) [-897.965] -- 0:00:25
      602500 -- (-902.252) [-897.774] (-898.188) (-900.543) * (-899.978) [-900.780] (-897.725) (-897.122) -- 0:00:25
      603000 -- (-908.311) [-897.490] (-899.721) (-900.131) * (-900.014) [-899.114] (-898.388) (-898.676) -- 0:00:25
      603500 -- (-898.330) (-899.852) [-897.593] (-903.165) * [-898.439] (-897.783) (-897.789) (-901.766) -- 0:00:25
      604000 -- (-897.995) [-898.902] (-899.844) (-902.807) * [-899.373] (-897.028) (-899.227) (-899.228) -- 0:00:25
      604500 -- (-900.082) [-900.782] (-898.265) (-897.771) * (-897.390) (-897.854) [-898.116] (-898.854) -- 0:00:25
      605000 -- (-899.194) [-901.260] (-898.071) (-897.314) * [-897.406] (-897.887) (-897.276) (-897.935) -- 0:00:25

      Average standard deviation of split frequencies: 0.009594

      605500 -- (-900.111) (-902.412) [-902.752] (-897.702) * (-899.871) (-897.889) [-896.927] (-898.419) -- 0:00:25
      606000 -- (-897.452) (-902.945) [-898.239] (-897.952) * [-898.942] (-899.143) (-897.907) (-898.231) -- 0:00:25
      606500 -- (-897.995) (-902.460) (-898.640) [-897.697] * (-900.963) [-901.634] (-905.469) (-899.757) -- 0:00:25
      607000 -- (-898.889) (-906.289) [-899.111] (-898.537) * (-898.587) (-898.438) [-900.408] (-900.373) -- 0:00:25
      607500 -- (-900.198) (-897.445) [-899.134] (-899.430) * (-897.349) (-902.717) (-902.045) [-901.891] -- 0:00:25
      608000 -- (-901.966) [-900.459] (-897.904) (-900.259) * (-901.501) (-898.859) (-900.000) [-902.590] -- 0:00:25
      608500 -- [-896.943] (-899.713) (-904.931) (-902.566) * (-898.964) (-901.067) (-898.010) [-901.956] -- 0:00:25
      609000 -- (-898.695) [-899.322] (-897.190) (-900.460) * [-902.659] (-901.565) (-897.209) (-898.936) -- 0:00:25
      609500 -- (-898.633) (-901.279) [-898.518] (-900.047) * (-903.894) (-900.025) (-898.518) [-898.833] -- 0:00:24
      610000 -- (-902.422) (-898.787) (-900.374) [-905.361] * (-902.934) (-902.755) [-900.778] (-898.909) -- 0:00:24

      Average standard deviation of split frequencies: 0.009881

      610500 -- [-900.573] (-897.660) (-898.479) (-901.019) * (-899.273) (-899.739) (-902.332) [-897.820] -- 0:00:24
      611000 -- (-902.525) [-899.021] (-901.962) (-900.739) * (-897.546) (-902.769) (-899.878) [-897.053] -- 0:00:25
      611500 -- (-900.850) (-899.020) [-897.857] (-902.350) * (-897.494) (-902.389) (-898.797) [-899.834] -- 0:00:25
      612000 -- (-902.270) [-904.068] (-897.701) (-898.732) * (-899.101) [-899.631] (-899.693) (-899.381) -- 0:00:25
      612500 -- (-900.008) (-900.654) [-897.768] (-899.382) * [-898.497] (-898.217) (-900.377) (-899.791) -- 0:00:25
      613000 -- (-897.967) [-900.132] (-904.587) (-899.432) * (-898.532) (-901.076) [-898.692] (-901.350) -- 0:00:25
      613500 -- (-897.967) (-902.193) (-902.528) [-902.867] * (-897.845) (-901.347) [-900.781] (-899.138) -- 0:00:25
      614000 -- (-899.000) [-897.838] (-906.406) (-897.857) * (-897.965) (-898.898) (-899.826) [-899.636] -- 0:00:25
      614500 -- (-899.460) (-899.655) [-898.165] (-898.095) * [-899.108] (-907.434) (-900.767) (-901.028) -- 0:00:25
      615000 -- [-900.136] (-897.760) (-898.915) (-903.011) * [-898.908] (-903.823) (-898.180) (-905.115) -- 0:00:25

