--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:22:30 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2498/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -898.46 -901.82
2 -898.52 -904.67
--------------------------------------
TOTAL -898.49 -904.04
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893153 0.092773 0.344270 1.495126 0.860419 1325.41 1413.20 1.000
r(A<->C){all} 0.168024 0.020461 0.000120 0.454267 0.128141 210.06 241.85 1.002
r(A<->G){all} 0.160458 0.018576 0.000046 0.431137 0.124720 222.50 252.07 1.004
r(A<->T){all} 0.170328 0.020066 0.000057 0.441223 0.135058 190.82 193.00 1.000
r(C<->G){all} 0.163176 0.019673 0.000021 0.449285 0.127114 175.82 208.39 1.000
r(C<->T){all} 0.170122 0.019850 0.000017 0.457311 0.134358 311.95 346.32 1.002
r(G<->T){all} 0.167892 0.019637 0.000002 0.444960 0.132083 175.79 208.16 1.003
pi(A){all} 0.198099 0.000249 0.166921 0.229249 0.198015 998.96 1141.58 1.000
pi(C){all} 0.325817 0.000337 0.291298 0.362966 0.325626 1085.77 1174.25 1.000
pi(G){all} 0.270779 0.000301 0.238609 0.306377 0.270298 1258.75 1379.88 1.000
pi(T){all} 0.205305 0.000249 0.174513 0.235169 0.205056 1193.40 1302.86 1.000
alpha{1,2} 0.431451 0.254073 0.000212 1.447037 0.251592 1013.83 1171.88 1.000
alpha{3} 0.478884 0.252378 0.000524 1.462121 0.316489 1198.92 1239.20 1.000
pinvar{all} 0.997585 0.000008 0.991730 0.999999 0.998533 1140.02 1213.22 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -858.415
Model 2: PositiveSelection -858.415036
Model 0: one-ratio -858.415024
Model 7: beta -858.415031
Model 8: beta&w>1 -858.415
Model 0 vs 1 4.8000000106185325E-5
Model 2 vs 1 7.200000004559115E-5
Model 8 vs 7 6.200000007083872E-5
>C1
MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
GVIKQTMFGHAAAALSANA
>C2
MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
GVIKQTMFGHAAAALSANA
>C3
MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
GVIKQTMFGHAAAALSANA
>C4
MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
GVIKQTMFGHAAAALSANA
>C5
MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
GVIKQTMFGHAAAALSANA
>C6
MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
GVIKQTMFGHAAAALSANA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=219
C1 MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
C2 MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
C3 MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
C4 MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
C5 MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
C6 MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
**************************************************
C1 LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
C2 LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
C3 LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
C4 LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
C5 LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
C6 LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
**************************************************
C1 FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
C2 FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
C3 FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
C4 FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
C5 FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
C6 FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
**************************************************
C1 ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
C2 ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
C3 ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
C4 ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
C5 ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
C6 ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
**************************************************
C1 GVIKQTMFGHAAAALSANA
C2 GVIKQTMFGHAAAALSANA
C3 GVIKQTMFGHAAAALSANA
C4 GVIKQTMFGHAAAALSANA
C5 GVIKQTMFGHAAAALSANA
C6 GVIKQTMFGHAAAALSANA
*******************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 219 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 219 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6570]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6570]--->[6570]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.485 Mb, Max= 30.766 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
C2 MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
C3 MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
C4 MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
C5 MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
C6 MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
**************************************************
C1 LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
C2 LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
C3 LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
C4 LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
C5 LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
C6 LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
**************************************************
C1 FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
C2 FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
C3 FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
C4 FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
C5 FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
C6 FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
**************************************************
C1 ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
C2 ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
C3 ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
C4 ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
C5 ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
C6 ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
**************************************************
C1 GVIKQTMFGHAAAALSANA
C2 GVIKQTMFGHAAAALSANA
C3 GVIKQTMFGHAAAALSANA
C4 GVIKQTMFGHAAAALSANA
C5 GVIKQTMFGHAAAALSANA
C6 GVIKQTMFGHAAAALSANA
*******************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG
C2 ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG
C3 ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG
C4 ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG
C5 ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG
C6 ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG
**************************************************
C1 TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC
C2 TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC
C3 TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC
C4 TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC
C5 TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC
C6 TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC
**************************************************
C1 ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA
C2 ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA
C3 ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA
C4 ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA
C5 ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA
C6 ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA
**************************************************
C1 CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA
C2 CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA
C3 CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA
C4 CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA
C5 CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA
C6 CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA
**************************************************
C1 CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC
C2 CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC
C3 CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC
C4 CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC
C5 CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC
C6 CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC
**************************************************
C1 GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG
C2 GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG
C3 GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG
C4 GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG
C5 GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG
C6 GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG
**************************************************
C1 TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG
C2 TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG
C3 TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG
C4 TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG
C5 TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG
C6 TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG
**************************************************
C1 TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT
C2 TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT
C3 TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT
C4 TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT
C5 TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT
C6 TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT
**************************************************
C1 TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA
C2 TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA
C3 TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA
C4 TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA
C5 TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA
C6 TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA
**************************************************
C1 GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC
C2 GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC
C3 GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC
C4 GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC
C5 GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC
C6 GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC
**************************************************
C1 CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG
C2 CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG
C3 CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG
C4 CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG
C5 CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG
C6 CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG
**************************************************
C1 TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG
C2 TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG
C3 TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG
C4 TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG
C5 TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG
C6 TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG
**************************************************
C1 GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC
C2 GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC
C3 GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC
C4 GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC
C5 GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC
C6 GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC
**************************************************
C1 CAATGCC
C2 CAATGCC
C3 CAATGCC
C4 CAATGCC
C5 CAATGCC
C6 CAATGCC
*******
>C1
ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG
TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC
ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA
CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA
CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC
GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG
TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG
TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT
TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA
GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC
CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG
TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG
GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC
CAATGCC
>C2
ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG
TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC
ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA
CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA
CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC
GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG
TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG
TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT
TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA
GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC
CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG
TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG
GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC
CAATGCC
>C3
ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG
TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC
ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA
CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA
CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC
GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG
TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG
TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT
TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA
GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC
CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG
TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG
GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC
CAATGCC
>C4
ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG
TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC
ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA
CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA
CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC
GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG
TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG
TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT
TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA
GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC
CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG
TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG
GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC
CAATGCC
>C5
ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG
TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC
ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA
CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA
CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC
GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG
TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG
TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT
TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA
GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC
CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG
TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG
GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC
CAATGCC
>C6
ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG
TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC
ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA
CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA
CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC
GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG
TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG
TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT
TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA
GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC
CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG
TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG
GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC
CAATGCC
>C1
MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
GVIKQTMFGHAAAALSANA
>C2
MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
GVIKQTMFGHAAAALSANA
>C3
MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
GVIKQTMFGHAAAALSANA
>C4
MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
GVIKQTMFGHAAAALSANA
>C5
MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
GVIKQTMFGHAAAALSANA
>C6
MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
GVIKQTMFGHAAAALSANA
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 657 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579857641
Setting output file names to "/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1419500002
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5684953126
Seed = 1900633949
Swapseed = 1579857641
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1470.397416 -- -24.965149
Chain 2 -- -1470.397416 -- -24.965149
Chain 3 -- -1470.397500 -- -24.965149
Chain 4 -- -1470.397416 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1470.397416 -- -24.965149
Chain 2 -- -1470.397500 -- -24.965149
Chain 3 -- -1470.397500 -- -24.965149
Chain 4 -- -1470.397416 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1470.397] (-1470.397) (-1470.397) (-1470.397) * [-1470.397] (-1470.397) (-1470.397) (-1470.397)
500 -- (-923.006) (-908.986) (-912.181) [-905.822] * [-904.500] (-910.715) (-920.069) (-909.663) -- 0:00:00
1000 -- (-916.825) [-906.674] (-908.948) (-911.771) * (-915.147) [-905.340] (-918.197) (-906.798) -- 0:00:00
1500 -- (-905.400) (-919.179) [-908.075] (-912.295) * (-906.940) [-908.187] (-909.650) (-912.455) -- 0:00:00
2000 -- [-908.763] (-913.999) (-906.531) (-908.164) * (-913.912) [-907.968] (-911.063) (-904.939) -- 0:00:00
2500 -- (-909.882) [-908.539] (-927.336) (-914.833) * (-918.008) (-907.853) (-906.547) [-905.214] -- 0:00:00