      Average standard deviation of split frequencies: 0.010204

      615500 -- (-898.033) (-901.176) (-900.075) [-899.937] * (-899.829) (-902.361) (-902.257) [-898.441] -- 0:00:24
      616000 -- [-899.448] (-898.495) (-898.190) (-900.718) * (-900.229) (-901.552) (-898.271) [-901.345] -- 0:00:24
      616500 -- (-898.149) (-898.053) [-899.797] (-901.302) * (-901.828) [-901.705] (-900.434) (-900.780) -- 0:00:24
      617000 -- (-899.970) (-900.059) [-898.938] (-898.244) * (-902.409) [-898.989] (-900.666) (-899.477) -- 0:00:24
      617500 -- [-900.075] (-897.717) (-901.460) (-900.597) * (-898.501) [-900.406] (-903.486) (-898.014) -- 0:00:24
      618000 -- (-900.440) [-898.545] (-900.705) (-897.328) * (-899.363) (-897.798) [-898.676] (-900.213) -- 0:00:24
      618500 -- (-898.716) (-901.928) (-897.965) [-897.354] * [-897.409] (-897.171) (-898.997) (-899.319) -- 0:00:24
      619000 -- [-898.945] (-903.104) (-900.749) (-899.088) * (-899.514) [-898.531] (-898.876) (-901.277) -- 0:00:24
      619500 -- [-899.805] (-903.101) (-899.397) (-900.423) * [-898.255] (-898.044) (-900.222) (-898.412) -- 0:00:24
      620000 -- (-899.841) (-902.675) [-898.265] (-898.328) * (-899.411) (-900.509) (-897.532) [-897.160] -- 0:00:24

      Average standard deviation of split frequencies: 0.009772

      620500 -- (-898.011) (-902.095) [-899.525] (-897.619) * (-898.610) (-898.932) (-898.063) [-897.281] -- 0:00:24
      621000 -- (-898.636) (-900.449) (-898.273) [-898.598] * [-899.085] (-897.872) (-898.434) (-897.931) -- 0:00:24
      621500 -- [-897.587] (-900.796) (-901.490) (-900.282) * [-897.043] (-899.121) (-899.204) (-897.589) -- 0:00:24
      622000 -- (-897.583) (-900.638) [-903.940] (-900.702) * (-898.895) [-902.401] (-897.001) (-898.356) -- 0:00:24
      622500 -- (-899.462) (-899.037) [-900.136] (-897.966) * (-898.800) (-898.366) [-898.395] (-898.209) -- 0:00:24
      623000 -- [-899.633] (-899.291) (-897.627) (-899.101) * (-898.562) (-898.094) [-898.696] (-898.802) -- 0:00:24
      623500 -- (-898.457) (-899.072) [-899.677] (-898.696) * (-899.545) (-900.599) (-897.880) [-899.153] -- 0:00:24
      624000 -- (-902.176) (-899.705) (-903.523) [-899.139] * [-898.834] (-899.919) (-898.075) (-898.704) -- 0:00:24
      624500 -- [-901.599] (-901.421) (-904.048) (-900.682) * [-899.134] (-900.897) (-901.838) (-899.094) -- 0:00:24
      625000 -- (-903.112) [-898.472] (-906.859) (-899.519) * [-898.337] (-898.831) (-898.700) (-899.030) -- 0:00:24

      Average standard deviation of split frequencies: 0.009739

      625500 -- (-905.623) [-898.812] (-902.246) (-899.631) * (-902.621) [-903.852] (-901.102) (-901.864) -- 0:00:23
      626000 -- (-898.480) (-897.923) (-904.781) [-898.930] * (-899.913) (-899.832) (-901.240) [-902.915] -- 0:00:23
      626500 -- (-897.892) [-897.858] (-899.538) (-900.346) * (-898.171) [-898.147] (-897.790) (-900.341) -- 0:00:23
      627000 -- (-899.587) [-899.710] (-898.584) (-902.101) * (-900.492) (-898.719) [-897.895] (-899.719) -- 0:00:24
      627500 -- (-899.837) (-899.044) (-899.080) [-900.911] * [-897.624] (-899.296) (-898.169) (-898.298) -- 0:00:24
      628000 -- (-898.803) (-899.508) (-899.004) [-900.808] * [-897.973] (-898.145) (-898.499) (-898.482) -- 0:00:24
      628500 -- (-897.609) [-899.487] (-900.802) (-897.759) * (-897.427) (-899.347) [-904.560] (-899.360) -- 0:00:24
      629000 -- (-897.070) (-898.813) (-898.791) [-898.754] * [-898.896] (-899.270) (-899.336) (-910.333) -- 0:00:24
      629500 -- (-899.383) [-899.797] (-897.219) (-898.791) * [-900.211] (-900.069) (-897.400) (-898.307) -- 0:00:24
      630000 -- [-897.470] (-899.678) (-902.340) (-900.050) * (-899.885) (-900.016) [-898.156] (-902.427) -- 0:00:24