3000 -- (-904.594) (-904.378) [-908.628] (-909.390) * (-912.791) [-900.725] (-905.772) (-913.853) -- 0:00:00
3500 -- (-912.449) (-916.841) (-908.874) [-912.623] * (-909.900) (-904.314) (-908.575) [-915.343] -- 0:00:00
4000 -- [-908.213] (-905.808) (-913.030) (-909.002) * (-914.230) [-904.937] (-919.419) (-910.962) -- 0:00:00
4500 -- (-904.207) [-917.517] (-909.329) (-911.444) * (-909.551) (-907.144) (-911.490) [-906.921] -- 0:00:00
5000 -- (-911.499) (-920.579) (-903.194) [-908.108] * (-913.383) [-904.588] (-914.050) (-908.652) -- 0:00:00
Average standard deviation of split frequencies: 0.081983
5500 -- (-914.900) (-919.688) (-914.543) [-908.245] * (-904.759) [-907.142] (-906.693) (-910.112) -- 0:00:00
6000 -- (-908.891) (-912.770) [-906.160] (-906.686) * (-906.216) [-906.321] (-911.953) (-910.073) -- 0:00:00
6500 -- (-909.077) [-906.444] (-909.312) (-906.159) * (-909.688) (-905.655) [-906.488] (-903.344) -- 0:00:00
7000 -- (-908.897) (-912.773) [-907.039] (-910.152) * (-913.434) (-908.442) (-907.678) [-906.178] -- 0:00:00
7500 -- (-904.838) (-906.007) (-910.318) [-907.836] * (-909.114) [-911.288] (-906.049) (-913.245) -- 0:00:00
8000 -- (-908.666) (-911.043) (-913.724) [-910.306] * (-908.470) (-907.083) [-907.729] (-911.938) -- 0:00:00
8500 -- [-910.429] (-915.768) (-914.226) (-919.104) * (-903.322) (-907.911) [-904.910] (-905.064) -- 0:00:00
9000 -- [-904.229] (-921.922) (-913.076) (-905.190) * [-907.081] (-904.224) (-909.536) (-907.049) -- 0:00:00
9500 -- (-909.460) (-908.408) [-903.998] (-916.209) * (-913.211) [-912.742] (-907.581) (-904.916) -- 0:01:44
10000 -- [-906.461] (-911.671) (-907.915) (-907.712) * [-914.550] (-910.547) (-902.998) (-909.666) -- 0:01:39
Average standard deviation of split frequencies: 0.072106
10500 -- (-905.351) (-908.137) [-908.294] (-905.660) * (-905.542) (-907.377) [-902.991] (-906.863) -- 0:01:34
11000 -- (-908.990) (-909.255) (-906.629) [-905.667] * (-905.866) (-913.524) (-903.823) [-908.036] -- 0:01:29
11500 -- [-902.724] (-901.453) (-908.468) (-903.325) * (-914.208) (-914.775) [-907.043] (-903.747) -- 0:01:25
12000 -- [-905.343] (-909.659) (-919.113) (-910.901) * (-904.489) (-911.396) [-904.024] (-907.471) -- 0:01:22
12500 -- [-907.509] (-909.821) (-908.454) (-904.190) * (-914.119) [-905.672] (-910.994) (-913.061) -- 0:01:19
13000 -- [-904.926] (-910.937) (-912.091) (-906.583) * (-908.761) (-908.274) [-907.930] (-918.154) -- 0:01:15
13500 -- (-903.908) [-912.416] (-912.072) (-904.177) * (-906.092) (-904.261) [-902.492] (-912.324) -- 0:01:13
14000 -- (-910.160) (-907.217) [-908.420] (-904.843) * (-909.023) (-910.637) (-908.593) [-907.203] -- 0:01:10
14500 -- (-908.454) (-908.551) [-907.554] (-901.779) * (-906.420) [-911.423] (-910.758) (-900.856) -- 0:01:07
15000 -- (-906.856) (-911.415) [-907.547] (-911.051) * [-908.427] (-909.619) (-907.657) (-908.311) -- 0:01:05
Average standard deviation of split frequencies: 0.058926
15500 -- [-907.751] (-911.666) (-911.663) (-911.596) * [-912.729] (-913.765) (-907.627) (-920.090) -- 0:01:03
16000 -- (-909.408) (-905.342) (-914.404) [-907.402] * (-906.831) [-905.823] (-906.984) (-916.671) -- 0:01:01
16500 -- (-904.328) (-913.027) [-900.825] (-909.593) * (-910.491) (-914.055) [-903.816] (-905.543) -- 0:00:59
17000 -- [-906.705] (-904.825) (-900.509) (-909.032) * (-910.010) (-909.629) [-907.265] (-909.637) -- 0:00:57
17500 -- (-912.183) (-909.499) (-899.603) [-906.339] * (-904.199) (-909.357) [-907.831] (-906.499) -- 0:00:56
18000 -- (-912.902) (-913.428) [-897.436] (-901.986) * (-908.404) [-903.269] (-909.715) (-916.071) -- 0:00:54
18500 -- (-912.063) [-912.075] (-898.150) (-906.526) * (-911.629) (-908.087) (-913.486) [-909.972] -- 0:00:53
19000 -- [-904.295] (-906.256) (-897.459) (-906.376) * [-905.344] (-903.876) (-911.096) (-912.687) -- 0:00:51
19500 -- (-909.842) [-902.417] (-898.763) (-917.661) * [-904.920] (-921.710) (-906.412) (-907.314) -- 0:00:50
20000 -- [-907.236] (-913.994) (-899.265) (-898.686) * (-918.665) (-898.107) (-913.087) [-910.670] -- 0:00:49
Average standard deviation of split frequencies: 0.052463
20500 -- (-908.892) (-911.449) (-899.008) [-898.469] * (-900.141) (-898.492) [-905.812] (-910.794) -- 0:00:47
21000 -- (-912.010) [-907.553] (-899.655) (-900.580) * (-904.850) (-898.703) (-906.626) [-901.871] -- 0:00:46
21500 -- [-910.638] (-909.626) (-898.510) (-902.809) * [-902.505] (-897.751) (-912.325) (-907.522) -- 0:00:45
22000 -- (-907.929) (-911.316) (-899.547) [-900.460] * (-900.218) (-898.939) [-906.704] (-915.063) -- 0:00:44
22500 -- (-905.887) (-906.720) (-903.346) [-901.961] * (-898.555) [-899.293] (-905.221) (-908.468) -- 0:01:26
23000 -- (-908.117) (-914.797) (-901.726) [-901.876] * [-898.042] (-897.925) (-906.953) (-916.621) -- 0:01:24
23500 -- (-908.731) [-908.468] (-898.181) (-900.951) * (-898.677) (-899.076) (-913.000) [-908.730] -- 0:01:23
24000 -- [-914.891] (-910.101) (-898.467) (-899.390) * (-900.503) (-897.939) [-906.473] (-908.662) -- 0:01:21
24500 -- [-907.183] (-916.044) (-897.756) (-899.239) * (-903.299) (-897.401) (-913.423) [-910.176] -- 0:01:19
25000 -- (-909.557) [-908.091] (-897.516) (-898.132) * (-901.364) (-897.761) (-908.126) [-906.038] -- 0:01:18
Average standard deviation of split frequencies: 0.038852
25500 -- [-910.633] (-907.334) (-903.466) (-898.962) * (-897.559) [-897.053] (-910.100) (-905.915) -- 0:01:16
26000 -- (-912.006) (-909.910) (-898.469) [-898.208] * (-897.335) [-897.521] (-905.758) (-908.482) -- 0:01:14
26500 -- [-903.407] (-906.132) (-900.787) (-900.229) * (-898.085) (-896.777) (-909.215) [-908.967] -- 0:01:13
27000 -- [-904.892] (-907.652) (-898.116) (-900.230) * (-897.179) (-898.305) (-907.127) [-911.568] -- 0:01:12
27500 -- [-909.076] (-905.923) (-898.539) (-899.382) * (-899.773) [-898.655] (-906.262) (-911.358) -- 0:01:10
28000 -- (-910.945) (-912.093) (-900.545) [-898.987] * (-907.192) [-898.710] (-910.124) (-908.561) -- 0:01:09
28500 -- [-908.630] (-915.192) (-899.429) (-901.291) * [-902.083] (-900.243) (-909.328) (-907.697) -- 0:01:08
29000 -- [-909.753] (-919.917) (-902.110) (-901.024) * (-905.513) (-903.090) [-910.884] (-903.313) -- 0:01:06
29500 -- (-908.048) (-910.721) (-896.852) [-898.175] * (-903.680) (-899.396) (-915.030) [-908.499] -- 0:01:05
30000 -- (-913.195) (-902.088) [-897.242] (-897.326) * (-900.914) (-901.242) [-906.812] (-915.791) -- 0:01:04
Average standard deviation of split frequencies: 0.036124
30500 -- (-911.484) (-907.799) [-898.463] (-903.129) * (-899.007) [-897.768] (-910.767) (-903.770) -- 0:01:03
31000 -- (-910.687) (-909.743) [-903.407] (-899.148) * (-902.848) (-899.063) [-905.833] (-917.184) -- 0:01:02
31500 -- (-903.221) (-908.448) [-899.705] (-898.546) * [-898.466] (-897.834) (-914.635) (-908.420) -- 0:01:01
32000 -- (-898.300) (-905.875) (-899.230) [-898.749] * (-901.953) (-898.285) [-909.964] (-909.123) -- 0:01:00
32500 -- [-898.390] (-908.192) (-898.302) (-900.064) * (-899.653) [-897.108] (-913.981) (-911.601) -- 0:00:59
33000 -- [-902.437] (-903.109) (-898.988) (-899.396) * (-900.344) [-897.535] (-913.423) (-932.222) -- 0:00:58
33500 -- (-901.930) (-909.643) (-898.107) [-898.319] * (-901.553) [-897.272] (-907.193) (-907.861) -- 0:00:57
34000 -- (-901.727) (-908.377) [-897.272] (-899.524) * [-897.562] (-897.226) (-907.064) (-899.989) -- 0:00:56
34500 -- (-897.257) (-907.214) [-898.641] (-899.373) * (-898.246) (-897.265) [-905.877] (-897.175) -- 0:00:55
35000 -- [-897.989] (-907.092) (-898.240) (-899.605) * [-898.191] (-897.447) (-907.717) (-897.234) -- 0:00:55
Average standard deviation of split frequencies: 0.029827
35500 -- (-898.330) (-914.090) (-898.043) [-898.275] * (-898.061) (-897.632) (-909.906) [-898.717] -- 0:00:54
36000 -- (-897.286) (-903.567) (-904.235) [-898.788] * (-899.017) [-897.268] (-909.615) (-898.855) -- 0:00:53
36500 -- (-899.811) (-913.225) [-902.276] (-900.133) * (-899.109) (-898.477) (-906.652) [-899.329] -- 0:01:19
37000 -- (-900.549) (-912.277) (-899.962) [-899.304] * (-899.053) (-899.173) (-900.026) [-899.228] -- 0:01:18
37500 -- [-903.125] (-904.175) (-901.038) (-898.297) * (-898.935) (-898.139) (-898.463) [-899.645] -- 0:01:17
38000 -- (-900.145) [-909.738] (-898.653) (-898.317) * (-899.088) (-899.980) (-897.548) [-901.790] -- 0:01:15
38500 -- (-899.724) (-910.427) [-899.758] (-900.139) * (-902.330) [-899.269] (-898.224) (-899.084) -- 0:01:14
39000 -- (-898.926) (-907.650) [-898.520] (-898.109) * [-897.316] (-898.843) (-898.240) (-903.459) -- 0:01:13
39500 -- (-898.488) (-911.661) [-901.275] (-898.514) * (-898.306) (-901.462) (-899.276) [-900.094] -- 0:01:12
40000 -- (-897.288) (-908.600) [-900.860] (-898.171) * (-902.085) (-903.072) (-897.711) [-898.412] -- 0:01:12
Average standard deviation of split frequencies: 0.035386
40500 -- [-898.760] (-913.612) (-899.577) (-902.875) * [-900.326] (-899.577) (-900.753) (-898.714) -- 0:01:11
41000 -- (-901.237) (-903.457) [-899.186] (-899.140) * (-900.111) [-900.920] (-900.663) (-897.689) -- 0:01:10
41500 -- (-898.854) [-904.089] (-900.134) (-902.500) * (-897.568) (-898.301) (-898.343) [-897.982] -- 0:01:09
42000 -- [-899.565] (-907.768) (-899.205) (-898.710) * (-897.792) (-898.558) (-898.108) [-897.828] -- 0:01:08
42500 -- (-900.110) (-910.226) [-899.829] (-899.585) * [-897.849] (-899.575) (-901.646) (-901.132) -- 0:01:07
43000 -- (-899.743) (-915.416) (-897.991) [-897.207] * (-905.809) [-900.020] (-898.053) (-898.674) -- 0:01:06
43500 -- (-898.115) [-904.992] (-897.733) (-898.973) * (-905.051) (-902.554) (-900.202) [-897.726] -- 0:01:05
44000 -- (-901.748) (-904.171) (-900.924) [-898.888] * (-898.635) (-903.736) (-898.788) [-898.234] -- 0:01:05
44500 -- (-900.403) (-917.833) (-899.157) [-899.914] * (-897.568) [-899.973] (-899.092) (-899.155) -- 0:01:04
45000 -- (-897.685) [-911.256] (-898.979) (-899.725) * (-901.391) (-903.274) (-897.954) [-898.872] -- 0:01:03
Average standard deviation of split frequencies: 0.035136
45500 -- (-898.526) (-915.303) [-897.643] (-902.044) * (-899.342) (-902.224) [-902.948] (-900.571) -- 0:01:02
46000 -- (-898.379) (-906.451) [-897.777] (-899.192) * (-899.044) (-899.249) (-898.819) [-898.252] -- 0:01:02
46500 -- (-897.181) (-911.926) (-899.691) [-899.006] * [-897.822] (-899.159) (-902.273) (-900.917) -- 0:01:01
47000 -- [-897.090] (-902.672) (-902.109) (-897.597) * (-898.543) (-900.722) [-898.980] (-901.864) -- 0:01:00
47500 -- (-897.674) [-903.466] (-900.311) (-898.939) * (-898.580) (-901.586) [-899.615] (-898.625) -- 0:01:00
48000 -- (-900.673) [-908.093] (-898.174) (-898.755) * [-898.603] (-898.911) (-901.775) (-897.194) -- 0:00:59
48500 -- (-897.419) (-904.350) [-897.317] (-899.566) * (-898.480) (-902.821) [-900.672] (-897.869) -- 0:00:58
49000 -- (-899.808) (-912.062) (-900.532) [-898.029] * [-899.805] (-899.063) (-903.868) (-899.134) -- 0:00:58
49500 -- (-898.547) (-916.750) (-898.901) [-898.868] * (-902.927) (-897.514) [-897.629] (-899.180) -- 0:00:57
50000 -- (-898.583) (-907.785) [-899.352] (-897.981) * (-899.971) (-898.889) (-898.040) [-898.542] -- 0:00:57
Average standard deviation of split frequencies: 0.028758
50500 -- [-898.549] (-907.612) (-899.863) (-898.619) * (-901.249) (-899.531) (-898.923) [-900.807] -- 0:00:56
51000 -- (-898.373) [-906.498] (-897.151) (-898.942) * (-900.484) (-900.941) [-897.448] (-902.011) -- 0:00:55
51500 -- [-899.011] (-905.790) (-901.213) (-900.759) * (-901.387) (-898.324) [-897.931] (-904.879) -- 0:01:13
52000 -- (-897.977) (-913.712) (-901.581) [-901.402] * (-903.053) [-899.080] (-897.296) (-898.195) -- 0:01:12
52500 -- (-899.626) (-915.202) [-899.036] (-899.044) * [-902.936] (-897.715) (-897.231) (-899.656) -- 0:01:12
53000 -- (-898.683) (-909.970) [-898.144] (-898.706) * [-897.717] (-897.837) (-897.490) (-900.430) -- 0:01:11
53500 -- (-899.575) (-907.285) (-899.519) [-898.344] * (-899.542) (-899.482) [-897.384] (-897.755) -- 0:01:10
54000 -- (-899.897) [-903.749] (-901.499) (-901.743) * (-899.980) [-897.716] (-899.764) (-897.610) -- 0:01:10
54500 -- (-897.850) (-912.038) [-900.291] (-898.027) * (-900.327) (-900.008) [-899.084] (-898.874) -- 0:01:09
55000 -- (-897.728) [-908.208] (-899.079) (-901.806) * [-900.406] (-898.413) (-900.603) (-897.575) -- 0:01:08
Average standard deviation of split frequencies: 0.029884
55500 -- (-899.530) (-919.597) [-900.461] (-899.372) * (-901.000) (-901.202) (-897.646) [-898.747] -- 0:01:08
56000 -- (-897.862) (-910.095) [-898.812] (-897.154) * (-901.779) (-900.667) (-899.895) [-897.285] -- 0:01:07
56500 -- [-897.418] (-908.179) (-898.427) (-897.619) * (-900.759) (-898.507) (-897.362) [-899.001] -- 0:01:06
57000 -- (-899.550) (-900.019) (-901.487) [-897.578] * [-900.145] (-899.657) (-899.395) (-900.844) -- 0:01:06
57500 -- (-897.972) (-907.508) (-904.165) [-897.288] * [-901.978] (-899.362) (-900.275) (-898.439) -- 0:01:05
58000 -- (-899.028) (-914.146) [-897.228] (-899.116) * [-897.764] (-897.929) (-899.588) (-899.002) -- 0:01:04
58500 -- (-898.563) [-910.102] (-897.158) (-900.762) * [-898.972] (-898.449) (-900.142) (-901.543) -- 0:01:04
59000 -- (-898.559) [-908.641] (-899.349) (-900.005) * (-899.555) [-898.101] (-898.813) (-897.857) -- 0:01:03
59500 -- (-901.442) (-908.715) [-897.261] (-898.417) * (-898.301) (-897.529) [-903.041] (-897.675) -- 0:01:03
60000 -- (-899.482) (-906.030) [-900.399] (-897.813) * (-904.855) (-901.778) (-900.714) [-897.618] -- 0:01:02
Average standard deviation of split frequencies: 0.028750
60500 -- (-899.226) (-920.535) (-899.779) [-898.299] * (-901.708) (-899.816) [-903.766] (-903.926) -- 0:01:02
61000 -- (-901.744) (-906.618) (-900.905) [-899.541] * (-899.526) [-901.373] (-898.821) (-902.441) -- 0:01:01
61500 -- [-901.804] (-905.647) (-901.368) (-904.559) * [-897.984] (-898.896) (-902.821) (-899.597) -- 0:01:01
62000 -- (-898.979) (-906.585) [-897.633] (-899.211) * [-899.741] (-902.649) (-898.488) (-898.821) -- 0:01:00
62500 -- (-898.898) [-909.337] (-897.952) (-900.837) * (-899.685) (-899.661) (-900.910) [-898.361] -- 0:01:00
63000 -- [-903.682] (-913.530) (-899.211) (-901.368) * (-898.628) (-899.661) (-900.896) [-898.863] -- 0:00:59
63500 -- [-899.816] (-907.536) (-900.693) (-904.851) * [-898.470] (-899.375) (-899.599) (-898.112) -- 0:00:58
64000 -- (-899.016) [-908.178] (-899.972) (-899.441) * (-897.643) (-898.415) (-899.445) [-899.185] -- 0:00:58
64500 -- (-903.376) (-907.489) (-901.093) [-899.331] * (-903.145) [-901.526] (-902.861) (-901.050) -- 0:00:58
65000 -- [-898.538] (-917.366) (-900.379) (-902.292) * (-900.854) [-903.868] (-902.848) (-897.690) -- 0:00:57
Average standard deviation of split frequencies: 0.026070
65500 -- (-899.872) [-912.035] (-898.833) (-903.408) * (-898.790) (-897.441) [-898.639] (-900.665) -- 0:00:57
66000 -- (-898.405) [-909.358] (-900.195) (-898.596) * [-899.563] (-897.900) (-905.415) (-900.286) -- 0:00:56
66500 -- [-898.772] (-909.298) (-899.204) (-901.557) * (-898.520) [-899.060] (-902.890) (-898.565) -- 0:01:10
67000 -- (-897.540) [-908.356] (-903.743) (-897.963) * (-900.068) (-898.705) [-904.519] (-898.392) -- 0:01:09
67500 -- (-897.797) (-912.234) (-899.986) [-897.963] * (-899.848) [-899.009] (-899.695) (-900.400) -- 0:01:09
68000 -- (-899.442) (-908.154) [-897.690] (-897.197) * (-903.132) (-898.466) (-900.673) [-897.909] -- 0:01:08
68500 -- (-902.104) (-908.654) (-899.220) [-899.662] * (-900.581) [-899.971] (-898.433) (-900.470) -- 0:01:07
69000 -- [-897.848] (-911.758) (-899.010) (-899.391) * (-902.273) [-898.944] (-898.639) (-898.441) -- 0:01:07
69500 -- (-897.846) [-906.739] (-903.344) (-898.781) * (-902.950) [-899.245] (-897.644) (-897.044) -- 0:01:06
70000 -- [-902.743] (-911.563) (-897.859) (-902.016) * (-906.115) [-899.258] (-899.584) (-897.302) -- 0:01:06
Average standard deviation of split frequencies: 0.030019
70500 -- (-903.449) (-908.794) [-898.681] (-898.112) * (-898.863) [-899.012] (-898.984) (-897.108) -- 0:01:05
71000 -- (-899.021) [-904.538] (-900.965) (-899.787) * [-897.747] (-900.429) (-898.100) (-899.542) -- 0:01:05
71500 -- (-899.403) (-908.542) (-898.534) [-898.799] * (-898.046) (-901.828) (-900.759) [-902.004] -- 0:01:04
72000 -- (-899.938) (-906.848) (-897.951) [-899.735] * (-898.293) (-898.879) [-898.076] (-901.166) -- 0:01:04
72500 -- (-899.984) [-916.455] (-898.731) (-899.462) * [-902.899] (-900.725) (-899.860) (-901.528) -- 0:01:03
73000 -- (-897.500) (-909.366) [-897.899] (-898.179) * (-898.187) [-897.998] (-897.693) (-903.288) -- 0:01:03
73500 -- (-899.258) (-909.316) (-897.909) [-897.523] * (-898.565) [-898.113] (-898.845) (-897.721) -- 0:01:03
74000 -- (-899.897) (-907.095) [-898.941] (-898.047) * (-899.177) (-901.372) (-899.690) [-899.227] -- 0:01:02
74500 -- (-901.001) (-920.394) [-897.789] (-898.124) * (-899.225) (-901.055) (-898.943) [-898.880] -- 0:01:02
75000 -- (-900.320) [-904.554] (-900.392) (-898.124) * [-898.944] (-899.185) (-898.590) (-901.009) -- 0:01:01
Average standard deviation of split frequencies: 0.028946
75500 -- (-900.816) [-909.496] (-898.162) (-898.285) * (-898.944) [-899.974] (-897.747) (-901.334) -- 0:01:01
76000 -- (-899.199) [-906.169] (-903.636) (-897.911) * (-898.863) (-899.181) [-902.155] (-899.723) -- 0:01:00
76500 -- (-902.706) (-909.388) (-899.389) [-897.880] * [-897.660] (-901.531) (-897.293) (-902.757) -- 0:01:00
77000 -- [-902.338] (-906.064) (-898.644) (-898.330) * [-897.789] (-898.739) (-900.246) (-898.206) -- 0:00:59
77500 -- (-901.666) (-913.564) [-898.925] (-899.231) * (-900.477) (-897.922) (-898.642) [-900.960] -- 0:00:59
78000 -- (-899.903) (-909.327) (-898.380) [-898.015] * (-900.284) (-900.947) (-899.449) [-901.801] -- 0:00:59
78500 -- [-897.912] (-911.187) (-898.294) (-898.913) * (-897.727) (-899.825) [-898.884] (-900.188) -- 0:00:58
79000 -- (-900.191) (-914.434) (-900.498) [-897.339] * (-897.530) (-897.504) [-897.792] (-899.085) -- 0:00:58
79500 -- (-898.645) [-904.842] (-900.779) (-897.317) * [-899.139] (-900.098) (-897.179) (-899.239) -- 0:00:57
80000 -- (-901.101) (-907.139) (-898.960) [-899.365] * (-899.847) (-901.548) (-897.441) [-898.409] -- 0:00:57
Average standard deviation of split frequencies: 0.028663
80500 -- [-898.180] (-898.418) (-900.659) (-900.704) * [-900.408] (-902.366) (-897.745) (-898.498) -- 0:00:57
81000 -- [-898.332] (-899.313) (-899.700) (-900.502) * (-902.335) (-906.982) (-899.792) [-898.574] -- 0:00:56
81500 -- (-901.295) (-897.400) [-899.814] (-899.303) * [-900.310] (-898.013) (-900.942) (-899.252) -- 0:00:56
82000 -- (-897.560) [-898.356] (-900.616) (-901.159) * (-898.406) (-898.249) (-902.279) [-898.619] -- 0:01:07
82500 -- (-899.148) (-898.106) (-898.330) [-900.334] * (-899.065) (-901.678) [-899.456] (-898.874) -- 0:01:06
83000 -- (-902.591) [-898.540] (-898.592) (-906.078) * (-899.478) (-896.983) [-899.677] (-897.797) -- 0:01:06
83500 -- (-901.116) (-897.951) (-900.513) [-901.697] * [-898.981] (-898.656) (-897.519) (-898.103) -- 0:01:05
84000 -- (-900.965) (-901.451) (-900.093) [-906.719] * (-898.005) [-899.345] (-899.116) (-898.693) -- 0:01:05
84500 -- (-898.692) (-900.156) [-899.799] (-903.759) * (-899.164) (-898.579) [-898.116] (-898.456) -- 0:01:05
85000 -- (-901.697) (-900.706) [-899.121] (-899.418) * [-898.803] (-899.766) (-900.065) (-899.026) -- 0:01:04
Average standard deviation of split frequencies: 0.029234
85500 -- (-899.263) (-899.485) [-900.623] (-898.505) * (-898.146) (-899.150) [-899.090] (-899.058) -- 0:01:04
86000 -- (-899.193) [-899.805] (-900.219) (-900.645) * (-898.356) (-898.460) [-904.365] (-898.256) -- 0:01:03
86500 -- [-899.536] (-902.820) (-900.563) (-897.624) * (-897.339) (-900.407) [-900.596] (-900.150) -- 0:01:03
87000 -- [-898.095] (-900.788) (-898.345) (-897.295) * (-898.704) (-897.270) [-897.543] (-901.033) -- 0:01:02
87500 -- (-900.180) [-899.676] (-898.984) (-900.997) * (-897.740) (-898.035) [-900.252] (-897.509) -- 0:01:02
88000 -- [-898.808] (-898.470) (-901.214) (-899.846) * [-897.528] (-898.340) (-899.167) (-900.670) -- 0:01:02
88500 -- [-899.878] (-901.535) (-897.588) (-900.042) * (-897.937) (-899.173) [-899.746] (-900.185) -- 0:01:01
89000 -- [-900.234] (-904.707) (-898.257) (-900.808) * (-899.452) (-901.135) [-898.410] (-898.901) -- 0:01:01
89500 -- (-900.826) [-899.203] (-897.982) (-900.338) * [-897.249] (-898.432) (-899.911) (-897.589) -- 0:01:01
90000 -- (-898.951) [-900.873] (-900.818) (-901.507) * [-897.740] (-900.174) (-900.002) (-899.821) -- 0:01:00
Average standard deviation of split frequencies: 0.032378
90500 -- (-899.539) (-898.547) [-897.522] (-904.628) * (-898.893) (-899.436) (-901.134) [-901.492] -- 0:01:00
91000 -- (-899.851) [-898.922] (-902.420) (-900.553) * (-897.875) [-897.381] (-900.215) (-903.843) -- 0:00:59
91500 -- (-900.213) [-900.402] (-902.748) (-898.654) * (-898.406) (-899.342) [-900.414] (-897.928) -- 0:00:59
92000 -- [-902.370] (-900.315) (-899.002) (-898.588) * (-897.668) [-897.463] (-901.411) (-897.565) -- 0:00:59
92500 -- (-899.296) (-901.660) [-899.645] (-899.841) * (-899.732) (-897.786) [-899.019] (-900.940) -- 0:00:58
93000 -- (-898.319) [-898.402] (-900.008) (-899.505) * (-900.606) (-897.671) [-899.310] (-899.989) -- 0:00:58
93500 -- (-898.721) [-899.630] (-899.190) (-900.798) * (-897.963) (-900.628) (-897.855) [-899.177] -- 0:00:58
94000 -- [-898.617] (-897.956) (-897.684) (-899.513) * [-899.461] (-900.640) (-897.067) (-897.350) -- 0:00:57
94500 -- (-898.486) (-897.570) [-898.124] (-901.263) * [-898.403] (-899.427) (-898.313) (-898.784) -- 0:00:57
95000 -- [-897.612] (-898.005) (-899.771) (-902.303) * (-897.686) [-900.929] (-900.522) (-899.367) -- 0:00:57
Average standard deviation of split frequencies: 0.029686
95500 -- (-898.845) [-897.448] (-898.215) (-898.867) * [-900.066] (-900.400) (-898.355) (-901.385) -- 0:00:56
96000 -- (-898.820) [-898.014] (-898.413) (-898.321) * [-897.991] (-901.936) (-897.016) (-901.295) -- 0:00:56
96500 -- (-898.520) (-898.482) [-900.604] (-898.528) * (-898.636) [-900.813] (-902.342) (-898.501) -- 0:00:56
97000 -- (-898.876) (-899.014) [-899.982] (-898.764) * (-904.699) (-902.959) [-897.993] (-899.311) -- 0:01:05
97500 -- (-897.997) (-898.659) [-901.646] (-897.637) * (-898.553) (-902.324) [-898.645] (-898.235) -- 0:01:04
98000 -- (-898.309) (-898.229) (-900.518) [-897.004] * [-897.954] (-904.569) (-896.955) (-903.358) -- 0:01:04
98500 -- [-897.402] (-898.226) (-899.413) (-899.493) * [-898.441] (-902.522) (-901.322) (-899.060) -- 0:01:04
99000 -- (-900.141) (-898.040) (-899.534) [-897.107] * [-898.159] (-902.817) (-900.537) (-900.197) -- 0:01:03
99500 -- [-899.577] (-900.381) (-904.806) (-898.217) * (-899.007) [-902.321] (-897.951) (-898.897) -- 0:01:03
100000 -- (-897.732) [-898.049] (-899.116) (-901.806) * (-901.528) (-902.715) [-898.485] (-905.068) -- 0:01:02
Average standard deviation of split frequencies: 0.029435
100500 -- (-898.139) (-897.500) (-897.556) [-902.098] * (-903.447) [-898.448] (-897.154) (-903.390) -- 0:01:02
101000 -- (-899.324) [-898.132] (-897.925) (-901.205) * (-902.485) (-897.891) (-897.435) [-901.937] -- 0:01:02
101500 -- [-898.543] (-899.181) (-902.368) (-900.202) * (-897.912) (-898.999) [-897.671] (-899.009) -- 0:01:01
102000 -- (-900.019) [-901.132] (-899.678) (-898.745) * (-897.680) [-902.048] (-904.342) (-898.790) -- 0:01:01
102500 -- [-897.744] (-901.114) (-900.509) (-898.543) * (-898.359) [-904.127] (-898.471) (-898.789) -- 0:01:01
103000 -- (-899.964) (-900.154) [-900.366] (-898.665) * (-899.220) [-898.829] (-899.288) (-897.630) -- 0:01:00
103500 -- (-898.872) (-900.458) (-900.705) [-899.545] * (-903.406) (-897.481) [-898.981] (-897.719) -- 0:01:00
104000 -- [-897.793] (-900.189) (-898.719) (-900.289) * [-900.395] (-901.577) (-898.284) (-899.779) -- 0:01:00
104500 -- (-898.344) (-899.192) [-897.496] (-901.540) * (-904.471) [-901.959] (-898.398) (-900.235) -- 0:00:59
105000 -- (-897.387) (-899.923) [-898.555] (-899.482) * (-900.591) (-898.207) [-897.556] (-898.597) -- 0:00:59
Average standard deviation of split frequencies: 0.027107
105500 -- (-900.176) (-900.817) [-897.791] (-897.520) * (-898.110) (-901.713) (-900.008) [-898.359] -- 0:00:59
106000 -- (-905.851) (-898.534) (-898.910) [-897.455] * (-897.253) (-899.243) [-900.512] (-898.099) -- 0:00:59
106500 -- (-900.023) (-900.606) [-899.179] (-902.061) * [-899.375] (-904.608) (-898.715) (-903.679) -- 0:00:58
107000 -- (-899.081) (-907.703) (-904.237) [-898.695] * (-897.212) [-898.590] (-898.764) (-899.057) -- 0:00:58
107500 -- (-899.639) (-899.897) (-898.051) [-899.474] * (-900.103) (-897.070) [-900.684] (-905.029) -- 0:00:58
108000 -- (-900.306) [-898.635] (-897.373) (-899.099) * (-899.300) [-898.581] (-900.538) (-898.737) -- 0:00:57
108500 -- [-900.053] (-900.286) (-897.864) (-902.811) * (-899.966) (-898.796) [-898.033] (-898.452) -- 0:00:57
109000 -- (-898.876) [-900.761] (-905.026) (-898.948) * (-898.848) (-899.262) (-897.839) [-898.395] -- 0:00:57
109500 -- [-898.049] (-900.258) (-900.323) (-901.477) * (-900.659) (-899.083) [-900.539] (-898.591) -- 0:00:56
110000 -- [-897.592] (-903.271) (-898.656) (-899.261) * (-901.279) [-898.983] (-898.211) (-900.910) -- 0:00:56
Average standard deviation of split frequencies: 0.024747
110500 -- (-897.877) (-899.373) [-897.177] (-897.498) * [-897.424] (-897.690) (-901.801) (-900.100) -- 0:00:56
111000 -- [-897.984] (-897.023) (-898.192) (-898.568) * (-897.884) [-897.561] (-899.257) (-901.977) -- 0:00:56
111500 -- [-900.069] (-897.074) (-900.197) (-899.873) * (-901.972) (-897.978) [-903.433] (-903.879) -- 0:00:55
112000 -- (-898.062) (-898.040) (-899.097) [-897.877] * (-901.614) [-896.920] (-899.674) (-901.893) -- 0:00:55
112500 -- [-897.276] (-899.289) (-897.929) (-898.666) * (-902.283) (-902.259) [-898.973] (-898.447) -- 0:01:03
113000 -- (-897.552) (-898.483) [-897.555] (-898.172) * (-900.584) (-898.777) (-900.600) [-899.089] -- 0:01:02
113500 -- [-899.429] (-901.262) (-899.235) (-898.778) * (-898.489) (-899.896) (-902.382) [-898.131] -- 0:01:02
114000 -- [-897.909] (-901.432) (-899.374) (-898.022) * (-900.701) [-897.462] (-902.656) (-902.651) -- 0:01:02
114500 -- (-898.083) (-897.903) (-898.752) [-899.845] * (-898.548) (-898.822) (-902.223) [-900.496] -- 0:01:01
115000 -- (-902.168) (-898.422) (-906.008) [-898.771] * (-899.669) [-898.309] (-900.275) (-901.430) -- 0:01:01
Average standard deviation of split frequencies: 0.023367
115500 -- (-901.052) [-897.425] (-902.467) (-898.839) * [-897.984] (-899.606) (-899.266) (-898.555) -- 0:01:01
116000 -- (-900.260) [-901.752] (-899.134) (-900.162) * [-897.120] (-900.323) (-898.068) (-898.066) -- 0:01:00
116500 -- (-898.619) (-902.158) (-899.513) [-897.923] * (-899.389) [-900.067] (-900.636) (-897.318) -- 0:01:00
117000 -- [-897.560] (-898.657) (-899.951) (-900.666) * [-898.677] (-900.065) (-901.613) (-901.079) -- 0:01:00
117500 -- (-899.417) [-897.408] (-898.635) (-897.003) * (-899.326) (-902.001) (-903.987) [-901.706] -- 0:01:00
118000 -- (-898.663) [-898.212] (-898.170) (-900.572) * (-899.258) [-901.026] (-902.475) (-903.554) -- 0:00:59
118500 -- (-900.972) [-900.201] (-899.066) (-900.752) * [-898.488] (-899.062) (-905.214) (-901.456) -- 0:00:59
119000 -- [-897.672] (-900.447) (-901.818) (-900.051) * [-899.879] (-898.842) (-900.870) (-899.918) -- 0:00:59
119500 -- (-897.635) [-899.873] (-898.058) (-901.690) * [-901.676] (-901.584) (-901.369) (-899.281) -- 0:00:58
120000 -- [-901.604] (-898.903) (-898.179) (-898.818) * (-899.750) (-899.268) (-900.594) [-901.428] -- 0:00:58
Average standard deviation of split frequencies: 0.024026
120500 -- (-901.453) (-898.553) (-899.479) [-898.003] * [-899.335] (-899.144) (-899.150) (-901.720) -- 0:00:58
121000 -- [-899.181] (-902.471) (-899.384) (-900.384) * (-900.989) (-898.862) (-897.907) [-899.778] -- 0:00:58
121500 -- (-900.095) (-901.991) (-899.221) [-898.734] * (-900.788) (-897.650) [-897.472] (-898.512) -- 0:00:57
122000 -- (-898.165) (-899.911) [-897.714] (-899.395) * (-898.619) (-898.950) (-897.395) [-899.496] -- 0:00:57
122500 -- (-898.971) [-898.856] (-897.647) (-897.758) * [-901.889] (-900.021) (-902.394) (-902.690) -- 0:00:57
123000 -- [-900.486] (-899.788) (-898.179) (-898.216) * (-901.369) (-899.736) [-903.802] (-901.672) -- 0:00:57
123500 -- [-900.031] (-897.556) (-899.860) (-898.650) * (-900.258) (-899.852) [-899.069] (-900.316) -- 0:00:56
124000 -- (-901.432) (-901.391) (-897.485) [-898.611] * (-901.430) (-901.128) [-897.920] (-898.332) -- 0:00:56
124500 -- [-899.531] (-900.557) (-897.441) (-899.174) * (-900.098) [-901.465] (-905.142) (-900.235) -- 0:00:56
125000 -- (-897.715) (-898.712) (-897.900) [-897.272] * [-902.242] (-903.085) (-902.683) (-898.184) -- 0:00:56
Average standard deviation of split frequencies: 0.023757
125500 -- [-900.280] (-898.905) (-897.493) (-897.769) * (-901.969) (-901.774) (-899.501) [-898.420] -- 0:00:55
126000 -- (-897.241) (-901.253) (-901.181) [-898.121] * (-900.002) [-901.259] (-899.272) (-897.638) -- 0:00:55
126500 -- [-898.111] (-902.098) (-902.824) (-899.034) * [-901.852] (-901.098) (-900.225) (-902.185) -- 0:00:55
127000 -- (-898.085) (-900.268) (-900.784) [-898.860] * [-899.960] (-899.692) (-899.840) (-901.910) -- 0:00:54
127500 -- (-898.649) (-900.404) (-899.384) [-899.117] * (-901.519) (-899.843) [-898.464] (-899.610) -- 0:00:54
128000 -- (-900.144) [-898.861] (-904.766) (-899.338) * (-897.890) (-902.657) [-900.112] (-898.636) -- 0:01:01
128500 -- (-898.680) (-898.300) [-897.070] (-900.478) * (-902.558) (-900.523) (-898.806) [-899.286] -- 0:01:01
129000 -- (-906.486) (-898.258) (-898.586) [-898.712] * (-898.446) (-902.620) (-899.044) [-899.286] -- 0:01:00
129500 -- (-899.387) (-899.621) (-904.811) [-900.376] * (-899.729) (-901.005) [-903.989] (-899.108) -- 0:01:00
130000 -- (-900.348) [-897.774] (-901.220) (-898.094) * (-899.081) (-900.482) (-903.053) [-898.937] -- 0:01:00
Average standard deviation of split frequencies: 0.023250
130500 -- (-899.466) [-897.503] (-900.873) (-899.678) * (-897.665) (-902.729) (-900.907) [-898.878] -- 0:00:59
131000 -- [-898.973] (-898.948) (-898.398) (-898.955) * [-898.947] (-899.677) (-900.030) (-898.803) -- 0:00:59
131500 -- (-900.376) (-897.797) [-900.592] (-900.778) * (-902.999) [-898.847] (-900.539) (-898.888) -- 0:00:59
132000 -- [-898.281] (-902.159) (-903.517) (-899.215) * (-903.347) (-897.837) [-898.848] (-898.892) -- 0:00:59
132500 -- (-898.537) [-902.730] (-901.187) (-898.646) * (-897.441) [-898.581] (-898.832) (-899.679) -- 0:00:58
133000 -- [-900.107] (-902.870) (-898.120) (-901.450) * (-899.290) (-901.233) [-899.190] (-897.987) -- 0:00:58
133500 -- [-897.642] (-904.418) (-900.029) (-899.056) * (-897.166) [-899.519] (-898.536) (-898.728) -- 0:00:58
134000 -- (-898.047) [-898.333] (-899.769) (-899.756) * [-897.160] (-902.496) (-898.392) (-900.037) -- 0:00:58
134500 -- [-897.748] (-896.977) (-899.192) (-898.504) * (-897.567) (-899.915) [-899.212] (-902.734) -- 0:00:57
135000 -- (-899.346) (-898.298) [-900.749] (-899.296) * (-899.861) [-903.041] (-898.203) (-900.404) -- 0:00:57
Average standard deviation of split frequencies: 0.021568
135500 -- (-897.774) (-899.760) (-903.439) [-898.534] * (-901.826) (-898.056) (-900.079) [-899.060] -- 0:00:57
136000 -- (-902.131) (-899.071) [-905.419] (-899.595) * (-902.108) (-899.331) (-899.030) [-899.318] -- 0:00:57
136500 -- (-898.513) (-898.031) [-899.503] (-898.998) * (-902.501) (-897.757) (-899.429) [-900.510] -- 0:00:56
137000 -- (-900.229) [-899.970] (-899.266) (-898.466) * (-900.194) (-897.630) [-899.873] (-898.758) -- 0:00:56
137500 -- (-907.156) [-899.395] (-899.465) (-898.960) * (-900.739) [-898.637] (-901.472) (-901.576) -- 0:00:56
138000 -- (-903.868) [-901.778] (-898.417) (-900.468) * (-900.692) (-898.883) (-899.117) [-900.209] -- 0:00:56
138500 -- [-896.938] (-901.120) (-898.159) (-898.775) * [-898.450] (-899.866) (-897.344) (-904.003) -- 0:00:55
139000 -- (-900.552) (-900.948) (-898.065) [-898.653] * (-897.787) [-898.738] (-899.609) (-900.065) -- 0:00:55
139500 -- (-902.824) [-897.615] (-897.360) (-900.468) * (-897.833) (-904.776) [-897.511] (-899.827) -- 0:00:55
140000 -- [-899.605] (-899.524) (-897.324) (-899.866) * (-902.611) (-898.669) [-897.721] (-900.337) -- 0:00:55
Average standard deviation of split frequencies: 0.019735
140500 -- [-904.549] (-904.195) (-899.641) (-899.464) * (-898.694) (-898.078) [-898.330] (-899.743) -- 0:00:55
141000 -- [-903.739] (-901.857) (-898.743) (-897.423) * (-899.226) (-898.520) [-897.955] (-899.151) -- 0:00:54
141500 -- (-898.860) (-899.047) [-899.695] (-900.940) * (-900.162) (-900.468) [-897.234] (-897.974) -- 0:00:54
142000 -- (-897.474) [-898.148] (-900.236) (-900.970) * [-898.983] (-900.285) (-897.713) (-898.164) -- 0:00:54
142500 -- [-897.433] (-899.889) (-903.234) (-902.338) * (-898.731) (-901.044) [-898.157] (-899.393) -- 0:00:54
143000 -- [-899.243] (-899.868) (-899.573) (-901.768) * (-899.799) (-901.201) [-899.446] (-899.178) -- 0:00:59
143500 -- (-901.168) (-897.331) (-903.943) [-898.743] * (-898.984) (-897.864) (-902.879) [-898.280] -- 0:00:59
144000 -- (-900.243) [-898.400] (-900.925) (-898.558) * (-898.686) (-899.023) [-900.945] (-898.465) -- 0:00:59
144500 -- (-901.099) (-904.080) (-897.594) [-899.686] * (-900.727) (-897.761) [-900.106] (-899.245) -- 0:00:59
145000 -- (-904.668) (-901.066) (-898.343) [-898.182] * (-899.083) (-897.044) [-898.088] (-898.863) -- 0:00:58
Average standard deviation of split frequencies: 0.021346
145500 -- [-898.530] (-899.800) (-897.471) (-900.728) * (-898.509) [-902.837] (-901.418) (-900.010) -- 0:00:58
146000 -- (-897.454) [-898.524] (-900.707) (-900.073) * (-898.417) (-902.397) (-899.927) [-900.190] -- 0:00:58
146500 -- (-897.995) (-898.632) (-900.740) [-897.862] * [-898.644] (-898.872) (-899.395) (-903.006) -- 0:00:58
147000 -- (-901.915) (-898.470) [-897.897] (-900.103) * [-899.999] (-899.433) (-900.715) (-900.160) -- 0:00:58
147500 -- [-904.613] (-899.104) (-903.447) (-899.228) * (-898.836) (-901.791) [-899.149] (-899.560) -- 0:00:57
148000 -- (-898.881) (-898.879) (-901.649) [-898.074] * (-900.244) (-897.675) (-898.924) [-899.512] -- 0:00:57
148500 -- (-900.697) (-899.273) [-898.753] (-897.167) * [-901.163] (-897.936) (-900.361) (-900.308) -- 0:00:57
149000 -- (-902.105) (-900.687) (-901.433) [-898.724] * [-900.064] (-899.235) (-901.264) (-899.465) -- 0:00:57
149500 -- [-897.987] (-902.372) (-901.856) (-899.502) * (-899.732) (-900.500) (-898.274) [-897.249] -- 0:00:56
150000 -- (-900.690) (-898.291) (-906.113) [-900.087] * (-901.875) (-900.313) [-898.561] (-897.771) -- 0:00:56
Average standard deviation of split frequencies: 0.019120
150500 -- (-897.957) [-900.094] (-903.232) (-897.610) * [-900.513] (-900.010) (-897.901) (-897.938) -- 0:00:56
151000 -- (-897.359) (-901.855) (-897.703) [-898.481] * (-900.599) (-899.370) (-899.908) [-900.198] -- 0:00:56
151500 -- (-900.688) (-902.326) (-896.883) [-897.302] * (-899.769) (-897.799) (-900.678) [-897.603] -- 0:00:56
152000 -- (-899.571) [-901.484] (-900.925) (-897.708) * (-898.089) [-902.545] (-898.614) (-903.646) -- 0:00:55
152500 -- (-898.285) (-901.881) [-897.888] (-901.694) * (-898.347) [-902.343] (-899.307) (-898.978) -- 0:00:55
153000 -- (-899.074) (-903.985) (-900.709) [-898.910] * [-898.227] (-899.136) (-900.571) (-898.371) -- 0:00:55
153500 -- [-897.551] (-901.173) (-900.310) (-898.914) * (-899.769) (-902.182) (-899.297) [-899.602] -- 0:00:55
154000 -- (-897.635) (-898.748) [-899.827] (-898.099) * (-900.762) [-901.373] (-897.869) (-897.118) -- 0:00:54