      Average standard deviation of split frequencies: 0.010278

      630500 -- (-898.312) [-899.312] (-903.983) (-900.966) * (-899.114) (-898.557) (-898.902) [-901.795] -- 0:00:24
      631000 -- (-899.466) (-899.859) (-899.537) [-900.750] * [-901.251] (-897.917) (-900.753) (-903.839) -- 0:00:23
      631500 -- [-898.198] (-898.229) (-901.079) (-898.331) * [-896.945] (-896.987) (-905.161) (-902.542) -- 0:00:23
      632000 -- [-899.855] (-898.961) (-898.750) (-899.034) * (-899.594) [-897.698] (-902.373) (-897.356) -- 0:00:23
      632500 -- (-899.661) (-899.315) [-900.636] (-900.453) * [-898.369] (-899.629) (-899.989) (-900.051) -- 0:00:23
      633000 -- [-901.084] (-899.252) (-901.789) (-900.816) * (-897.968) [-898.864] (-898.256) (-899.816) -- 0:00:23
      633500 -- [-897.712] (-897.228) (-900.326) (-900.305) * [-898.887] (-902.162) (-898.173) (-899.947) -- 0:00:23
      634000 -- (-897.231) (-899.257) [-899.490] (-897.692) * [-897.711] (-899.715) (-897.944) (-899.129) -- 0:00:23
      634500 -- (-897.209) (-900.800) [-899.119] (-899.547) * [-897.144] (-898.638) (-898.296) (-905.764) -- 0:00:23
      635000 -- (-897.119) (-903.166) [-900.362] (-897.490) * [-897.234] (-902.092) (-898.177) (-898.446) -- 0:00:23

      Average standard deviation of split frequencies: 0.010031

      635500 -- [-899.633] (-900.946) (-899.233) (-899.777) * (-897.917) [-899.549] (-897.338) (-900.045) -- 0:00:23
      636000 -- [-902.739] (-898.395) (-899.793) (-899.216) * [-900.367] (-898.920) (-897.950) (-897.981) -- 0:00:23
      636500 -- (-902.428) (-901.437) (-901.701) [-897.946] * (-898.617) (-898.703) [-898.463] (-898.022) -- 0:00:23
      637000 -- (-900.753) [-898.244] (-900.359) (-900.592) * [-899.993] (-898.120) (-899.290) (-901.922) -- 0:00:23
      637500 -- (-903.158) [-897.822] (-902.136) (-901.378) * [-897.576] (-898.199) (-897.740) (-904.937) -- 0:00:23
      638000 -- (-898.640) (-900.847) (-898.165) [-899.372] * (-897.371) (-897.539) (-898.958) [-903.700] -- 0:00:23
      638500 -- (-898.014) [-897.874] (-898.854) (-897.394) * [-902.540] (-896.826) (-898.838) (-898.773) -- 0:00:23
      639000 -- [-897.427] (-897.959) (-902.859) (-897.480) * (-897.852) [-897.545] (-906.600) (-903.745) -- 0:00:23
      639500 -- (-898.802) [-901.021] (-899.542) (-898.853) * (-898.462) (-899.059) [-897.487] (-898.615) -- 0:00:23
      640000 -- [-900.337] (-902.239) (-903.091) (-898.540) * [-898.535] (-900.936) (-900.671) (-897.968) -- 0:00:23