154500 -- (-898.620) [-900.505] (-899.117) (-898.307) * (-899.667) (-901.446) (-898.450) [-902.858] -- 0:00:54
155000 -- (-898.559) (-899.163) [-897.960] (-898.933) * (-899.877) (-901.987) (-898.514) [-898.230] -- 0:00:54
Average standard deviation of split frequencies: 0.019721
155500 -- (-898.949) (-898.608) (-903.025) [-899.423] * (-900.661) (-900.585) (-898.964) [-898.159] -- 0:00:54
156000 -- [-897.163] (-902.005) (-899.206) (-897.448) * (-899.361) (-897.716) [-903.287] (-900.501) -- 0:00:54
156500 -- (-903.931) (-898.018) (-898.215) [-897.448] * [-897.637] (-897.448) (-900.361) (-902.017) -- 0:00:53
157000 -- (-900.897) [-898.059] (-898.181) (-898.174) * (-899.165) (-899.592) [-898.142] (-900.389) -- 0:00:53
157500 -- [-900.109] (-898.940) (-898.223) (-901.624) * [-899.876] (-897.770) (-897.518) (-899.305) -- 0:00:53
158000 -- (-898.348) [-898.023] (-898.886) (-900.505) * (-898.527) (-897.825) [-898.098] (-900.081) -- 0:00:58
158500 -- [-898.504] (-898.831) (-904.595) (-899.086) * (-903.487) [-897.115] (-901.378) (-898.039) -- 0:00:58
159000 -- (-900.624) [-897.041] (-900.869) (-901.073) * (-904.662) (-902.522) [-901.773] (-899.046) -- 0:00:58
159500 -- [-899.211] (-897.201) (-903.547) (-902.665) * (-903.043) (-901.813) [-902.359] (-899.672) -- 0:00:57
160000 -- (-901.018) (-897.201) [-899.988] (-900.147) * (-900.734) [-898.888] (-902.025) (-899.622) -- 0:00:57
Average standard deviation of split frequencies: 0.016914
160500 -- (-900.677) (-898.684) (-899.499) [-899.961] * [-899.189] (-899.799) (-898.217) (-898.679) -- 0:00:57
161000 -- (-899.644) (-901.689) [-897.389] (-898.415) * [-898.776] (-898.488) (-898.871) (-898.970) -- 0:00:57
161500 -- [-903.417] (-901.223) (-899.046) (-900.754) * (-898.350) (-901.039) (-901.049) [-897.935] -- 0:00:57
162000 -- (-901.741) (-899.458) [-898.689] (-900.548) * (-897.517) (-900.048) (-902.070) [-897.906] -- 0:00:56
162500 -- (-900.093) (-898.679) [-898.734] (-898.706) * (-898.946) [-898.334] (-898.200) (-897.236) -- 0:00:56
163000 -- (-902.306) [-900.438] (-909.754) (-899.506) * [-900.695] (-900.123) (-899.964) (-898.638) -- 0:00:56
163500 -- (-902.312) [-900.114] (-897.738) (-900.317) * (-901.468) (-899.318) [-899.606] (-907.250) -- 0:00:56
164000 -- (-901.494) [-900.448] (-897.674) (-899.157) * (-901.374) (-899.547) [-899.126] (-901.737) -- 0:00:56
164500 -- (-899.668) (-900.227) [-899.355] (-899.146) * (-897.007) (-898.979) [-898.879] (-897.613) -- 0:00:55
165000 -- [-897.895] (-900.237) (-903.691) (-900.455) * (-898.754) (-898.429) [-896.979] (-897.613) -- 0:00:55
Average standard deviation of split frequencies: 0.017039
165500 -- (-899.983) (-898.362) (-902.865) [-901.238] * (-899.071) (-902.774) (-898.775) [-898.440] -- 0:00:55
166000 -- (-899.997) (-901.637) (-898.128) [-897.420] * (-900.482) [-899.834] (-901.036) (-900.801) -- 0:00:55
166500 -- (-898.699) (-902.920) [-898.476] (-903.020) * [-899.193] (-897.880) (-902.356) (-901.085) -- 0:00:55
167000 -- (-899.702) (-908.714) [-901.040] (-897.354) * (-900.725) (-898.596) [-898.665] (-897.003) -- 0:00:54
167500 -- (-899.854) [-899.827] (-899.546) (-901.521) * (-900.026) (-900.944) [-898.379] (-898.172) -- 0:00:54
168000 -- (-899.272) [-898.346] (-897.779) (-900.334) * (-905.801) (-901.558) [-897.574] (-897.374) -- 0:00:54
168500 -- (-900.545) (-898.231) [-898.849] (-902.196) * (-900.559) (-900.394) [-901.006] (-896.959) -- 0:00:54
169000 -- (-900.747) (-897.981) [-897.479] (-899.189) * (-901.170) [-899.624] (-898.174) (-899.694) -- 0:00:54
169500 -- (-899.104) [-897.221] (-897.802) (-897.888) * [-898.630] (-898.740) (-899.183) (-901.052) -- 0:00:53
170000 -- (-901.021) (-897.854) [-897.649] (-897.060) * (-898.322) (-899.263) [-898.998] (-902.487) -- 0:00:53
Average standard deviation of split frequencies: 0.014578
170500 -- [-900.368] (-898.537) (-899.680) (-900.427) * (-898.385) (-899.898) [-897.264] (-898.506) -- 0:00:53
171000 -- (-898.274) (-901.128) (-898.381) [-897.980] * [-899.163] (-900.835) (-897.279) (-897.722) -- 0:00:53
171500 -- [-897.992] (-898.375) (-897.983) (-899.099) * (-898.011) (-900.143) [-897.159] (-898.969) -- 0:00:53
172000 -- [-898.192] (-897.657) (-899.259) (-900.755) * (-898.700) [-900.444] (-898.214) (-898.257) -- 0:00:52
172500 -- (-901.829) [-900.543] (-897.227) (-898.754) * (-899.081) [-899.042] (-903.885) (-902.759) -- 0:00:52
173000 -- (-898.330) (-900.692) [-899.012] (-897.847) * [-898.442] (-898.086) (-899.023) (-898.332) -- 0:00:57
173500 -- (-898.145) (-901.297) (-899.055) [-899.210] * [-899.250] (-897.730) (-898.335) (-897.465) -- 0:00:57
174000 -- (-898.688) (-898.275) [-901.080] (-899.512) * (-898.675) [-899.665] (-897.424) (-897.049) -- 0:00:56
174500 -- [-897.851] (-902.585) (-898.240) (-899.624) * (-902.243) [-899.853] (-901.247) (-897.083) -- 0:00:56
175000 -- [-901.170] (-898.497) (-898.391) (-899.883) * (-900.268) [-898.729] (-899.474) (-898.562) -- 0:00:56
Average standard deviation of split frequencies: 0.014583
175500 -- (-901.067) (-900.014) (-902.423) [-900.802] * (-897.430) (-898.182) [-897.406] (-900.320) -- 0:00:56
176000 -- [-897.862] (-900.526) (-904.713) (-901.172) * (-899.425) (-897.197) [-898.019] (-899.477) -- 0:00:56
176500 -- (-898.251) (-899.806) [-899.062] (-899.319) * [-897.771] (-898.612) (-898.688) (-897.524) -- 0:00:55
177000 -- (-900.394) (-903.003) [-901.670] (-902.299) * (-898.506) [-898.450] (-899.913) (-897.504) -- 0:00:55
177500 -- (-901.532) (-898.081) [-899.584] (-904.111) * (-899.687) (-898.420) (-900.484) [-898.596] -- 0:00:55
178000 -- (-899.831) (-899.471) (-900.120) [-900.495] * (-900.604) (-898.105) (-902.030) [-898.616] -- 0:00:55
178500 -- (-898.562) (-901.813) [-899.658] (-898.001) * [-898.753] (-899.230) (-899.459) (-901.895) -- 0:00:55
179000 -- (-898.673) (-898.397) [-903.046] (-897.898) * (-897.708) [-901.355] (-901.124) (-901.408) -- 0:00:55
179500 -- (-899.885) [-898.593] (-902.273) (-898.913) * (-906.482) [-897.530] (-897.996) (-899.047) -- 0:00:54
180000 -- [-898.066] (-897.995) (-900.408) (-900.328) * (-905.037) [-898.814] (-901.476) (-897.033) -- 0:00:54
Average standard deviation of split frequencies: 0.014735
180500 -- [-900.993] (-899.473) (-897.522) (-898.823) * [-898.577] (-901.010) (-902.375) (-897.852) -- 0:00:54
181000 -- (-898.316) (-897.908) [-898.409] (-898.956) * (-900.097) (-899.800) (-901.460) [-897.769] -- 0:00:54
181500 -- (-898.163) [-897.455] (-898.753) (-900.532) * (-899.263) (-899.933) (-900.424) [-899.390] -- 0:00:54
182000 -- [-902.997] (-898.783) (-899.654) (-899.544) * (-899.848) (-898.399) (-899.692) [-897.886] -- 0:00:53
182500 -- (-898.448) (-903.367) (-901.330) [-898.525] * (-899.424) [-899.615] (-899.331) (-898.316) -- 0:00:53
183000 -- (-898.901) [-898.837] (-898.804) (-898.105) * (-898.804) [-902.402] (-900.943) (-900.667) -- 0:00:53
183500 -- (-899.619) [-898.356] (-898.907) (-898.789) * (-899.253) (-898.637) [-899.338] (-904.963) -- 0:00:53
184000 -- (-901.424) (-897.064) [-897.776] (-899.960) * [-900.265] (-899.283) (-899.441) (-901.105) -- 0:00:53
184500 -- (-898.525) [-896.937] (-898.849) (-900.545) * [-899.191] (-898.664) (-897.389) (-898.704) -- 0:00:53
185000 -- (-899.588) [-897.807] (-897.181) (-898.403) * [-899.809] (-900.963) (-901.317) (-899.693) -- 0:00:52
Average standard deviation of split frequencies: 0.014139
185500 -- [-901.270] (-898.358) (-897.269) (-901.416) * [-904.894] (-899.659) (-901.203) (-898.635) -- 0:00:52
186000 -- [-898.603] (-900.390) (-897.123) (-899.733) * [-900.921] (-897.461) (-905.247) (-898.617) -- 0:00:52
186500 -- (-899.150) (-900.225) (-897.364) [-899.098] * (-902.083) [-898.513] (-902.235) (-898.043) -- 0:00:52
187000 -- (-898.663) (-900.390) [-896.929] (-903.463) * (-900.756) (-897.884) (-899.372) [-897.752] -- 0:00:52
187500 -- [-897.282] (-899.537) (-899.194) (-900.106) * (-898.326) (-900.031) (-897.757) [-897.940] -- 0:00:52
188000 -- [-899.718] (-899.566) (-898.516) (-907.421) * [-902.797] (-900.032) (-898.338) (-901.468) -- 0:00:51
188500 -- (-897.208) [-899.354] (-898.063) (-909.260) * (-901.706) [-902.328] (-897.692) (-898.186) -- 0:00:55
189000 -- (-898.499) (-899.786) [-898.417] (-903.285) * (-901.378) [-902.380] (-899.061) (-899.607) -- 0:00:55
189500 -- (-897.371) (-899.458) [-897.648] (-897.214) * [-898.725] (-899.478) (-899.533) (-898.389) -- 0:00:55
190000 -- (-904.115) (-898.971) [-900.068] (-898.457) * (-900.209) (-898.544) [-897.776] (-902.783) -- 0:00:55
Average standard deviation of split frequencies: 0.012499
190500 -- [-898.931] (-902.226) (-900.369) (-897.302) * (-899.245) [-898.375] (-900.608) (-900.173) -- 0:00:55
191000 -- [-897.061] (-902.081) (-900.458) (-898.410) * [-900.281] (-900.729) (-898.729) (-899.631) -- 0:00:55
191500 -- (-898.658) (-899.226) [-898.270] (-898.179) * (-900.235) (-898.234) (-898.985) [-902.856] -- 0:00:54
192000 -- (-898.429) (-899.317) (-902.732) [-899.672] * (-898.760) [-899.301] (-898.420) (-898.652) -- 0:00:54
192500 -- (-899.900) [-898.070] (-902.567) (-899.200) * (-903.079) (-898.745) [-899.387] (-898.201) -- 0:00:54
193000 -- (-901.704) (-900.440) [-901.702] (-900.590) * [-898.673] (-899.197) (-898.673) (-898.264) -- 0:00:54
193500 -- [-899.568] (-903.117) (-900.748) (-904.567) * (-898.116) [-900.194] (-901.063) (-898.056) -- 0:00:54
194000 -- (-897.251) (-902.334) (-901.819) [-902.026] * (-901.107) (-900.079) [-897.972] (-900.677) -- 0:00:54
194500 -- (-899.499) (-898.343) [-898.767] (-901.367) * (-899.023) [-898.391] (-899.728) (-899.706) -- 0:00:53
195000 -- (-899.423) [-899.371] (-897.097) (-901.179) * (-899.005) [-898.200] (-903.832) (-902.831) -- 0:00:53
Average standard deviation of split frequencies: 0.012450
195500 -- (-899.318) (-900.981) (-897.899) [-898.509] * [-904.111] (-898.105) (-898.824) (-900.419) -- 0:00:53
196000 -- (-899.611) [-901.200] (-900.608) (-902.124) * (-899.055) (-899.388) [-902.764] (-900.878) -- 0:00:53
196500 -- [-899.330] (-897.904) (-897.603) (-898.961) * (-899.766) (-904.273) [-899.978] (-900.322) -- 0:00:53
197000 -- (-901.352) [-898.087] (-901.807) (-899.295) * [-901.232] (-905.479) (-903.015) (-901.928) -- 0:00:52
197500 -- (-899.552) [-901.160] (-901.375) (-898.794) * [-901.560] (-905.042) (-898.361) (-901.917) -- 0:00:52
198000 -- (-898.980) (-898.572) (-902.228) [-899.574] * (-901.010) [-901.047] (-899.544) (-900.297) -- 0:00:52
198500 -- [-898.945] (-898.180) (-903.024) (-898.169) * (-900.569) (-898.612) (-899.024) [-899.609] -- 0:00:52
199000 -- (-902.826) (-898.087) [-898.386] (-900.640) * (-898.097) (-898.009) [-896.889] (-899.585) -- 0:00:52
199500 -- (-903.481) [-898.649] (-901.284) (-898.839) * [-898.356] (-898.284) (-898.523) (-899.397) -- 0:00:52
200000 -- (-901.831) (-901.005) [-899.321] (-900.628) * (-901.569) (-902.810) [-898.954] (-900.067) -- 0:00:51
Average standard deviation of split frequencies: 0.012437
200500 -- (-902.712) (-899.365) [-897.341] (-899.457) * (-902.080) [-897.358] (-898.337) (-899.002) -- 0:00:51
201000 -- (-900.507) (-904.654) [-897.601] (-901.531) * (-901.747) (-898.798) [-899.889] (-899.550) -- 0:00:51
201500 -- [-903.332] (-901.543) (-897.077) (-898.407) * [-898.480] (-899.604) (-899.776) (-898.538) -- 0:00:51
202000 -- (-902.165) (-903.701) (-897.613) [-896.805] * (-902.008) [-899.800] (-899.525) (-898.917) -- 0:00:51
202500 -- (-901.735) (-898.149) (-897.093) [-896.793] * [-903.604] (-898.852) (-897.250) (-901.892) -- 0:00:51
203000 -- (-897.775) (-897.679) [-898.178] (-897.127) * [-897.941] (-898.126) (-899.877) (-899.961) -- 0:00:51
203500 -- (-899.514) [-897.157] (-900.440) (-898.994) * [-899.491] (-901.243) (-900.220) (-899.961) -- 0:00:50
204000 -- (-902.243) [-896.811] (-899.469) (-898.241) * (-900.100) (-899.686) (-901.446) [-900.199] -- 0:00:54
204500 -- (-898.124) (-896.808) (-898.146) [-897.549] * (-897.858) (-897.577) (-901.571) [-897.723] -- 0:00:54
205000 -- (-903.295) (-897.699) (-898.368) [-897.288] * (-899.719) (-900.002) [-897.777] (-898.421) -- 0:00:54
Average standard deviation of split frequencies: 0.011980
205500 -- (-902.744) (-899.286) [-898.415] (-899.176) * [-898.102] (-899.219) (-898.286) (-897.951) -- 0:00:54
206000 -- (-898.431) [-899.394] (-898.227) (-897.894) * (-900.323) (-899.950) [-898.394] (-901.950) -- 0:00:53
206500 -- [-897.916] (-899.676) (-897.734) (-899.965) * (-900.046) [-900.548] (-897.654) (-897.312) -- 0:00:53
207000 -- (-898.318) [-899.374] (-898.891) (-899.164) * [-897.596] (-898.424) (-898.523) (-898.961) -- 0:00:53
207500 -- [-901.040] (-903.710) (-900.886) (-898.507) * (-900.971) [-904.547] (-898.591) (-899.451) -- 0:00:53
208000 -- (-899.856) [-897.793] (-903.107) (-899.561) * (-899.012) (-898.988) [-899.086] (-903.542) -- 0:00:53
208500 -- (-901.158) (-897.392) (-902.746) [-902.306] * (-898.350) (-897.463) [-899.127] (-898.298) -- 0:00:53
209000 -- (-901.900) (-898.121) (-900.320) [-899.824] * (-906.541) (-899.619) [-899.899] (-898.078) -- 0:00:52
209500 -- (-903.118) (-897.763) (-897.906) [-898.196] * (-900.713) (-898.091) [-898.689] (-901.930) -- 0:00:52
210000 -- [-898.197] (-897.103) (-899.444) (-901.401) * (-900.664) (-897.825) (-902.809) [-897.978] -- 0:00:52
Average standard deviation of split frequencies: 0.011057
210500 -- (-898.458) (-898.072) [-899.930] (-902.841) * [-899.423] (-897.199) (-901.621) (-899.220) -- 0:00:52
211000 -- (-902.368) (-899.983) [-900.137] (-902.238) * (-904.070) (-898.447) [-899.726] (-899.995) -- 0:00:52
211500 -- [-900.741] (-898.082) (-901.456) (-902.960) * (-899.946) [-898.455] (-901.221) (-896.881) -- 0:00:52
212000 -- (-900.663) [-898.489] (-901.777) (-901.109) * (-899.275) (-897.922) [-902.536] (-898.215) -- 0:00:52
212500 -- (-902.686) [-899.036] (-898.234) (-899.361) * (-899.812) (-897.264) [-897.384] (-898.684) -- 0:00:51
213000 -- (-899.230) (-898.413) (-897.486) [-900.739] * (-902.190) (-899.199) [-898.045] (-897.616) -- 0:00:51
213500 -- (-898.613) [-897.794] (-898.032) (-901.899) * (-903.803) (-898.198) [-898.425] (-897.199) -- 0:00:51
214000 -- (-898.898) (-899.125) [-897.379] (-897.805) * (-902.076) [-899.944] (-898.266) (-899.620) -- 0:00:51
214500 -- (-898.770) [-898.602] (-897.195) (-900.522) * [-899.657] (-900.757) (-899.966) (-899.241) -- 0:00:51
215000 -- (-899.558) (-899.674) (-898.791) [-899.031] * (-899.507) [-902.287] (-900.673) (-899.276) -- 0:00:51
Average standard deviation of split frequencies: 0.011882
215500 -- [-899.297] (-898.345) (-897.228) (-899.121) * [-900.880] (-901.597) (-898.719) (-902.001) -- 0:00:50
216000 -- (-902.617) (-902.278) [-898.147] (-903.384) * (-900.138) [-899.866] (-900.868) (-897.717) -- 0:00:50
216500 -- (-905.370) (-901.985) [-897.922] (-899.674) * (-897.918) (-898.517) (-900.546) [-897.268] -- 0:00:50
217000 -- (-899.863) [-900.679] (-898.000) (-901.450) * (-899.157) (-897.702) (-898.606) [-897.242] -- 0:00:50
217500 -- [-899.071] (-898.946) (-898.261) (-901.803) * (-904.527) [-904.059] (-899.674) (-897.168) -- 0:00:50
218000 -- (-898.051) [-900.820] (-902.370) (-897.390) * (-902.914) (-897.209) (-899.542) [-898.079] -- 0:00:50
218500 -- (-899.623) (-901.020) [-899.402] (-896.897) * [-905.666] (-902.897) (-896.992) (-901.764) -- 0:00:50
219000 -- (-897.205) [-897.974] (-899.596) (-898.108) * (-900.853) [-897.204] (-901.338) (-900.018) -- 0:00:49
219500 -- (-896.983) (-898.256) [-900.033] (-907.148) * (-901.478) (-896.949) [-899.739] (-898.901) -- 0:00:53
220000 -- (-897.047) (-898.542) [-900.261] (-897.644) * (-900.130) (-897.108) [-898.742] (-898.669) -- 0:00:53
Average standard deviation of split frequencies: 0.011868
220500 -- [-897.391] (-899.776) (-899.373) (-897.799) * [-898.548] (-898.386) (-897.647) (-899.504) -- 0:00:53
221000 -- [-898.195] (-899.168) (-901.756) (-900.320) * (-897.884) [-897.752] (-899.421) (-897.898) -- 0:00:52
221500 -- (-897.403) (-900.216) (-898.476) [-900.018] * [-900.145] (-898.145) (-899.393) (-903.446) -- 0:00:52
222000 -- [-897.292] (-897.641) (-902.810) (-899.160) * (-899.753) [-897.352] (-899.218) (-898.950) -- 0:00:52
222500 -- [-900.911] (-897.570) (-903.539) (-899.536) * (-899.599) (-898.548) [-898.764] (-898.871) -- 0:00:52
223000 -- (-905.633) (-898.806) [-898.293] (-897.546) * (-899.405) (-900.589) [-898.104] (-900.695) -- 0:00:52
223500 -- (-899.005) [-900.544] (-898.044) (-904.349) * [-899.558] (-898.810) (-898.483) (-899.285) -- 0:00:52
224000 -- (-900.707) (-898.637) (-897.574) [-901.468] * (-899.515) (-899.438) [-897.151] (-900.242) -- 0:00:51
224500 -- (-898.965) (-899.023) (-899.333) [-901.530] * (-898.532) [-899.059] (-904.049) (-897.541) -- 0:00:51
225000 -- (-900.151) (-901.194) (-900.530) [-901.939] * (-898.602) [-899.622] (-902.356) (-899.613) -- 0:00:51
Average standard deviation of split frequencies: 0.011820
225500 -- (-897.764) [-899.745] (-901.516) (-902.332) * (-899.853) (-899.503) (-904.727) [-899.312] -- 0:00:51
226000 -- [-900.165] (-900.741) (-901.448) (-899.972) * (-898.532) (-898.269) [-902.320] (-898.474) -- 0:00:51
226500 -- (-899.526) (-909.522) (-898.305) [-898.503] * (-900.918) [-898.297] (-898.134) (-897.940) -- 0:00:51
227000 -- [-897.887] (-900.321) (-898.410) (-903.769) * (-900.825) (-897.747) (-899.975) [-897.704] -- 0:00:51
227500 -- (-900.041) (-899.763) (-898.243) [-897.797] * (-899.593) [-900.319] (-900.659) (-899.112) -- 0:00:50
228000 -- (-896.886) (-898.730) (-898.363) [-897.226] * (-898.581) (-900.740) (-897.462) [-897.946] -- 0:00:50
228500 -- (-897.986) (-897.886) [-900.452] (-897.565) * (-899.305) [-898.610] (-897.501) (-899.169) -- 0:00:50
229000 -- [-899.188] (-898.333) (-906.146) (-898.587) * (-901.978) (-897.891) [-897.901] (-899.244) -- 0:00:50
229500 -- (-899.926) (-897.978) (-898.023) [-899.695] * (-898.283) (-900.071) (-896.950) [-900.657] -- 0:00:50
230000 -- (-905.767) [-897.751] (-899.660) (-899.565) * (-901.565) (-901.750) (-899.386) [-898.951] -- 0:00:50
Average standard deviation of split frequencies: 0.010579
230500 -- [-902.935] (-897.831) (-901.825) (-900.010) * (-901.139) [-898.627] (-898.089) (-897.976) -- 0:00:50
231000 -- (-898.539) (-897.669) (-897.953) [-899.934] * (-899.200) (-899.002) [-899.352] (-897.705) -- 0:00:49
231500 -- [-898.312] (-899.498) (-897.927) (-903.202) * [-899.093] (-899.247) (-899.170) (-897.663) -- 0:00:49
232000 -- [-898.184] (-899.088) (-897.852) (-899.685) * (-902.105) (-899.164) [-897.996] (-898.775) -- 0:00:49
232500 -- [-898.914] (-902.517) (-900.178) (-901.441) * (-899.676) (-899.739) [-898.199] (-897.613) -- 0:00:49
233000 -- (-898.070) (-902.075) (-900.312) [-897.558] * (-902.719) (-897.929) [-897.640] (-896.935) -- 0:00:49
233500 -- (-898.418) (-903.313) (-897.455) [-897.807] * (-897.498) (-900.734) (-898.190) [-897.848] -- 0:00:49
234000 -- (-898.571) (-898.080) (-897.497) [-900.125] * [-902.150] (-902.564) (-900.768) (-897.494) -- 0:00:49
234500 -- (-898.599) (-901.099) [-897.606] (-900.381) * (-898.152) (-899.200) [-899.087] (-901.489) -- 0:00:52
235000 -- (-900.188) [-900.688] (-898.162) (-900.865) * (-900.570) (-898.470) [-898.735] (-899.123) -- 0:00:52
Average standard deviation of split frequencies: 0.010340
235500 -- (-901.306) [-901.502] (-900.903) (-899.620) * [-899.623] (-900.464) (-898.045) (-901.577) -- 0:00:51
236000 -- (-900.387) (-899.438) [-900.575] (-897.666) * [-898.854] (-898.972) (-898.579) (-899.189) -- 0:00:51
236500 -- (-897.340) (-900.964) (-898.377) [-899.561] * (-903.247) (-898.716) [-897.991] (-897.894) -- 0:00:51
237000 -- (-897.570) (-900.220) [-899.711] (-903.721) * (-899.751) [-898.172] (-899.191) (-897.965) -- 0:00:51
237500 -- (-898.989) [-897.920] (-898.053) (-899.361) * (-904.486) (-898.749) [-897.962] (-899.621) -- 0:00:51
238000 -- (-901.533) (-898.437) [-898.973] (-903.038) * (-900.119) (-901.151) [-897.659] (-900.650) -- 0:00:51
238500 -- (-901.316) [-901.953] (-901.555) (-900.290) * [-897.986] (-901.649) (-897.965) (-901.181) -- 0:00:51
239000 -- (-899.033) (-897.300) (-899.774) [-897.184] * (-899.142) [-901.486] (-905.557) (-902.320) -- 0:00:50
239500 -- [-897.829] (-904.996) (-899.873) (-897.361) * [-898.427] (-897.887) (-900.011) (-897.930) -- 0:00:50
240000 -- [-899.413] (-904.153) (-900.528) (-905.346) * (-901.273) [-899.148] (-899.191) (-906.890) -- 0:00:50
Average standard deviation of split frequencies: 0.011752
240500 -- (-898.880) (-899.802) [-899.804] (-901.689) * (-899.713) [-899.427] (-899.605) (-903.290) -- 0:00:50
241000 -- (-905.021) (-901.158) [-899.289] (-897.777) * (-899.289) [-898.769] (-898.811) (-901.283) -- 0:00:50
241500 -- [-901.086] (-899.691) (-900.847) (-901.718) * [-899.562] (-902.119) (-900.389) (-897.008) -- 0:00:50
242000 -- (-900.933) (-898.413) (-902.590) [-898.887] * (-898.734) (-902.864) [-897.158] (-897.225) -- 0:00:50
242500 -- (-900.522) (-898.095) [-900.377] (-897.564) * (-899.188) (-901.420) (-899.439) [-898.297] -- 0:00:49
243000 -- (-897.617) (-898.461) (-899.100) [-896.969] * (-899.405) [-901.634] (-900.008) (-897.617) -- 0:00:49
243500 -- (-897.608) [-901.051] (-901.403) (-898.714) * (-897.541) [-898.285] (-900.467) (-897.120) -- 0:00:49
244000 -- (-898.686) [-900.585] (-900.684) (-900.817) * [-897.170] (-898.733) (-898.405) (-897.065) -- 0:00:49
244500 -- (-898.684) (-900.646) [-904.852] (-898.536) * [-898.306] (-898.728) (-899.187) (-900.603) -- 0:00:49
245000 -- (-897.751) (-900.897) [-897.769] (-901.029) * [-897.417] (-897.915) (-900.416) (-904.440) -- 0:00:49
Average standard deviation of split frequencies: 0.011617
245500 -- (-898.553) (-898.847) (-901.375) [-898.738] * (-897.759) [-898.162] (-900.356) (-898.873) -- 0:00:49
246000 -- (-898.968) [-897.502] (-900.195) (-901.540) * (-899.149) [-900.316] (-900.757) (-899.765) -- 0:00:49
246500 -- (-901.531) (-901.855) [-904.450] (-900.757) * (-899.433) (-900.774) [-900.405] (-901.955) -- 0:00:48
247000 -- [-900.794] (-902.242) (-898.671) (-900.877) * (-898.011) (-900.271) [-897.335] (-898.627) -- 0:00:48
247500 -- (-901.661) (-897.547) [-898.352] (-900.753) * (-902.407) (-902.608) [-898.338] (-900.349) -- 0:00:48
248000 -- (-901.919) [-898.747] (-898.379) (-898.158) * (-901.370) [-900.680] (-899.089) (-899.996) -- 0:00:48
248500 -- [-899.679] (-898.292) (-897.960) (-898.158) * (-900.374) (-902.171) [-897.588] (-901.093) -- 0:00:48
249000 -- (-897.923) [-897.706] (-897.515) (-898.096) * (-899.369) [-899.374] (-901.195) (-897.891) -- 0:00:48
249500 -- (-896.951) [-898.112] (-897.601) (-898.446) * [-897.653] (-897.190) (-899.413) (-899.369) -- 0:00:48
250000 -- (-898.780) (-898.240) (-897.987) [-899.269] * (-899.592) (-898.814) (-899.606) [-898.296] -- 0:00:51
Average standard deviation of split frequencies: 0.012106
250500 -- [-897.875] (-898.499) (-897.877) (-898.586) * (-901.150) [-898.077] (-901.476) (-899.335) -- 0:00:50
251000 -- (-897.565) (-898.540) [-898.287] (-898.709) * (-901.159) (-898.583) [-898.165] (-904.048) -- 0:00:50
251500 -- (-900.946) (-900.777) [-897.738] (-898.333) * (-900.294) (-899.496) [-898.132] (-899.200) -- 0:00:50
252000 -- (-898.996) (-901.180) [-898.415] (-902.271) * [-897.501] (-901.528) (-901.003) (-899.904) -- 0:00:50
252500 -- (-898.001) (-898.701) (-899.951) [-899.798] * [-901.620] (-901.671) (-897.479) (-900.402) -- 0:00:50
253000 -- (-903.635) (-902.203) (-898.346) [-897.670] * [-898.023] (-899.301) (-897.983) (-900.961) -- 0:00:50
253500 -- [-898.359] (-899.740) (-899.132) (-903.030) * (-897.824) (-902.190) [-897.737] (-902.744) -- 0:00:50
254000 -- (-900.605) (-899.949) (-900.811) [-902.823] * (-897.824) [-899.150] (-899.615) (-900.493) -- 0:00:49
254500 -- (-898.982) (-898.709) (-903.162) [-900.248] * (-898.675) (-901.235) [-897.499] (-897.876) -- 0:00:49
255000 -- (-898.467) [-901.039] (-899.831) (-901.524) * (-897.263) [-898.539] (-901.576) (-898.223) -- 0:00:49
Average standard deviation of split frequencies: 0.013465
255500 -- (-899.452) [-897.384] (-898.359) (-900.598) * (-899.609) [-897.621] (-897.398) (-898.273) -- 0:00:49
256000 -- [-900.749] (-903.596) (-897.950) (-902.117) * (-900.050) [-898.918] (-897.750) (-901.661) -- 0:00:49
256500 -- (-899.047) (-903.801) [-898.132] (-900.625) * (-899.522) (-897.356) (-901.180) [-898.416] -- 0:00:49
257000 -- (-898.028) (-899.172) (-898.454) [-900.505] * [-897.917] (-897.909) (-897.830) (-898.346) -- 0:00:49
257500 -- [-899.542] (-898.664) (-898.748) (-900.014) * (-902.168) [-897.279] (-901.108) (-898.359) -- 0:00:49
258000 -- (-902.220) [-900.347] (-899.880) (-898.706) * (-901.893) [-897.606] (-897.631) (-898.876) -- 0:00:48
258500 -- (-903.581) (-898.186) [-898.301] (-898.624) * [-899.287] (-897.605) (-899.580) (-899.436) -- 0:00:48
259000 -- [-900.859] (-900.718) (-901.179) (-905.725) * (-897.984) (-901.302) [-899.231] (-897.970) -- 0:00:48
259500 -- (-903.099) (-901.380) (-899.440) [-900.181] * (-899.101) (-903.669) [-897.994] (-901.975) -- 0:00:48
260000 -- (-900.821) (-898.827) [-900.603] (-897.873) * (-901.363) (-901.320) [-899.836] (-898.339) -- 0:00:48
Average standard deviation of split frequencies: 0.014242
260500 -- [-899.068] (-900.043) (-899.806) (-901.583) * (-899.198) (-902.581) (-898.900) [-897.928] -- 0:00:48
261000 -- (-900.727) [-899.419] (-898.704) (-899.543) * (-900.777) [-903.787] (-900.371) (-900.589) -- 0:00:48
261500 -- (-898.134) [-898.009] (-898.346) (-898.982) * (-900.059) [-897.675] (-901.003) (-898.172) -- 0:00:48
262000 -- [-898.872] (-897.241) (-898.542) (-898.752) * (-897.585) (-898.775) (-898.731) [-897.737] -- 0:00:47
262500 -- (-899.835) (-900.276) [-899.040] (-900.665) * (-897.228) [-898.556] (-899.773) (-899.243) -- 0:00:47
263000 -- [-897.980] (-898.142) (-900.998) (-897.947) * (-897.701) (-900.745) (-900.542) [-902.292] -- 0:00:47
263500 -- (-900.207) (-898.269) [-901.030] (-901.519) * (-903.164) (-900.286) (-900.259) [-901.444] -- 0:00:47
264000 -- (-897.976) (-897.157) (-901.143) [-898.006] * (-904.767) [-900.491] (-900.546) (-900.002) -- 0:00:47
264500 -- (-902.934) (-898.700) [-898.071] (-900.765) * [-899.901] (-897.534) (-899.840) (-900.348) -- 0:00:47
265000 -- (-903.475) [-897.952] (-897.861) (-900.931) * [-897.627] (-898.811) (-899.257) (-900.902) -- 0:00:47
Average standard deviation of split frequencies: 0.013735
265500 -- (-902.497) [-900.976] (-899.088) (-904.857) * (-900.367) (-901.197) [-898.864] (-900.277) -- 0:00:49
266000 -- (-898.800) [-897.507] (-900.575) (-899.876) * (-903.807) (-901.177) [-900.085] (-902.739) -- 0:00:49
266500 -- [-901.921] (-898.472) (-899.460) (-900.267) * [-902.156] (-902.513) (-904.877) (-899.997) -- 0:00:49
267000 -- (-898.235) [-898.746] (-900.318) (-899.620) * (-904.077) [-899.089] (-901.554) (-899.930) -- 0:00:49
267500 -- [-898.692] (-897.247) (-902.495) (-897.671) * (-902.644) [-900.098] (-897.936) (-898.272) -- 0:00:49
268000 -- (-897.743) (-898.567) [-899.290] (-897.628) * (-905.926) [-900.420] (-898.210) (-897.880) -- 0:00:49
268500 -- (-898.507) (-898.001) [-898.691] (-897.956) * (-901.537) (-899.676) [-899.552] (-898.133) -- 0:00:49
269000 -- (-897.388) (-900.066) [-899.305] (-898.220) * (-901.946) (-898.894) [-897.923] (-899.422) -- 0:00:48
269500 -- (-899.456) (-899.585) (-899.127) [-898.323] * (-902.657) (-900.197) (-900.521) [-899.006] -- 0:00:48
270000 -- (-899.625) [-897.811] (-899.827) (-897.704) * (-898.907) (-898.697) [-898.825] (-898.855) -- 0:00:48
Average standard deviation of split frequencies: 0.013607
270500 -- (-899.071) [-897.796] (-903.485) (-900.526) * (-897.768) [-898.621] (-898.228) (-898.647) -- 0:00:48
271000 -- (-901.985) [-899.147] (-898.299) (-898.624) * (-901.618) [-898.131] (-904.328) (-897.489) -- 0:00:48
271500 -- (-899.515) (-900.051) (-900.689) [-899.195] * (-902.352) [-897.132] (-899.422) (-898.573) -- 0:00:48
272000 -- (-899.517) [-898.286] (-900.281) (-908.106) * [-897.931] (-897.485) (-900.335) (-897.748) -- 0:00:48
272500 -- [-898.478] (-897.964) (-898.993) (-902.352) * (-899.064) [-898.200] (-900.217) (-900.051) -- 0:00:48
273000 -- (-902.150) (-899.653) (-897.723) [-897.630] * (-900.679) [-896.854] (-899.900) (-899.025) -- 0:00:47
273500 -- (-898.664) (-897.403) (-898.625) [-898.489] * (-897.935) (-899.269) (-900.369) [-898.357] -- 0:00:47
274000 -- (-898.210) [-899.807] (-899.551) (-897.767) * (-898.138) [-899.779] (-899.803) (-898.530) -- 0:00:47
274500 -- (-897.316) (-899.528) [-898.541] (-901.616) * [-899.529] (-899.115) (-900.393) (-898.761) -- 0:00:47
275000 -- (-897.060) (-901.443) [-899.007] (-901.481) * [-897.361] (-901.727) (-897.933) (-898.197) -- 0:00:47
Average standard deviation of split frequencies: 0.014091
275500 -- (-898.253) [-900.941] (-899.115) (-903.864) * (-899.000) [-899.933] (-899.635) (-899.236) -- 0:00:47
276000 -- (-897.646) (-900.379) [-897.232] (-904.201) * (-899.804) [-898.989] (-898.611) (-900.076) -- 0:00:47
276500 -- (-899.183) (-904.090) (-898.006) [-899.305] * (-900.557) [-902.987] (-897.275) (-899.124) -- 0:00:47
277000 -- (-898.996) [-906.438] (-899.675) (-900.577) * (-899.774) (-902.938) [-900.112] (-898.777) -- 0:00:46
277500 -- (-898.481) (-902.396) (-900.625) [-899.541] * (-902.156) (-897.161) [-898.369] (-903.179) -- 0:00:46
278000 -- (-898.798) (-901.568) (-897.510) [-902.632] * (-899.425) (-899.299) (-898.343) [-900.723] -- 0:00:46
278500 -- (-897.413) (-902.474) (-899.315) [-897.869] * (-902.566) [-900.410] (-898.411) (-899.499) -- 0:00:46
279000 -- [-897.930] (-900.144) (-898.924) (-898.106) * (-902.131) (-900.577) (-899.590) [-897.563] -- 0:00:46
279500 -- (-897.716) [-897.899] (-897.908) (-898.707) * [-900.136] (-901.027) (-899.902) (-902.290) -- 0:00:46
280000 -- (-897.490) [-900.104] (-897.748) (-900.817) * (-898.125) [-898.319] (-898.909) (-899.868) -- 0:00:46
Average standard deviation of split frequencies: 0.013647
280500 -- (-899.146) [-899.969] (-897.745) (-900.681) * (-899.138) [-899.887] (-899.046) (-898.206) -- 0:00:46
281000 -- (-899.254) (-900.313) (-899.754) [-897.959] * (-900.457) (-897.436) [-898.739] (-905.978) -- 0:00:48
281500 -- (-902.507) [-899.101] (-897.522) (-900.734) * (-901.536) (-897.506) (-897.715) [-898.680] -- 0:00:48
282000 -- [-897.828] (-897.855) (-898.946) (-898.683) * (-898.284) (-899.556) [-897.063] (-899.750) -- 0:00:48
282500 -- [-899.673] (-897.255) (-897.618) (-898.961) * [-897.199] (-899.615) (-897.185) (-900.659) -- 0:00:48
283000 -- (-899.575) (-899.937) [-897.931] (-898.999) * (-899.929) (-898.146) (-897.782) [-900.049] -- 0:00:48
283500 -- (-897.706) (-900.286) [-897.964] (-901.065) * (-898.735) (-899.720) [-897.180] (-902.928) -- 0:00:48
284000 -- (-897.660) (-901.634) (-899.287) [-898.060] * (-900.409) (-897.914) [-897.467] (-900.934) -- 0:00:47
284500 -- (-899.927) [-899.110] (-898.124) (-897.479) * (-897.125) (-897.742) [-897.644] (-898.857) -- 0:00:47
285000 -- [-902.757] (-898.612) (-900.065) (-897.102) * (-897.897) (-897.645) [-897.634] (-898.967) -- 0:00:47
Average standard deviation of split frequencies: 0.014216
285500 -- (-901.939) (-903.326) [-900.500] (-897.140) * (-899.175) [-897.892] (-903.269) (-898.058) -- 0:00:47
286000 -- [-898.324] (-901.934) (-898.717) (-897.990) * (-900.413) (-897.384) (-901.131) [-900.240] -- 0:00:47
286500 -- (-898.952) (-904.825) [-898.620] (-899.006) * (-903.841) (-898.515) [-898.303] (-901.322) -- 0:00:47
287000 -- (-900.237) (-903.476) [-898.225] (-898.693) * (-900.199) [-900.514] (-903.474) (-900.331) -- 0:00:47
287500 -- (-903.811) (-903.165) [-898.624] (-901.724) * (-897.821) (-898.625) (-901.980) [-899.503] -- 0:00:47
288000 -- (-899.185) (-898.608) (-900.568) [-900.139] * [-899.068] (-898.746) (-904.504) (-899.263) -- 0:00:46
288500 -- [-902.129] (-901.872) (-898.060) (-898.315) * (-897.672) [-900.625] (-899.007) (-898.265) -- 0:00:46
289000 -- [-897.930] (-902.046) (-900.325) (-897.618) * (-899.497) (-897.702) [-897.680] (-899.787) -- 0:00:46
289500 -- (-897.796) (-899.118) [-899.943] (-897.492) * (-897.903) [-899.000] (-901.672) (-897.307) -- 0:00:46
290000 -- (-898.770) [-898.233] (-902.055) (-898.071) * (-901.665) (-901.563) [-899.560] (-898.608) -- 0:00:46
Average standard deviation of split frequencies: 0.014495
290500 -- (-898.829) (-897.007) [-900.538] (-901.090) * (-898.109) [-902.076] (-898.897) (-898.649) -- 0:00:46
291000 -- (-898.603) [-896.932] (-900.766) (-901.612) * (-898.426) (-899.689) [-897.861] (-898.656) -- 0:00:46
291500 -- (-901.025) [-900.563] (-903.778) (-899.624) * (-902.898) (-900.495) [-898.593] (-898.545) -- 0:00:46
292000 -- (-898.573) [-897.882] (-898.076) (-903.567) * [-900.988] (-901.137) (-898.521) (-904.017) -- 0:00:46
292500 -- (-899.762) [-897.989] (-897.810) (-899.568) * (-899.823) [-900.104] (-899.121) (-898.592) -- 0:00:45
293000 -- (-899.870) (-899.746) (-900.666) [-901.008] * (-899.235) (-898.803) (-899.604) [-898.092] -- 0:00:45
293500 -- [-899.519] (-897.294) (-900.523) (-897.266) * (-901.403) (-898.407) (-900.131) [-898.527] -- 0:00:45
294000 -- (-897.181) (-897.904) (-899.566) [-897.818] * (-902.432) (-897.054) (-899.729) [-897.047] -- 0:00:45
294500 -- (-901.067) (-898.634) (-898.949) [-897.302] * (-902.194) (-898.099) [-899.293] (-899.334) -- 0:00:45
295000 -- (-900.435) (-901.718) (-900.784) [-898.217] * (-898.510) (-900.776) (-909.249) [-898.089] -- 0:00:45
Average standard deviation of split frequencies: 0.013736
295500 -- [-903.158] (-900.940) (-900.538) (-898.577) * (-899.236) (-899.092) (-906.938) [-898.298] -- 0:00:45
296000 -- (-898.080) [-897.880] (-899.987) (-897.663) * (-899.800) (-898.772) [-902.068] (-898.450) -- 0:00:47
296500 -- (-898.002) (-898.330) [-897.920] (-910.499) * [-900.785] (-898.954) (-908.198) (-900.139) -- 0:00:47
297000 -- (-900.239) (-897.523) [-898.326] (-907.250) * (-900.240) (-899.869) [-905.513] (-901.431) -- 0:00:47
297500 -- (-898.305) (-899.111) [-900.686] (-913.204) * (-899.679) [-899.864] (-901.078) (-901.557) -- 0:00:47
298000 -- [-898.499] (-899.069) (-899.346) (-907.363) * (-901.031) [-899.899] (-899.359) (-898.008) -- 0:00:47
298500 -- (-898.605) (-899.814) [-901.619] (-904.084) * (-899.475) (-898.103) [-900.444] (-907.285) -- 0:00:47
299000 -- (-902.494) (-900.621) [-900.002] (-898.015) * (-900.796) (-898.724) [-898.174] (-899.258) -- 0:00:46
299500 -- (-899.984) [-901.192] (-898.499) (-897.993) * (-898.652) (-897.536) (-897.623) [-900.381] -- 0:00:46
300000 -- [-901.641] (-899.404) (-897.210) (-904.152) * [-898.636] (-899.336) (-899.047) (-898.807) -- 0:00:46
Average standard deviation of split frequencies: 0.012641
300500 -- (-899.716) (-898.267) (-899.217) [-897.526] * [-899.691] (-898.202) (-905.201) (-902.837) -- 0:00:46
301000 -- (-900.367) (-898.907) (-901.852) [-897.376] * [-897.188] (-898.837) (-899.488) (-898.492) -- 0:00:46
301500 -- (-898.901) (-898.515) [-897.586] (-902.509) * (-898.087) [-897.655] (-897.984) (-899.826) -- 0:00:46
302000 -- [-897.624] (-899.330) (-897.869) (-899.625) * (-900.473) [-897.651] (-899.936) (-898.688) -- 0:00:46
302500 -- [-898.032] (-899.050) (-901.078) (-897.963) * (-901.699) (-900.002) [-898.153] (-897.492) -- 0:00:46
303000 -- (-902.607) (-907.114) (-898.659) [-899.068] * (-900.281) [-900.938] (-898.994) (-898.269) -- 0:00:46
303500 -- [-899.629] (-906.249) (-898.384) (-899.788) * [-898.358] (-901.282) (-899.318) (-898.149) -- 0:00:45
304000 -- (-901.567) [-898.679] (-897.248) (-898.652) * [-897.656] (-901.582) (-898.905) (-899.478) -- 0:00:45
304500 -- (-899.467) (-897.984) (-899.022) [-898.541] * (-899.535) (-900.362) [-898.031] (-898.915) -- 0:00:45