      Average standard deviation of split frequencies: 0.009811

      640500 -- (-898.734) [-899.321] (-903.486) (-898.726) * [-899.903] (-898.993) (-898.078) (-900.754) -- 0:00:23
      641000 -- [-898.130] (-900.942) (-901.241) (-898.085) * (-903.599) [-900.949] (-897.946) (-899.017) -- 0:00:22
      641500 -- (-898.549) [-900.427] (-900.567) (-898.989) * (-899.274) [-899.328] (-901.027) (-900.881) -- 0:00:22
      642000 -- (-898.280) (-902.967) (-897.991) [-899.450] * (-898.822) (-902.296) [-897.635] (-897.298) -- 0:00:22
      642500 -- [-902.814] (-902.944) (-897.615) (-897.155) * [-901.945] (-897.787) (-897.446) (-898.189) -- 0:00:22
      643000 -- (-897.868) (-901.316) (-897.887) [-899.191] * (-906.240) [-898.944] (-899.474) (-900.203) -- 0:00:22
      643500 -- (-899.332) [-900.278] (-899.123) (-898.347) * (-898.207) (-898.180) (-899.647) [-901.174] -- 0:00:23
      644000 -- (-898.299) [-898.154] (-898.856) (-901.094) * (-897.390) [-898.161] (-898.773) (-902.544) -- 0:00:23
      644500 -- (-900.299) (-898.280) (-898.841) [-898.458] * (-897.726) (-899.855) [-897.889] (-900.965) -- 0:00:23
      645000 -- [-898.841] (-900.674) (-900.442) (-900.237) * (-898.370) (-904.705) (-899.405) [-899.242] -- 0:00:23

      Average standard deviation of split frequencies: 0.009486

      645500 -- (-900.213) [-898.973] (-899.152) (-898.401) * [-902.777] (-899.109) (-902.923) (-898.924) -- 0:00:23
      646000 -- (-902.113) (-898.060) (-899.470) [-898.748] * [-898.403] (-900.369) (-899.042) (-900.845) -- 0:00:23
      646500 -- (-903.095) (-899.524) (-906.740) [-900.905] * [-898.726] (-898.305) (-897.792) (-900.847) -- 0:00:22
      647000 -- (-901.233) [-898.784] (-897.510) (-900.924) * [-900.277] (-899.873) (-899.092) (-899.775) -- 0:00:22
      647500 -- [-897.120] (-899.992) (-896.846) (-897.976) * (-899.547) (-899.885) [-901.556] (-899.773) -- 0:00:22
      648000 -- (-897.879) (-898.953) [-898.983] (-900.134) * (-897.360) [-902.837] (-900.578) (-901.624) -- 0:00:22
      648500 -- [-897.378] (-898.351) (-902.690) (-899.294) * (-898.856) (-900.985) [-899.001] (-907.904) -- 0:00:22
      649000 -- (-900.231) (-900.140) (-899.738) [-898.464] * (-898.360) (-897.490) (-898.714) [-902.137] -- 0:00:22
      649500 -- (-897.849) (-901.327) (-903.624) [-900.240] * (-900.181) (-899.475) (-899.141) [-897.462] -- 0:00:22
      650000 -- (-900.162) (-900.727) (-898.392) [-897.487] * (-899.216) [-897.834] (-898.862) (-900.570) -- 0:00:22

      Average standard deviation of split frequencies: 0.009370

      650500 -- (-900.893) [-899.594] (-897.923) (-899.109) * (-899.562) [-897.858] (-903.139) (-898.324) -- 0:00:22
      651000 -- [-900.463] (-900.616) (-901.466) (-900.615) * [-898.236] (-897.858) (-903.174) (-902.673) -- 0:00:22
      651500 -- (-899.649) (-898.671) (-898.111) [-898.791] * (-899.822) (-900.139) [-899.878] (-898.696) -- 0:00:22
      652000 -- (-899.811) (-901.006) [-899.039] (-898.054) * (-897.963) (-900.381) [-901.761] (-898.269) -- 0:00:22
      652500 -- (-903.980) (-898.322) [-898.607] (-898.844) * (-901.779) (-899.200) [-899.734] (-901.501) -- 0:00:22
      653000 -- [-898.483] (-898.667) (-900.362) (-899.090) * (-899.940) (-898.883) (-901.314) [-899.997] -- 0:00:22
      653500 -- (-897.564) [-897.364] (-899.306) (-903.081) * (-900.333) [-901.267] (-905.003) (-898.075) -- 0:00:22
      654000 -- [-900.624] (-897.588) (-900.602) (-899.900) * (-898.485) (-897.475) [-898.851] (-901.705) -- 0:00:22
      654500 -- (-899.923) [-900.823] (-898.707) (-897.589) * [-899.610] (-897.471) (-898.986) (-898.228) -- 0:00:22
      655000 -- [-900.179] (-898.799) (-898.491) (-897.405) * (-900.446) (-897.693) [-897.776] (-898.727) -- 0:00:22

      Average standard deviation of split frequencies: 0.009294

      655500 -- (-899.294) (-899.215) [-898.948] (-898.281) * (-899.647) (-897.014) (-899.571) [-897.916] -- 0:00:22
      656000 -- (-898.302) (-898.06