305000 -- (-901.860) (-897.633) (-903.771) [-901.866] * (-900.920) (-897.386) [-900.389] (-897.898) -- 0:00:45
Average standard deviation of split frequencies: 0.012959
305500 -- [-899.412] (-898.360) (-898.698) (-899.967) * [-897.845] (-897.181) (-897.535) (-898.914) -- 0:00:45
306000 -- (-897.915) (-899.538) [-899.699] (-900.275) * (-899.774) (-897.513) (-901.187) [-898.771] -- 0:00:45
306500 -- (-899.589) (-900.157) (-900.753) [-901.837] * (-899.403) [-899.144] (-902.482) (-904.012) -- 0:00:45
307000 -- [-901.438] (-899.588) (-902.755) (-902.254) * [-897.674] (-900.809) (-901.654) (-901.986) -- 0:00:45
307500 -- [-901.596] (-897.778) (-898.743) (-902.997) * (-898.073) (-897.577) (-901.523) [-898.991] -- 0:00:45
308000 -- (-900.418) [-897.867] (-898.606) (-901.801) * (-903.153) [-897.981] (-900.968) (-899.855) -- 0:00:44
308500 -- (-897.949) [-897.802] (-899.544) (-899.220) * (-903.818) [-899.352] (-899.180) (-896.882) -- 0:00:44
309000 -- (-898.818) (-899.712) (-900.422) [-898.056] * (-898.103) (-899.329) [-898.566] (-898.870) -- 0:00:44
309500 -- (-897.203) (-898.444) [-899.411] (-900.294) * (-901.635) (-898.283) [-900.103] (-900.906) -- 0:00:44
310000 -- (-897.392) (-899.102) [-902.534] (-900.502) * [-902.128] (-898.595) (-899.971) (-903.873) -- 0:00:44
Average standard deviation of split frequencies: 0.010811
310500 -- (-900.557) [-899.619] (-902.476) (-898.985) * (-899.589) (-899.844) [-899.329] (-902.885) -- 0:00:44
311000 -- [-900.058] (-898.649) (-898.584) (-901.266) * (-899.515) [-898.767] (-898.243) (-902.207) -- 0:00:46
311500 -- (-900.106) [-901.546] (-902.056) (-899.482) * (-896.888) [-903.143] (-898.529) (-908.739) -- 0:00:46
312000 -- (-897.537) (-902.729) [-901.936] (-899.826) * (-898.219) (-901.539) (-899.902) [-898.657] -- 0:00:46
312500 -- [-898.200] (-902.219) (-897.080) (-901.713) * (-898.785) [-899.397] (-898.931) (-899.879) -- 0:00:46
313000 -- [-900.554] (-902.781) (-897.752) (-903.879) * (-899.678) [-898.907] (-898.381) (-904.481) -- 0:00:46
313500 -- (-901.032) (-900.813) (-903.145) [-904.167] * [-898.459] (-899.047) (-898.679) (-898.036) -- 0:00:45
314000 -- (-900.817) (-899.535) (-898.612) [-900.950] * (-899.347) (-900.861) [-897.471] (-898.260) -- 0:00:45
314500 -- (-898.445) (-899.778) [-898.707] (-897.631) * (-899.315) [-900.508] (-900.535) (-898.045) -- 0:00:45
315000 -- (-899.521) [-898.919] (-902.339) (-898.768) * (-898.251) (-900.291) (-899.551) [-899.326] -- 0:00:45
Average standard deviation of split frequencies: 0.011841
315500 -- [-898.403] (-897.552) (-898.391) (-901.637) * (-897.163) (-901.558) [-898.920] (-900.647) -- 0:00:45
316000 -- (-897.309) [-899.926] (-899.332) (-903.179) * [-899.551] (-898.942) (-905.121) (-898.101) -- 0:00:45
316500 -- [-897.566] (-899.881) (-898.539) (-897.397) * [-900.984] (-899.228) (-906.507) (-899.379) -- 0:00:45
317000 -- (-897.860) [-900.094] (-898.698) (-897.261) * (-900.289) [-899.085] (-901.724) (-896.928) -- 0:00:45
317500 -- [-898.865] (-900.140) (-899.539) (-897.754) * (-899.750) [-902.170] (-898.042) (-898.307) -- 0:00:45
318000 -- [-898.866] (-897.517) (-899.834) (-897.735) * (-897.188) [-900.588] (-898.437) (-897.096) -- 0:00:45
318500 -- (-898.621) [-898.661] (-900.879) (-898.712) * [-898.473] (-898.841) (-897.953) (-904.746) -- 0:00:44
319000 -- (-898.616) (-897.771) [-897.491] (-898.543) * (-904.655) (-901.723) [-897.800] (-898.830) -- 0:00:44
319500 -- (-898.447) (-898.501) [-900.586] (-900.757) * (-899.827) (-900.880) [-897.561] (-899.056) -- 0:00:44
320000 -- (-897.688) (-897.468) [-898.547] (-898.959) * (-899.985) [-897.760] (-899.201) (-898.130) -- 0:00:44
Average standard deviation of split frequencies: 0.012220
320500 -- (-897.938) (-898.786) (-897.289) [-901.161] * (-903.250) (-897.616) [-901.051] (-897.792) -- 0:00:44
321000 -- (-897.345) (-897.124) [-900.304] (-899.951) * (-900.413) [-899.337] (-900.381) (-898.538) -- 0:00:44
321500 -- (-898.966) [-897.409] (-900.089) (-898.259) * (-905.663) [-900.107] (-901.011) (-901.341) -- 0:00:44
322000 -- (-896.901) (-897.537) (-898.127) [-901.262] * (-899.397) (-898.916) (-901.331) [-899.027] -- 0:00:44
322500 -- [-897.117] (-898.226) (-902.306) (-904.894) * (-898.078) (-899.098) (-902.556) [-901.781] -- 0:00:44
323000 -- (-897.375) [-898.575] (-897.301) (-899.761) * (-899.184) (-898.677) [-899.453] (-901.046) -- 0:00:44
323500 -- [-897.921] (-898.887) (-897.301) (-897.991) * (-898.690) (-898.368) (-898.387) [-898.806] -- 0:00:43
324000 -- [-898.957] (-899.372) (-898.136) (-897.625) * (-900.112) (-897.843) (-903.511) [-897.430] -- 0:00:43
324500 -- (-900.991) (-900.730) (-897.965) [-897.391] * (-901.493) [-897.936] (-900.187) (-905.022) -- 0:00:43
325000 -- (-901.032) (-903.402) [-899.047] (-899.137) * (-898.352) (-897.149) (-897.602) [-904.012] -- 0:00:43
Average standard deviation of split frequencies: 0.012653
325500 -- (-897.883) (-898.187) (-900.214) [-897.899] * [-899.180] (-898.109) (-902.658) (-897.342) -- 0:00:43
326000 -- (-897.509) (-898.488) (-900.422) [-903.092] * (-901.535) (-900.395) (-898.657) [-899.002] -- 0:00:43
326500 -- [-898.448] (-900.270) (-899.438) (-899.001) * (-899.487) (-904.288) (-897.225) [-898.439] -- 0:00:45
327000 -- (-900.273) [-899.544] (-900.069) (-899.081) * (-900.950) (-900.506) (-900.700) [-897.999] -- 0:00:45
327500 -- (-900.067) (-897.662) (-900.339) [-898.171] * [-899.636] (-898.248) (-898.789) (-900.443) -- 0:00:45
328000 -- (-898.873) [-898.913] (-899.079) (-900.635) * (-897.541) (-897.524) (-899.885) [-902.558] -- 0:00:45
328500 -- (-897.307) [-897.986] (-899.837) (-902.161) * (-897.755) (-901.417) (-900.664) [-899.985] -- 0:00:44
329000 -- [-897.308] (-897.908) (-900.107) (-899.241) * (-898.347) (-899.522) (-902.614) [-898.906] -- 0:00:44
329500 -- (-897.906) [-899.548] (-899.148) (-899.618) * [-899.129] (-898.817) (-899.168) (-901.516) -- 0:00:44
330000 -- (-897.969) (-900.857) [-898.324] (-904.907) * (-899.479) (-899.897) (-899.962) [-899.201] -- 0:00:44
Average standard deviation of split frequencies: 0.013276
330500 -- (-902.252) (-904.076) [-897.841] (-898.591) * (-899.784) [-897.040] (-901.019) (-901.236) -- 0:00:44
331000 -- (-900.028) (-900.099) (-899.836) [-897.659] * (-901.194) [-897.339] (-903.349) (-898.893) -- 0:00:44
331500 -- [-899.500] (-898.428) (-898.528) (-901.709) * (-898.476) [-897.493] (-898.326) (-901.288) -- 0:00:44
332000 -- (-900.770) (-898.382) [-899.057] (-899.984) * [-898.591] (-897.604) (-897.669) (-898.503) -- 0:00:44
332500 -- (-900.277) (-901.935) [-897.990] (-900.061) * [-899.046] (-902.531) (-899.526) (-898.944) -- 0:00:44
333000 -- (-899.249) (-897.681) [-898.862] (-904.510) * (-901.233) [-898.527] (-901.581) (-899.744) -- 0:00:44
333500 -- [-897.774] (-899.960) (-898.945) (-901.530) * (-899.376) (-908.785) [-899.271] (-901.660) -- 0:00:43
334000 -- [-900.808] (-902.308) (-897.470) (-905.378) * (-897.800) (-898.797) [-898.862] (-898.306) -- 0:00:43
334500 -- [-898.556] (-899.713) (-897.457) (-901.564) * [-897.935] (-898.731) (-901.859) (-897.990) -- 0:00:43
335000 -- [-899.067] (-899.056) (-899.211) (-897.659) * [-898.436] (-897.461) (-897.141) (-899.660) -- 0:00:43
Average standard deviation of split frequencies: 0.012544
335500 -- (-898.325) (-898.992) [-898.089] (-898.006) * [-898.801] (-898.707) (-898.699) (-900.075) -- 0:00:43
336000 -- [-899.570] (-905.331) (-900.278) (-899.643) * (-898.681) (-898.376) (-899.424) [-900.157] -- 0:00:43
336500 -- (-897.718) (-898.974) (-898.350) [-900.854] * [-897.875] (-899.093) (-899.332) (-896.800) -- 0:00:43
337000 -- (-899.319) [-897.658] (-897.651) (-898.870) * (-899.371) [-900.990] (-897.512) (-898.619) -- 0:00:43
337500 -- (-897.821) (-898.151) [-897.701] (-898.072) * (-900.722) (-899.468) [-898.391] (-898.177) -- 0:00:43
338000 -- (-898.745) (-900.829) (-901.548) [-897.725] * (-903.787) [-899.665] (-901.029) (-898.581) -- 0:00:43
338500 -- (-899.156) (-899.155) (-899.386) [-902.258] * (-900.540) (-903.540) (-899.639) [-897.884] -- 0:00:42
339000 -- (-898.648) (-897.973) [-898.023] (-898.285) * (-904.337) (-899.864) (-902.327) [-898.793] -- 0:00:42
339500 -- (-897.825) [-899.620] (-900.171) (-899.316) * (-899.257) (-902.892) (-898.885) [-898.307] -- 0:00:42
340000 -- [-898.995] (-897.116) (-899.733) (-899.186) * (-903.567) [-899.346] (-899.394) (-898.172) -- 0:00:42
Average standard deviation of split frequencies: 0.012886
340500 -- (-898.767) [-898.121] (-898.748) (-899.676) * (-897.870) (-898.394) (-901.173) [-903.606] -- 0:00:42
341000 -- (-898.326) [-898.902] (-899.421) (-899.881) * [-897.536] (-897.233) (-901.129) (-898.527) -- 0:00:42
341500 -- [-898.036] (-899.246) (-901.897) (-897.754) * (-897.201) [-899.109] (-899.049) (-898.184) -- 0:00:42
342000 -- (-897.988) (-900.743) (-899.222) [-898.146] * (-897.267) (-899.281) [-898.014] (-905.213) -- 0:00:44
342500 -- (-900.212) [-898.792] (-899.800) (-903.147) * (-899.639) [-898.303] (-901.495) (-900.049) -- 0:00:44
343000 -- (-901.056) (-900.521) [-899.395] (-899.733) * (-898.226) (-903.296) (-903.841) [-898.371] -- 0:00:44
343500 -- (-901.066) (-899.561) (-897.867) [-898.845] * (-898.198) (-898.073) (-899.356) [-901.864] -- 0:00:43
344000 -- (-899.309) [-899.287] (-899.568) (-900.007) * [-898.926] (-902.468) (-900.069) (-899.409) -- 0:00:43
344500 -- [-897.877] (-898.982) (-899.551) (-899.008) * (-897.853) [-898.541] (-899.495) (-898.305) -- 0:00:43
345000 -- [-898.622] (-898.478) (-898.666) (-898.153) * (-898.379) [-903.346] (-899.645) (-900.575) -- 0:00:43
Average standard deviation of split frequencies: 0.012773
345500 -- (-899.141) (-902.460) [-899.903] (-899.551) * [-898.144] (-900.388) (-905.549) (-902.321) -- 0:00:43
346000 -- (-897.776) (-905.435) (-899.879) [-898.988] * (-898.843) (-906.190) (-901.703) [-899.117] -- 0:00:43
346500 -- (-899.990) (-900.591) (-898.252) [-899.561] * (-901.159) (-903.443) (-898.607) [-897.140] -- 0:00:43
347000 -- (-897.970) (-896.892) [-901.747] (-899.057) * (-898.708) (-898.784) (-899.819) [-898.589] -- 0:00:43
347500 -- (-898.636) [-898.976] (-903.058) (-900.258) * (-900.692) [-899.292] (-897.333) (-897.742) -- 0:00:43
348000 -- (-899.971) (-899.456) [-898.157] (-903.155) * (-898.692) [-897.868] (-900.177) (-900.542) -- 0:00:43
348500 -- (-899.110) (-897.699) (-897.985) [-898.335] * (-899.452) (-900.004) (-898.143) [-900.266] -- 0:00:42
349000 -- (-898.519) (-899.641) [-900.343] (-897.822) * [-899.592] (-900.759) (-900.322) (-899.268) -- 0:00:42
349500 -- (-897.174) (-901.481) (-900.809) [-898.973] * [-898.216] (-902.891) (-901.645) (-897.027) -- 0:00:42
350000 -- [-897.942] (-900.542) (-900.162) (-899.811) * (-906.732) (-901.410) (-901.196) [-899.337] -- 0:00:42
Average standard deviation of split frequencies: 0.012183
350500 -- (-898.074) (-901.260) [-901.439] (-897.405) * (-900.062) (-898.084) (-899.250) [-897.772] -- 0:00:42
351000 -- (-898.816) [-900.154] (-900.204) (-899.116) * (-899.147) [-897.105] (-899.184) (-897.830) -- 0:00:42
351500 -- [-899.198] (-898.659) (-898.117) (-897.736) * (-899.529) (-897.700) [-900.366] (-907.640) -- 0:00:42
352000 -- (-898.778) (-903.588) [-898.973] (-898.021) * (-897.747) (-898.083) (-898.686) [-900.355] -- 0:00:42
352500 -- [-897.130] (-900.019) (-904.053) (-898.562) * (-897.553) (-899.061) [-900.364] (-897.830) -- 0:00:42
353000 -- (-900.001) (-898.107) (-906.119) [-898.814] * (-898.393) (-898.813) (-898.828) [-902.952] -- 0:00:42
353500 -- (-899.489) (-897.252) (-898.028) [-898.193] * [-897.320] (-899.614) (-898.779) (-900.504) -- 0:00:42
354000 -- [-900.363] (-900.528) (-897.201) (-897.670) * [-899.197] (-901.174) (-900.650) (-901.590) -- 0:00:41
354500 -- (-899.401) (-897.573) [-898.636] (-897.366) * [-904.383] (-907.995) (-897.922) (-898.395) -- 0:00:41
355000 -- [-897.167] (-898.819) (-899.001) (-899.057) * (-899.782) (-901.206) (-901.382) [-898.838] -- 0:00:41
Average standard deviation of split frequencies: 0.013330
355500 -- (-900.670) (-903.453) [-897.329] (-897.671) * (-900.740) [-900.074] (-903.272) (-898.441) -- 0:00:41
356000 -- (-900.540) (-902.897) [-897.869] (-898.566) * (-902.055) (-899.919) [-900.520] (-899.779) -- 0:00:41
356500 -- [-900.090] (-902.707) (-899.609) (-898.687) * (-899.462) (-898.590) (-898.770) [-900.062] -- 0:00:41
357000 -- (-900.417) (-899.450) (-899.354) [-897.924] * [-898.939] (-900.725) (-897.897) (-899.903) -- 0:00:43
357500 -- (-899.449) (-899.240) (-897.635) [-899.068] * [-900.024] (-899.341) (-898.486) (-901.277) -- 0:00:43
358000 -- [-901.732] (-898.935) (-897.593) (-898.837) * (-902.090) [-900.102] (-898.137) (-897.287) -- 0:00:43
358500 -- [-898.715] (-898.955) (-898.888) (-906.070) * (-902.011) [-900.947] (-899.006) (-899.111) -- 0:00:42
359000 -- (-898.834) [-899.381] (-898.469) (-899.849) * [-901.304] (-901.798) (-898.893) (-899.388) -- 0:00:42
359500 -- (-900.996) (-899.305) (-897.429) [-898.186] * (-904.245) [-902.536] (-899.716) (-900.575) -- 0:00:42
360000 -- (-899.951) (-897.651) (-898.050) [-898.443] * (-900.707) (-898.708) [-898.362] (-897.499) -- 0:00:42
Average standard deviation of split frequencies: 0.013506
360500 -- (-899.281) (-898.572) (-898.739) [-898.427] * (-898.324) (-899.837) [-898.232] (-898.900) -- 0:00:42
361000 -- (-900.416) [-897.934] (-902.002) (-898.179) * (-898.006) (-898.189) (-897.930) [-898.496] -- 0:00:42
361500 -- (-897.624) (-897.829) (-899.081) [-899.934] * (-898.423) (-901.085) [-897.772] (-902.208) -- 0:00:42
362000 -- [-898.243] (-898.225) (-900.644) (-899.033) * (-900.227) [-901.312] (-897.164) (-898.733) -- 0:00:42
362500 -- (-899.000) (-899.105) (-899.990) [-898.469] * (-899.664) (-898.956) [-896.938] (-901.525) -- 0:00:42
363000 -- (-898.426) (-900.590) [-900.979] (-899.360) * (-901.264) (-900.244) (-898.048) [-900.800] -- 0:00:42
363500 -- (-901.216) (-898.525) (-899.978) [-901.823] * (-899.741) (-899.692) (-900.434) [-901.574] -- 0:00:42
364000 -- (-899.815) (-899.166) [-898.032] (-898.437) * [-900.681] (-903.830) (-902.048) (-899.316) -- 0:00:41
364500 -- (-897.802) (-899.385) (-899.167) [-897.742] * (-897.824) (-900.317) [-898.058] (-899.603) -- 0:00:41
365000 -- [-900.327] (-898.811) (-899.095) (-897.390) * (-897.988) (-901.720) (-899.449) [-899.364] -- 0:00:41
Average standard deviation of split frequencies: 0.013765
365500 -- (-899.430) [-897.905] (-901.109) (-898.195) * (-900.212) (-901.771) [-899.684] (-898.395) -- 0:00:41
366000 -- [-902.248] (-903.610) (-898.235) (-900.020) * (-899.643) (-906.099) (-898.802) [-897.046] -- 0:00:41
366500 -- (-899.361) (-900.473) [-899.481] (-898.930) * [-899.516] (-901.578) (-898.557) (-900.354) -- 0:00:41
367000 -- (-900.346) (-898.424) (-901.418) [-901.332] * (-898.806) (-899.535) [-898.885] (-901.135) -- 0:00:41
367500 -- (-902.373) (-899.367) [-898.298] (-898.543) * (-898.370) (-899.364) (-899.996) [-901.079] -- 0:00:41
368000 -- (-898.605) [-899.371] (-899.365) (-902.225) * [-897.171] (-901.032) (-899.201) (-899.509) -- 0:00:41
368500 -- (-897.613) [-897.581] (-898.908) (-898.592) * (-897.021) (-902.675) (-899.363) [-900.865] -- 0:00:41
369000 -- [-900.348] (-899.844) (-900.436) (-900.624) * [-899.803] (-898.742) (-900.364) (-900.606) -- 0:00:41
369500 -- (-898.601) (-903.112) (-900.112) [-899.430] * (-897.392) [-897.232] (-898.071) (-898.552) -- 0:00:40
370000 -- [-899.106] (-901.878) (-898.745) (-898.045) * (-900.002) (-898.903) (-900.926) [-900.287] -- 0:00:40
Average standard deviation of split frequencies: 0.014387
370500 -- (-898.164) (-899.592) (-900.350) [-897.743] * (-901.981) (-898.009) [-898.362] (-899.413) -- 0:00:40
371000 -- (-903.321) (-901.841) [-898.553] (-904.070) * (-905.879) (-899.384) [-897.638] (-899.958) -- 0:00:40
371500 -- (-900.088) (-900.443) [-897.580] (-901.142) * (-902.712) (-898.869) [-901.860] (-899.065) -- 0:00:40
372000 -- [-900.207] (-898.898) (-900.318) (-898.627) * (-899.727) (-897.495) [-898.967] (-897.839) -- 0:00:42
372500 -- (-899.421) (-898.536) [-899.979] (-898.758) * (-898.584) (-897.811) (-898.356) [-899.623] -- 0:00:42
373000 -- (-898.662) (-900.759) (-897.393) [-897.234] * (-900.933) [-897.195] (-897.941) (-899.595) -- 0:00:42
373500 -- (-898.594) (-898.294) [-897.367] (-897.770) * [-898.362] (-897.727) (-897.459) (-900.164) -- 0:00:41
374000 -- (-900.483) (-900.880) (-899.496) [-898.302] * [-898.311] (-897.364) (-899.207) (-902.241) -- 0:00:41
374500 -- (-901.017) (-898.991) (-898.716) [-896.848] * (-899.722) (-897.201) (-897.170) [-903.650] -- 0:00:41
375000 -- (-897.423) [-899.100] (-898.340) (-900.046) * [-900.875] (-897.871) (-898.714) (-900.478) -- 0:00:41
Average standard deviation of split frequencies: 0.014653
375500 -- (-900.980) (-901.735) (-898.382) [-897.227] * (-901.060) [-900.081] (-899.623) (-899.370) -- 0:00:41
376000 -- (-902.862) (-898.808) (-898.595) [-899.329] * (-899.219) (-899.071) [-899.449] (-898.673) -- 0:00:41
376500 -- (-903.469) (-902.585) [-900.107] (-900.862) * (-898.167) (-899.276) (-902.100) [-898.824] -- 0:00:41
377000 -- (-898.395) (-901.327) [-897.670] (-899.667) * (-898.422) (-899.632) [-898.672] (-897.638) -- 0:00:41
377500 -- (-900.224) (-902.240) (-899.959) [-898.399] * (-899.667) [-900.057] (-897.782) (-899.633) -- 0:00:41
378000 -- (-899.798) (-903.871) [-899.970] (-899.137) * (-899.639) [-903.761] (-899.115) (-899.487) -- 0:00:41
378500 -- (-898.207) (-900.749) (-899.814) [-899.721] * (-898.877) (-905.764) (-898.222) [-898.368] -- 0:00:41
379000 -- (-902.396) (-899.274) [-903.992] (-899.998) * [-900.467] (-902.121) (-898.572) (-899.586) -- 0:00:40
379500 -- (-898.921) (-898.482) (-900.445) [-899.411] * (-900.832) (-899.212) (-899.550) [-900.848] -- 0:00:40
380000 -- [-898.264] (-900.547) (-899.565) (-901.661) * (-899.713) (-897.912) (-898.143) [-898.244] -- 0:00:40
Average standard deviation of split frequencies: 0.014319
380500 -- (-902.237) (-900.274) (-903.237) [-897.960] * (-900.557) (-898.212) (-900.323) [-898.379] -- 0:00:40
381000 -- (-898.829) (-898.709) [-899.444] (-898.511) * (-901.852) (-899.758) (-897.305) [-898.127] -- 0:00:40
381500 -- (-899.188) (-898.914) (-898.829) [-901.794] * (-899.107) (-900.406) [-899.743] (-903.882) -- 0:00:40
382000 -- (-899.422) [-903.171] (-905.862) (-898.263) * (-899.110) [-898.031] (-898.733) (-900.197) -- 0:00:40
382500 -- [-899.374] (-898.119) (-899.141) (-898.995) * [-898.470] (-897.685) (-901.329) (-901.863) -- 0:00:40
383000 -- (-900.755) (-899.880) (-899.951) [-902.068] * [-898.454] (-898.999) (-898.439) (-898.094) -- 0:00:40
383500 -- (-898.256) (-904.146) [-898.547] (-901.339) * (-910.194) (-898.718) [-897.687] (-903.750) -- 0:00:40
384000 -- (-900.478) (-900.198) (-899.446) [-897.767] * (-900.470) [-899.050] (-899.486) (-899.743) -- 0:00:40
384500 -- (-898.023) (-899.368) (-900.599) [-900.184] * (-900.029) (-900.010) (-898.259) [-899.027] -- 0:00:40
385000 -- [-897.657] (-900.732) (-899.375) (-902.723) * [-898.253] (-901.622) (-898.481) (-903.138) -- 0:00:39
Average standard deviation of split frequencies: 0.014044
385500 -- (-899.430) (-898.689) [-898.075] (-900.254) * (-897.588) (-899.194) (-900.664) [-901.341] -- 0:00:39
386000 -- (-900.752) (-900.018) [-900.238] (-898.769) * (-897.328) (-898.135) [-897.376] (-899.724) -- 0:00:39
386500 -- (-898.203) [-899.743] (-901.014) (-898.957) * (-897.896) (-899.237) (-900.977) [-900.027] -- 0:00:39
387000 -- (-901.945) [-901.099] (-898.512) (-898.712) * (-905.042) (-903.698) (-902.529) [-898.808] -- 0:00:41
387500 -- (-899.932) (-901.744) (-898.245) [-897.460] * (-898.826) (-899.649) [-899.698] (-901.725) -- 0:00:41
388000 -- (-900.412) [-898.484] (-899.463) (-897.749) * (-898.415) [-899.326] (-900.558) (-897.907) -- 0:00:41
388500 -- (-899.953) (-904.932) (-898.818) [-898.370] * (-900.618) [-898.310] (-902.329) (-897.383) -- 0:00:40
389000 -- (-897.469) [-897.957] (-898.534) (-899.018) * (-900.122) (-898.686) (-899.206) [-899.188] -- 0:00:40
389500 -- (-901.850) (-900.899) (-902.251) [-898.790] * (-897.212) (-898.365) [-902.740] (-899.407) -- 0:00:40
390000 -- (-899.680) [-901.699] (-904.532) (-899.406) * (-897.258) (-898.521) [-900.584] (-901.419) -- 0:00:40
Average standard deviation of split frequencies: 0.014631
390500 -- (-901.449) (-899.849) [-902.843] (-898.690) * (-898.297) [-900.249] (-898.775) (-899.632) -- 0:00:40
391000 -- (-898.582) (-897.204) (-899.597) [-899.365] * (-899.010) (-899.245) [-899.654] (-900.968) -- 0:00:40
391500 -- (-898.830) (-898.215) [-898.115] (-898.076) * (-899.242) (-901.717) (-900.594) [-900.380] -- 0:00:40
392000 -- (-898.652) [-899.974] (-899.260) (-901.046) * (-897.296) (-901.003) [-897.341] (-902.050) -- 0:00:40
392500 -- (-897.826) [-898.037] (-901.665) (-901.596) * [-897.236] (-897.617) (-898.962) (-897.533) -- 0:00:40
393000 -- (-898.111) (-897.482) [-898.326] (-899.921) * (-898.203) [-900.052] (-898.887) (-898.216) -- 0:00:40
393500 -- [-897.213] (-900.502) (-900.099) (-898.716) * (-900.770) [-899.190] (-899.200) (-898.594) -- 0:00:40
394000 -- (-897.232) [-899.547] (-898.464) (-897.834) * [-898.314] (-898.659) (-899.633) (-898.761) -- 0:00:39
394500 -- (-897.950) (-899.694) [-901.179] (-897.985) * [-898.102] (-899.364) (-898.977) (-897.704) -- 0:00:39
395000 -- (-897.561) (-899.667) [-899.799] (-897.516) * [-898.351] (-896.857) (-898.092) (-899.099) -- 0:00:39
Average standard deviation of split frequencies: 0.014285
395500 -- (-897.378) (-898.099) (-902.787) [-897.516] * (-908.499) (-897.300) [-899.698] (-900.033) -- 0:00:39
396000 -- [-899.353] (-899.562) (-898.526) (-897.654) * (-901.706) (-899.904) [-897.622] (-901.544) -- 0:00:39
396500 -- (-903.671) [-899.525] (-898.472) (-901.646) * (-900.940) (-897.491) [-902.407] (-902.913) -- 0:00:39
397000 -- [-902.832] (-901.194) (-898.827) (-901.835) * (-902.568) [-901.508] (-899.338) (-899.219) -- 0:00:39
397500 -- (-900.221) [-899.447] (-900.254) (-899.470) * [-898.345] (-902.256) (-900.424) (-901.708) -- 0:00:39
398000 -- (-900.681) (-898.740) [-900.264] (-899.154) * [-900.601] (-898.022) (-904.042) (-897.166) -- 0:00:39
398500 -- [-900.055] (-898.629) (-901.703) (-902.164) * [-899.738] (-897.318) (-900.823) (-897.777) -- 0:00:39
399000 -- [-897.148] (-903.201) (-902.775) (-900.279) * (-899.571) (-900.205) [-900.377] (-897.763) -- 0:00:39
399500 -- [-897.167] (-898.398) (-899.566) (-899.115) * (-899.005) (-899.479) (-902.129) [-897.852] -- 0:00:39
400000 -- (-899.472) (-899.334) [-899.547] (-901.836) * (-905.531) (-897.986) [-897.102] (-897.154) -- 0:00:39
Average standard deviation of split frequencies: 0.014119
400500 -- (-899.183) [-901.353] (-899.227) (-902.284) * (-901.411) (-902.096) [-900.925] (-897.515) -- 0:00:40
401000 -- [-901.504] (-897.273) (-899.230) (-899.295) * (-905.486) (-900.086) [-899.282] (-897.511) -- 0:00:40
401500 -- (-902.152) [-897.632] (-901.767) (-898.695) * [-899.082] (-899.231) (-898.427) (-897.335) -- 0:00:40
402000 -- (-898.548) (-898.200) (-899.140) [-899.054] * [-898.242] (-900.494) (-898.383) (-898.192) -- 0:00:40
402500 -- (-898.803) (-899.028) [-899.840] (-900.165) * (-900.925) [-897.991] (-898.861) (-900.187) -- 0:00:40
403000 -- [-898.129] (-900.870) (-900.393) (-899.264) * (-901.789) (-898.620) [-897.744] (-898.113) -- 0:00:39
403500 -- [-899.159] (-898.550) (-902.360) (-898.836) * (-901.754) (-899.982) (-897.513) [-899.082] -- 0:00:39
404000 -- (-900.316) [-899.556] (-903.362) (-899.249) * (-900.603) (-898.192) (-899.867) [-897.164] -- 0:00:39
404500 -- (-901.906) (-899.569) [-898.318] (-898.465) * (-900.933) (-899.681) (-898.630) [-897.704] -- 0:00:39
405000 -- (-897.884) [-898.464] (-898.697) (-902.526) * [-901.088] (-903.696) (-898.523) (-898.398) -- 0:00:39
Average standard deviation of split frequencies: 0.013933
405500 -- (-900.549) (-897.411) (-899.085) [-897.891] * (-899.529) (-904.057) (-899.143) [-900.128] -- 0:00:39
406000 -- (-898.888) (-902.942) (-899.586) [-899.321] * (-901.404) (-900.059) [-899.134] (-903.636) -- 0:00:39
406500 -- (-897.562) (-899.232) [-898.963] (-901.320) * (-900.186) (-898.453) [-898.968] (-901.191) -- 0:00:39
407000 -- (-898.395) (-898.612) (-900.198) [-897.672] * (-899.178) (-900.214) (-899.206) [-897.522] -- 0:00:39
407500 -- (-897.687) (-905.417) (-897.762) [-899.529] * (-898.485) (-899.125) (-898.209) [-897.980] -- 0:00:39
408000 -- [-899.739] (-908.600) (-897.676) (-899.500) * (-900.896) (-900.585) [-900.746] (-899.419) -- 0:00:39
408500 -- [-900.709] (-900.229) (-900.086) (-899.253) * (-897.723) (-898.292) (-899.211) [-901.049] -- 0:00:39
409000 -- (-901.214) (-897.889) [-898.924] (-898.305) * (-899.023) [-900.258] (-899.048) (-900.275) -- 0:00:39
409500 -- (-900.747) [-898.891] (-899.846) (-898.256) * (-900.702) (-898.265) [-898.488] (-898.826) -- 0:00:38
410000 -- [-900.702] (-903.084) (-902.295) (-897.617) * (-899.392) [-897.213] (-897.605) (-899.461) -- 0:00:38
Average standard deviation of split frequencies: 0.014045
410500 -- [-901.352] (-903.738) (-897.855) (-898.058) * [-901.287] (-897.733) (-898.121) (-900.021) -- 0:00:38
411000 -- [-899.448] (-901.068) (-898.834) (-900.308) * (-899.714) [-905.672] (-898.502) (-898.371) -- 0:00:38
411500 -- (-898.162) (-899.318) [-900.856] (-901.185) * (-897.615) (-902.197) (-897.619) [-898.619] -- 0:00:38
412000 -- [-898.166] (-898.965) (-899.664) (-898.063) * (-898.639) (-899.667) [-897.358] (-898.714) -- 0:00:38
412500 -- (-899.634) [-899.815] (-901.672) (-898.099) * (-901.349) (-898.453) [-897.064] (-897.379) -- 0:00:38
413000 -- (-902.791) (-902.145) (-897.839) [-897.225] * [-897.978] (-898.482) (-900.899) (-899.694) -- 0:00:38
413500 -- (-898.825) (-900.661) (-897.814) [-897.256] * [-901.120] (-903.012) (-898.131) (-901.378) -- 0:00:38
414000 -- (-900.036) [-900.821] (-898.345) (-898.436) * (-896.922) [-901.868] (-909.611) (-898.463) -- 0:00:38
414500 -- (-899.974) (-900.760) (-900.254) [-901.262] * (-896.970) (-899.027) [-907.700] (-898.005) -- 0:00:38
415000 -- [-900.541] (-897.597) (-899.807) (-899.467) * (-897.907) (-896.933) [-898.956] (-897.673) -- 0:00:38
Average standard deviation of split frequencies: 0.013386
415500 -- [-899.078] (-899.080) (-897.149) (-900.741) * [-898.678] (-897.762) (-898.577) (-898.686) -- 0:00:37
416000 -- (-900.370) (-900.767) (-903.689) [-899.487] * (-898.562) [-897.476] (-899.596) (-900.017) -- 0:00:37
416500 -- (-898.627) (-899.384) [-899.150] (-897.943) * (-903.165) (-897.583) (-898.824) [-902.774] -- 0:00:39
417000 -- [-898.509] (-898.505) (-897.205) (-899.617) * (-898.520) (-897.611) [-900.366] (-901.184) -- 0:00:39
417500 -- (-899.076) (-898.232) [-897.205] (-899.967) * (-899.808) (-897.958) (-900.553) [-899.919] -- 0:00:39
418000 -- (-903.225) [-898.521] (-898.154) (-900.415) * [-899.434] (-897.858) (-904.991) (-897.393) -- 0:00:38
418500 -- (-898.728) [-902.449] (-899.347) (-898.395) * (-900.112) [-897.865] (-901.742) (-898.406) -- 0:00:38
419000 -- [-897.971] (-898.857) (-902.100) (-898.704) * [-899.795] (-897.380) (-900.707) (-899.582) -- 0:00:38
419500 -- (-897.192) (-899.809) (-905.223) [-898.062] * (-900.823) [-897.380] (-901.477) (-898.573) -- 0:00:38
420000 -- (-897.583) (-901.576) [-900.566] (-903.217) * (-898.153) [-897.380] (-901.642) (-897.977) -- 0:00:38
Average standard deviation of split frequencies: 0.013868
420500 -- (-897.580) (-903.175) [-899.467] (-899.074) * (-898.186) (-898.654) [-899.283] (-897.776) -- 0:00:38
421000 -- (-898.163) (-897.715) [-901.341] (-900.490) * (-903.821) (-900.444) [-900.019] (-899.671) -- 0:00:38
421500 -- (-899.724) [-897.804] (-899.081) (-902.057) * (-899.761) (-898.095) (-900.611) [-900.503] -- 0:00:38
422000 -- (-898.768) (-897.680) [-898.836] (-900.380) * (-897.679) [-899.584] (-898.163) (-898.516) -- 0:00:38
422500 -- (-899.361) [-897.242] (-899.515) (-898.085) * (-899.786) (-900.312) (-897.870) [-900.628] -- 0:00:38
423000 -- [-900.450] (-902.739) (-899.708) (-898.034) * [-901.402] (-898.608) (-896.973) (-900.292) -- 0:00:38
423500 -- (-900.355) [-900.002] (-904.178) (-899.112) * (-901.629) (-897.866) [-898.676] (-897.514) -- 0:00:38
424000 -- (-899.125) [-898.598] (-902.465) (-899.309) * [-900.035] (-897.450) (-898.626) (-899.519) -- 0:00:38
424500 -- (-898.461) [-899.326] (-901.835) (-898.796) * [-903.249] (-900.446) (-899.138) (-898.991) -- 0:00:37
425000 -- [-897.541] (-899.950) (-900.680) (-900.771) * [-899.837] (-897.316) (-899.517) (-898.771) -- 0:00:37
Average standard deviation of split frequencies: 0.012933
425500 -- [-897.453] (-900.161) (-897.657) (-900.576) * (-899.932) (-897.641) (-899.801) [-903.224] -- 0:00:37
426000 -- (-897.366) (-904.847) [-899.279] (-901.485) * [-898.763] (-900.799) (-903.290) (-908.701) -- 0:00:37
426500 -- (-898.359) (-901.676) [-899.268] (-900.633) * (-897.893) (-900.690) [-901.979] (-899.304) -- 0:00:37
427000 -- (-902.725) (-898.877) (-899.288) [-898.061] * (-898.383) (-898.496) [-899.763] (-899.523) -- 0:00:37
427500 -- (-902.706) [-898.697] (-898.153) (-898.740) * (-897.746) (-898.162) (-898.111) [-897.647] -- 0:00:37
428000 -- (-899.058) [-898.739] (-898.383) (-898.970) * (-899.005) [-899.357] (-897.450) (-897.813) -- 0:00:37
428500 -- (-900.854) (-899.334) [-900.899] (-898.411) * [-898.520] (-898.574) (-898.052) (-901.571) -- 0:00:37
429000 -- (-904.104) [-900.009] (-899.402) (-898.736) * (-899.862) (-897.078) (-897.691) [-899.595] -- 0:00:37
429500 -- (-902.516) [-898.576] (-899.619) (-901.758) * [-898.362] (-896.903) (-899.085) (-898.386) -- 0:00:37
430000 -- (-899.210) (-899.839) [-898.227] (-901.666) * (-899.409) [-897.379] (-899.138) (-899.823) -- 0:00:37
Average standard deviation of split frequencies: 0.013272
430500 -- (-898.825) (-899.038) (-897.347) [-898.004] * [-899.169] (-897.430) (-899.706) (-898.316) -- 0:00:37
431000 -- [-900.042] (-900.875) (-897.618) (-904.194) * (-898.527) [-897.529] (-901.647) (-898.425) -- 0:00:36
431500 -- [-898.158] (-903.811) (-897.593) (-898.414) * (-897.755) (-898.701) (-899.326) [-899.754] -- 0:00:36
432000 -- [-898.440] (-898.584) (-898.640) (-898.756) * [-898.337] (-901.597) (-899.144) (-899.043) -- 0:00:36
432500 -- (-903.434) (-898.498) (-897.198) [-899.308] * (-899.653) [-899.370] (-897.686) (-897.858) -- 0:00:36
433000 -- [-901.417] (-898.698) (-898.572) (-898.641) * [-898.399] (-902.724) (-900.700) (-898.311) -- 0:00:37
433500 -- [-903.599] (-897.754) (-897.961) (-900.801) * (-898.503) [-900.180] (-897.817) (-897.595) -- 0:00:37
434000 -- (-903.009) [-899.669] (-897.878) (-900.049) * (-897.474) [-898.594] (-898.607) (-897.163) -- 0:00:37
434500 -- (-897.405) [-900.689] (-897.782) (-898.242) * (-897.135) (-899.298) [-899.930] (-897.145) -- 0:00:37
435000 -- (-898.591) [-897.883] (-897.546) (-897.636) * [-899.191] (-897.981) (-898.759) (-899.428) -- 0:00:37
Average standard deviation of split frequencies: 0.013447
435500 -- (-899.118) (-898.000) (-903.001) [-897.634] * [-897.616] (-899.090) (-898.397) (-898.694) -- 0:00:37
436000 -- (-898.120) [-897.283] (-901.552) (-899.211) * [-897.948] (-897.955) (-902.002) (-900.066) -- 0:00:37
436500 -- (-899.699) [-897.273] (-898.594) (-897.254) * [-899.639] (-901.442) (-899.503) (-899.681) -- 0:00:37
437000 -- (-898.187) [-896.886] (-898.471) (-902.879) * (-897.876) (-899.603) (-898.342) [-906.403] -- 0:00:37
437500 -- [-902.371] (-898.249) (-897.979) (-901.172) * [-902.142] (-901.541) (-898.630) (-900.861) -- 0:00:37
438000 -- (-898.683) (-900.943) [-898.705] (-898.041) * (-900.924) (-900.206) [-899.648] (-900.329) -- 0:00:37
438500 -- (-897.786) (-901.286) [-899.301] (-897.128) * (-897.709) [-900.107] (-899.246) (-898.413) -- 0:00:37
439000 -- (-899.304) (-899.722) (-897.309) [-899.106] * (-901.066) (-898.861) [-898.848] (-900.447) -- 0:00:37
439500 -- [-897.975] (-899.618) (-897.190) (-898.711) * (-901.015) (-901.551) [-899.024] (-899.761) -- 0:00:36
440000 -- (-903.743) (-898.358) [-897.111] (-900.085) * (-898.943) (-899.057) [-901.617] (-900.681) -- 0:00:36
Average standard deviation of split frequencies: 0.013974
440500 -- (-898.701) (-898.792) (-901.733) [-898.711] * (-898.071) (-898.228) (-897.061) [-899.709] -- 0:00:36
441000 -- (-898.916) (-898.764) (-899.402) [-897.883] * [-903.384] (-898.209) (-904.647) (-900.048) -- 0:00:36
441500 -- [-897.926] (-898.883) (-900.650) (-898.532) * (-902.258) (-898.190) [-904.638] (-900.917) -- 0:00:36
442000 -- (-900.122) (-900.278) (-901.019) [-898.717] * [-898.288] (-897.549) (-898.622) (-898.914) -- 0:00:36
442500 -- (-899.609) (-897.818) [-899.962] (-898.547) * (-898.833) (-898.237) [-898.644] (-898.845) -- 0:00:36
443000 -- (-902.462) (-899.891) (-907.675) [-900.370] * [-899.057] (-897.625) (-898.823) (-900.820) -- 0:00:36
443500 -- [-898.055] (-898.961) (-901.178) (-897.601) * (-898.421) (-899.210) (-902.412) [-903.960] -- 0:00:36
444000 -- (-897.858) (-897.715) (-900.552) [-897.824] * [-899.573] (-898.172) (-898.962) (-902.779) -- 0:00:36
444500 -- (-898.308) [-898.294] (-899.344) (-899.275) * (-900.508) (-903.824) (-899.002) [-900.419] -- 0:00:36
445000 -- [-901.374] (-905.824) (-899.500) (-903.386) * (-900.244) [-897.725] (-898.806) (-898.478) -- 0:00:36
Average standard deviation of split frequencies: 0.014467
445500 -- (-902.739) (-903.083) [-898.747] (-900.703) * (-897.723) [-898.136] (-898.377) (-898.518) -- 0:00:36
446000 -- (-899.964) (-904.899) [-897.230] (-899.603) * (-898.775) [-898.342] (-899.228) (-899.678) -- 0:00:36
446500 -- (-899.168) (-899.823) [-898.237] (-898.882) * (-899.834) (-898.405) [-897.766] (-900.536) -- 0:00:35
447000 -- (-898.649) (-903.232) [-899.692] (-898.412) * (-900.818) (-900.934) (-897.902) [-901.293] -- 0:00:35
447500 -- (-897.825) [-899.187] (-901.607) (-899.706) * (-900.051) [-898.065] (-899.109) (-899.619) -- 0:00:35
448000 -- (-900.700) (-898.958) (-901.179) [-901.473] * [-900.339] (-898.629) (-898.631) (-897.004) -- 0:00:35
448500 -- (-904.139) (-897.673) [-897.460] (-900.418) * (-899.651) [-898.211] (-897.613) (-898.846) -- 0:00:35
449000 -- (-898.555) (-897.349) [-897.403] (-903.330) * (-901.576) [-898.457] (-905.320) (-898.378) -- 0:00:35
449500 -- [-898.924] (-898.058) (-898.525) (-897.391) * [-898.457] (-901.512) (-900.375) (-899.634) -- 0:00:36
450000 -- [-897.771] (-900.803) (-896.794) (-901.401) * (-898.099) (-899.702) [-899.608] (-899.109) -- 0:00:36
Average standard deviation of split frequencies: 0.015136
450500 -- (-898.497) (-904.826) [-897.368] (-901.781) * (-898.188) [-900.779] (-901.019) (-897.446) -- 0:00:36
451000 -- (-897.882) (-902.008) [-899.338] (-897.852) * [-900.105] (-897.804) (-897.712) (-899.682) -- 0:00:36
451500 -- (-900.722) (-903.785) (-899.313) [-902.687] * (-900.113) (-898.872) (-902.102) [-898.397] -- 0:00:36
452000 -- (-899.619) (-900.386) [-897.647] (-900.270) * (-901.855) (-897.661) [-901.360] (-898.654) -- 0:00:36
452500 -- (-903.447) [-899.092] (-897.169) (-900.034) * (-903.499) [-898.718] (-906.095) (-900.090) -- 0:00:36
453000 -- [-900.943] (-897.320) (-904.143) (-896.905) * [-901.978] (-900.573) (-901.312) (-899.697) -- 0:00:36
453500 -- [-899.449] (-899.833) (-899.938) (-902.389) * [-900.613] (-900.503) (-902.788) (-902.548) -- 0:00:36
454000 -- (-898.730) [-898.820] (-899.543) (-903.388) * (-900.401) (-899.491) [-900.114] (-899.481) -- 0:00:36
454500 -- (-898.741) [-897.892] (-899.407) (-903.966) * (-900.592) (-898.993) (-897.175) [-905.031] -- 0:00:36
455000 -- (-898.456) [-898.836] (-899.582) (-900.796) * [-899.870] (-903.406) (-898.182) (-900.445) -- 0:00:35
Average standard deviation of split frequencies: 0.015203
455500 -- (-898.528) (-899.223) [-898.892] (-899.765) * [-897.463] (-905.764) (-898.222) (-899.131) -- 0:00:35
456000 -- (-897.798) [-900.759] (-898.730) (-898.559) * [-898.752] (-899.819) (-898.874) (-898.727) -- 0:00:35
456500 -- (-898.480) (-899.012) [-898.811] (-897.614) * [-901.268] (-900.423) (-902.208) (-899.404) -- 0:00:35
457000 -- (-899.402) (-898.984) [-897.565] (-898.735) * (-899.334) (-899.420) (-898.631) [-901.050] -- 0:00:35
457500 -- [-902.794] (-897.291) (-906.504) (-900.661) * (-897.947) (-899.433) (-902.041) [-898.678] -- 0:00:35
458000 -- [-899.409] (-899.131) (-898.785) (-902.232) * (-898.207) [-900.633] (-897.960) (-899.335) -- 0:00:35
458500 -- (-900.733) [-899.500] (-904.252) (-898.158) * (-897.094) [-899.844] (-900.581) (-899.948) -- 0:00:35
459000 -- (-901.111) (-900.417) (-899.351) [-898.522] * (-903.489) (-900.301) [-898.758] (-899.342) -- 0:00:35
459500 -- (-902.355) [-899.229] (-898.116) (-899.765) * (-899.758) (-898.932) (-901.789) [-898.512] -- 0:00:35
460000 -- [-897.791] (-899.581) (-898.115) (-898.562) * (-898.988) (-898.989) [-899.221] (-898.276) -- 0:00:35
Average standard deviation of split frequencies: 0.013965
460500 -- (-901.652) (-902.924) [-898.535] (-897.946) * [-898.821] (-899.820) (-899.897) (-898.581) -- 0:00:35
461000 -- (-899.212) [-903.776] (-897.119) (-897.662) * (-901.409) (-901.582) (-900.030) [-897.246] -- 0:00:35
461500 -- (-897.885) [-897.956] (-898.244) (-898.866) * (-899.048) (-900.942) [-897.904] (-902.617) -- 0:00:35
462000 -- [-900.257] (-898.127) (-898.841) (-898.309) * (-899.797) (-899.837) (-898.450) [-901.333] -- 0:00:34
462500 -- (-897.485) [-900.184] (-899.659) (-897.865) * (-904.004) (-900.191) (-897.590) [-902.289] -- 0:00:34
463000 -- (-899.665) [-900.086] (-897.231) (-898.849) * (-899.205) (-900.275) (-897.992) [-898.268] -- 0:00:34
463500 -- (-900.930) (-901.750) [-906.888] (-898.880) * (-900.587) (-901.505) [-898.089] (-897.678) -- 0:00:34
464000 -- (-898.865) (-903.553) [-903.208] (-898.351) * (-897.734) (-898.926) (-897.873) [-898.514] -- 0:00:34
464500 -- (-900.504) (-899.804) (-905.447) [-899.266] * (-898.198) (-897.520) [-900.016] (-897.087) -- 0:00:34
465000 -- (-899.148) (-900.309) (-898.763) [-898.339] * (-900.323) [-901.278] (-897.471) (-898.055) -- 0:00:34
Average standard deviation of split frequencies: 0.014103
465500 -- (-899.293) (-900.860) (-900.423) [-898.610] * (-898.041) [-897.324] (-901.806) (-897.868) -- 0:00:35
466000 -- [-900.591] (-897.072) (-897.736) (-898.164) * (-901.536) (-897.545) (-898.864) [-900.540] -- 0:00:35
466500 -- (-898.059) (-897.400) [-898.191] (-898.788) * [-901.377] (-899.897) (-900.657) (-901.430) -- 0:00:35
467000 -- (-898.081) (-897.280) (-902.104) [-899.523] * [-904.081] (-898.798) (-898.331) (-898.267) -- 0:00:35
467500 -- (-898.581) (-898.066) [-903.868] (-898.253) * [-898.899] (-900.243) (-898.224) (-898.226) -- 0:00:35
468000 -- (-900.231) (-898.222) [-901.406] (-898.659) * (-897.614) [-900.741] (-901.374) (-899.019) -- 0:00:35
468500 -- [-900.910] (-901.016) (-900.146) (-897.871) * (-898.346) [-897.420] (-900.674) (-899.197) -- 0:00:35
469000 -- (-898.173) [-900.746] (-899.598) (-898.291) * (-897.130) (-898.604) [-900.235] (-899.030) -- 0:00:35
469500 -- (-902.552) [-900.331] (-899.989) (-902.256) * (-898.672) (-897.841) (-897.768) [-897.897] -- 0:00:35
470000 -- (-902.139) [-898.672] (-897.276) (-898.618) * [-898.867] (-898.008) (-903.989) (-897.496) -- 0:00:34
Average standard deviation of split frequencies: 0.013492
470500 -- (-899.431) (-897.480) (-898.046) [-899.324] * (-898.726) (-908.911) (-900.167) [-900.415] -- 0:00:34
471000 -- [-900.566] (-899.217) (-904.149) (-900.598) * (-899.768) [-899.932] (-901.853) (-898.969) -- 0:00:34
471500 -- [-903.997] (-904.197) (-900.987) (-901.425) * (-899.601) (-900.279) [-899.736] (-898.330) -- 0:00:34
472000 -- [-897.384] (-901.562) (-899.987) (-903.663) * [-897.077] (-904.141) (-899.159) (-900.268) -- 0:00:34
472500 -- (-900.664) (-897.682) [-898.587] (-898.785) * (-898.166) (-900.150) (-899.973) [-898.830] -- 0:00:34
473000 -- (-898.838) (-898.154) [-899.922] (-900.904) * (-899.621) (-899.410) (-905.139) [-900.314] -- 0:00:34
473500 -- [-900.479] (-897.890) (-897.708) (-901.574) * (-899.271) (-899.933) (-900.156) [-898.261] -- 0:00:34
474000 -- (-897.177) (-898.558) (-900.409) [-899.641] * (-898.613) [-898.306] (-898.370) (-899.724) -- 0:00:34
474500 -- [-897.316] (-901.376) (-900.222) (-900.779) * (-903.711) [-901.486] (-902.720) (-899.021) -- 0:00:34
475000 -- (-897.661) [-900.192] (-898.435) (-898.167) * (-901.145) (-898.160) [-901.078] (-899.356) -- 0:00:34
Average standard deviation of split frequencies: 0.013923
475500 -- (-898.195) (-900.225) [-898.351] (-899.180) * (-901.060) (-899.193) [-899.878] (-898.443) -- 0:00:34
476000 -- (-899.255) (-900.161) (-898.660) [-900.399] * (-897.938) (-898.597) [-898.882] (-896.813) -- 0:00:34
476500 -- (-898.594) (-899.200) [-898.872] (-900.628) * [-898.381] (-900.939) (-898.728) (-897.429) -- 0:00:34
477000 -- (-900.798) (-898.364) [-899.016] (-898.348) * (-898.319) (-900.627) [-901.743] (-897.979) -- 0:00:33
477500 -- (-901.266) (-898.236) (-898.328) [-900.154] * (-898.684) (-898.601) (-898.791) [-897.606] -- 0:00:33
478000 -- (-899.901) [-898.997] (-899.825) (-896.824) * [-897.073] (-897.904) (-898.327) (-899.823) -- 0:00:33
478500 -- (-898.429) [-899.085] (-900.996) (-897.072) * (-898.539) [-901.884] (-899.622) (-900.695) -- 0:00:33
479000 -- (-898.040) (-898.932) [-899.854] (-897.095) * [-897.347] (-898.205) (-899.569) (-898.312) -- 0:00:33
479500 -- (-898.790) (-904.496) (-901.746) [-898.046] * (-897.348) [-898.283] (-898.665) (-901.856) -- 0:00:33
480000 -- (-897.767) (-898.548) [-897.399] (-898.598) * (-901.287) [-899.569] (-899.435) (-898.397) -- 0:00:33
Average standard deviation of split frequencies: 0.012872
480500 -- [-898.252] (-897.832) (-897.191) (-898.245) * (-901.343) (-899.471) (-898.781) [-898.226] -- 0:00:33
481000 -- [-904.944] (-898.311) (-901.160) (-897.526) * [-898.783] (-899.177) (-900.315) (-897.875) -- 0:00:33
481500 -- (-900.655) (-904.394) (-901.336) [-898.088] * (-899.321) (-898.662) (-902.017) [-902.205] -- 0:00:33
482000 -- (-900.595) (-899.517) [-897.883] (-899.974) * (-899.938) (-897.389) [-903.955] (-899.056) -- 0:00:34
482500 -- (-899.739) (-901.787) [-904.193] (-898.784) * [-900.241] (-901.764) (-907.086) (-903.475) -- 0:00:34
483000 -- [-899.115] (-898.955) (-905.038) (-898.923) * (-899.724) (-898.869) [-899.385] (-900.206) -- 0:00:34
483500 -- (-897.124) [-900.476] (-899.306) (-900.008) * [-900.134] (-900.752) (-899.161) (-897.378) -- 0:00:34
484000 -- (-897.159) [-899.466] (-898.498) (-905.807) * (-901.685) [-898.351] (-898.300) (-900.232) -- 0:00:34
484500 -- (-897.968) (-900.730) [-899.568] (-902.141) * [-902.352] (-899.174) (-898.010) (-900.892) -- 0:00:34
485000 -- (-902.151) (-899.061) [-902.599] (-899.761) * [-900.095] (-898.777) (-897.086) (-899.692) -- 0:00:33
Average standard deviation of split frequencies: 0.012731
485500 -- (-900.891) (-905.990) (-902.591) [-897.559] * (-899.599) (-903.037) [-897.193] (-902.378) -- 0:00:33
486000 -- (-902.752) (-901.845) (-899.025) [-897.397] * (-899.194) (-903.454) [-902.791] (-903.424) -- 0:00:33
486500 -- (-898.655) (-898.239) (-898.247) [-897.626] * (-897.446) [-897.628] (-900.043) (-898.136) -- 0:00:33
487000 -- [-897.973] (-900.476) (-899.318) (-897.918) * (-897.863) [-901.034] (-902.924) (-898.353) -- 0:00:33
487500 -- (-898.174) (-901.307) (-899.655) [-899.529] * [-901.098] (-902.516) (-903.191) (-899.738) -- 0:00:33
488000 -- (-897.486) [-897.498] (-899.609) (-899.238) * (-900.288) (-897.569) (-899.489) [-900.718] -- 0:00:33
488500 -- [-898.077] (-898.478) (-897.296) (-899.323) * (-898.672) (-897.998) (-906.391) [-902.797] -- 0:00:33
489000 -- (-898.110) (-899.235) [-898.067] (-900.884) * [-897.128] (-899.073) (-901.810) (-899.718) -- 0:00:33
489500 -- (-899.119) (-900.352) (-898.279) [-899.084] * (-897.112) (-901.855) (-899.816) [-897.937] -- 0:00:33
490000 -- (-898.016) (-898.670) [-898.253] (-899.002) * (-897.750) (-899.458) [-898.526] (-899.337) -- 0:00:33
Average standard deviation of split frequencies: 0.011465
490500 -- (-897.225) [-900.666] (-899.221) (-899.898) * [-899.784] (-899.667) (-897.452) (-900.065) -- 0:00:33
491000 -- (-898.316) (-900.543) (-904.371) [-898.966] * (-899.186) (-899.312) (-901.174) [-901.238] -- 0:00:33
491500 -- (-899.619) (-899.058) (-901.022) [-898.675] * (-899.430) (-900.409) (-898.470) [-897.249] -- 0:00:33
492000 -- (-903.646) (-898.974) (-899.303) [-900.516] * (-898.218) (-899.020) [-902.437] (-900.697) -- 0:00:33
492500 -- (-902.916) [-897.719] (-898.779) (-898.620) * (-898.910) [-897.526] (-897.253) (-903.709) -- 0:00:32
493000 -- (-900.926) [-899.370] (-899.296) (-901.267) * (-899.735) (-899.708) (-897.347) [-905.026] -- 0:00:32
493500 -- (-901.435) [-898.239] (-900.879) (-902.256) * (-900.624) (-898.166) [-900.793] (-900.577) -- 0:00:32
494000 -- [-901.898] (-898.926) (-900.950) (-900.473) * (-900.042) (-897.212) (-901.300) [-898.801] -- 0:00:32
494500 -- (-901.165) (-904.646) [-900.201] (-904.709) * [-899.535] (-899.523) (-900.965) (-897.886) -- 0:00:32
495000 -- (-900.970) [-897.096] (-899.848) (-905.063) * [-900.828] (-902.850) (-898.509) (-897.242) -- 0:00:32
Average standard deviation of split frequencies: 0.010518
495500 -- (-900.661) [-897.429] (-899.187) (-899.071) * (-899.168) [-897.978] (-898.258) (-898.923) -- 0:00:32
496000 -- (-897.839) [-898.837] (-899.211) (-899.427) * (-898.227) (-899.583) (-900.313) [-897.837] -- 0:00:32
496500 -- (-901.564) (-897.615) (-902.063) [-901.559] * (-898.152) (-900.907) (-897.889) [-898.336] -- 0:00:32
497000 -- (-906.373) (-900.640) [-899.322] (-900.168) * (-898.276) [-898.740] (-899.518) (-900.567) -- 0:00:32
497500 -- (-902.460) (-901.699) (-898.133) [-899.991] * (-899.554) (-897.991) [-901.092] (-898.630) -- 0:00:33
498000 -- (-902.257) (-899.035) (-901.646) [-899.916] * (-900.345) (-900.410) (-898.915) [-901.122] -- 0:00:33
498500 -- (-903.361) (-898.320) [-897.822] (-897.440) * (-901.548) (-899.687) [-898.070] (-900.416) -- 0:00:33
499000 -- (-897.949) [-899.190] (-899.556) (-905.308) * (-905.818) [-898.994] (-898.907) (-899.152) -- 0:00:33
499500 -- (-898.191) [-901.676] (-900.099) (-902.301) * (-900.438) (-902.095) [-900.041] (-903.420) -- 0:00:33
500000 -- (-901.316) (-900.960) (-900.143) [-898.412] * (-897.538) [-897.135] (-900.499) (-900.524) -- 0:00:33
Average standard deviation of split frequencies: 0.010043
500500 -- [-900.944] (-897.932) (-898.515) (-905.198) * (-902.898) (-902.603) (-899.224) [-900.912] -- 0:00:32
501000 -- (-900.664) (-897.579) [-898.553] (-897.907) * (-899.654) (-899.214) [-899.678] (-899.546) -- 0:00:32
501500 -- (-897.854) (-899.300) (-897.471) [-898.285] * (-897.613) [-898.013] (-902.915) (-899.875) -- 0:00:32
502000 -- (-902.179) [-898.894] (-897.975) (-898.347) * (-901.834) [-899.068] (-897.917) (-903.651) -- 0:00:32
502500 -- (-898.475) (-899.293) (-900.376) [-899.221] * [-898.332] (-896.843) (-899.698) (-904.808) -- 0:00:32
503000 -- (-900.332) [-898.908] (-904.896) (-899.927) * (-898.574) [-899.215] (-897.090) (-901.755) -- 0:00:32
503500 -- (-903.035) [-897.820] (-906.047) (-901.234) * (-897.857) (-900.086) (-897.304) [-899.470] -- 0:00:32
504000 -- (-899.301) [-897.314] (-900.072) (-899.732) * [-901.058] (-897.494) (-901.070) (-898.126) -- 0:00:32
504500 -- (-897.903) [-900.413] (-901.171) (-901.237) * (-902.897) (-906.066) [-898.428] (-897.775) -- 0:00:32
505000 -- (-898.270) (-899.669) (-899.260) [-897.720] * [-900.215] (-899.186) (-897.783) (-898.484) -- 0:00:32
Average standard deviation of split frequencies: 0.010621
505500 -- (-898.153) [-899.636] (-898.795) (-898.082) * (-898.405) (-898.304) (-899.676) [-899.213] -- 0:00:32
506000 -- (-898.202) (-902.302) [-901.248] (-898.081) * (-898.038) (-899.864) (-902.567) [-897.082] -- 0:00:32
506500 -- [-899.030] (-901.996) (-901.214) (-897.674) * [-898.516] (-898.313) (-898.225) (-900.120) -- 0:00:32
507000 -- (-900.537) (-900.844) (-898.158) [-897.340] * (-901.319) (-899.748) [-900.339] (-898.318) -- 0:00:32
507500 -- (-899.399) [-899.877] (-898.418) (-897.340) * (-899.433) (-900.863) [-899.796] (-899.039) -- 0:00:32
508000 -- (-899.098) (-898.091) (-898.896) [-899.089] * (-898.635) (-898.189) (-898.657) [-897.891] -- 0:00:31
508500 -- (-899.995) [-898.320] (-897.646) (-901.111) * (-897.918) (-898.503) [-904.856] (-899.847) -- 0:00:31
509000 -- (-899.974) (-899.690) [-898.116] (-900.704) * [-898.066] (-900.681) (-900.803) (-898.344) -- 0:00:31
509500 -- (-900.351) (-899.565) (-896.989) [-897.422] * (-898.077) (-900.970) (-900.449) [-898.180] -- 0:00:31
510000 -- (-899.165) [-897.482] (-898.893) (-897.397) * (-898.166) [-900.425] (-898.072) (-900.311) -- 0:00:31
Average standard deviation of split frequencies: 0.011020
510500 -- [-901.113] (-898.195) (-898.342) (-900.084) * (-899.466) (-900.049) [-899.125] (-901.395) -- 0:00:31
511000 -- (-899.604) (-899.520) [-897.357] (-898.212) * [-899.777] (-898.197) (-898.498) (-898.427) -- 0:00:31
511500 -- (-898.812) (-898.798) (-898.250) [-899.994] * (-902.410) [-898.752] (-898.799) (-899.222) -- 0:00:31
512000 -- (-898.646) (-899.674) [-898.014] (-904.964) * (-900.186) [-899.092] (-900.371) (-898.289) -- 0:00:31
512500 -- (-901.589) [-900.070] (-899.931) (-901.029) * (-900.520) [-901.816] (-899.370) (-899.196) -- 0:00:31
513000 -- [-899.753] (-900.945) (-897.695) (-899.070) * (-902.959) [-900.059] (-898.303) (-898.711) -- 0:00:31
513500 -- (-899.209) (-899.409) [-898.102] (-898.814) * [-901.819] (-902.117) (-898.940) (-901.291) -- 0:00:32
514000 -- (-898.989) (-899.746) (-897.735) [-897.722] * (-898.536) [-901.373] (-898.055) (-900.782) -- 0:00:32
514500 -- (-898.551) [-900.815] (-901.287) (-908.846) * (-898.040) (-897.944) (-899.326) [-897.738] -- 0:00:32
515000 -- [-900.700] (-898.038) (-904.751) (-902.371) * (-898.753) [-898.524] (-902.053) (-899.801) -- 0:00:32
Average standard deviation of split frequencies: 0.010963
515500 -- (-906.310) (-899.392) (-906.177) [-900.861] * (-897.056) [-898.721] (-900.337) (-898.876) -- 0:00:31
516000 -- (-900.521) [-898.788] (-899.455) (-898.420) * (-897.577) (-898.704) [-899.982] (-899.093) -- 0:00:31
516500 -- (-898.429) [-899.254] (-897.328) (-897.440) * (-900.813) [-898.421] (-897.495) (-899.516) -- 0:00:31
517000 -- [-898.786] (-904.561) (-902.077) (-898.162) * (-898.869) [-899.686] (-905.576) (-898.530) -- 0:00:31
517500 -- (-897.377) (-899.284) (-900.602) [-902.538] * (-900.567) (-899.134) (-901.600) [-899.370] -- 0:00:31
518000 -- (-898.557) [-897.571] (-899.123) (-898.649) * (-900.541) (-899.581) (-902.210) [-900.274] -- 0:00:31
518500 -- (-898.861) (-897.543) (-899.387) [-899.360] * (-898.048) (-899.053) (-900.117) [-900.432] -- 0:00:31
519000 -- (-897.654) [-901.371] (-900.411) (-897.742) * (-900.075) (-899.005) (-900.917) [-899.936] -- 0:00:31
519500 -- (-902.074) (-900.895) [-898.961] (-896.897) * [-897.906] (-898.933) (-900.935) (-902.324) -- 0:00:31
520000 -- [-899.635] (-902.684) (-901.566) (-898.427) * (-897.626) [-898.798] (-898.600) (-899.507) -- 0:00:31
Average standard deviation of split frequencies: 0.011131
520500 -- (-899.910) [-899.497] (-897.819) (-896.916) * (-901.850) (-899.580) (-899.034) [-900.819] -- 0:00:31
521000 -- [-899.328] (-899.517) (-898.070) (-897.319) * (-903.971) [-901.806] (-899.837) (-897.750) -- 0:00:31
521500 -- (-898.885) (-898.223) [-897.821] (-897.292) * [-901.407] (-902.000) (-906.793) (-899.064) -- 0:00:31
522000 -- [-899.306] (-897.773) (-898.369) (-900.954) * (-898.845) (-900.719) [-905.758] (-904.474) -- 0:00:31
522500 -- (-900.431) (-903.675) [-898.830] (-900.072) * [-898.354] (-902.546) (-899.861) (-899.621) -- 0:00:31
523000 -- (-898.235) [-900.700] (-898.975) (-897.940) * (-900.175) (-902.867) (-900.310) [-899.270] -- 0:00:31
523500 -- (-897.979) (-897.380) (-898.796) [-897.998] * (-902.703) (-900.020) (-897.615) [-899.393] -- 0:00:30
524000 -- (-897.339) [-899.222] (-898.276) (-899.676) * [-900.749] (-899.528) (-899.561) (-897.743) -- 0:00:30
524500 -- (-899.296) (-899.394) [-900.719] (-898.782) * (-898.537) (-899.888) (-897.277) [-897.169] -- 0:00:30
525000 -- (-898.787) [-899.432] (-902.007) (-897.853) * (-898.155) (-899.483) [-898.809] (-900.238) -- 0:00:30
Average standard deviation of split frequencies: 0.011545
525500 -- (-902.699) (-899.938) (-901.073) [-900.598] * (-901.140) (-899.063) [-898.589] (-898.225) -- 0:00:30
526000 -- [-900.324] (-897.868) (-902.227) (-897.641) * [-898.697] (-900.746) (-902.975) (-898.976) -- 0:00:30
526500 -- (-903.056) [-901.398] (-899.546) (-899.578) * (-898.743) (-899.354) (-900.129) [-898.617] -- 0:00:30
527000 -- (-897.556) [-902.002] (-901.942) (-898.045) * (-899.560) (-898.530) [-899.997] (-899.370) -- 0:00:30
527500 -- [-897.801] (-898.508) (-900.820) (-897.953) * (-898.129) (-896.811) [-900.150] (-899.367) -- 0:00:30
528000 -- (-899.103) (-897.579) [-898.711] (-897.760) * (-897.192) (-898.334) (-897.484) [-909.901] -- 0:00:30
528500 -- [-898.665] (-899.556) (-898.887) (-898.352) * (-898.372) [-898.651] (-899.112) (-899.559) -- 0:00:30
529000 -- (-902.937) (-899.822) (-898.892) [-897.120] * (-898.439) [-899.377] (-903.857) (-898.161) -- 0:00:30
529500 -- (-901.774) (-898.135) [-900.582] (-898.242) * (-902.026) [-897.907] (-897.970) (-897.750) -- 0:00:30
530000 -- (-900.944) (-899.211) (-898.574) [-899.323] * (-897.176) (-902.253) [-899.929] (-899.009) -- 0:00:31
Average standard deviation of split frequencies: 0.011235
530500 -- (-899.045) [-901.194] (-897.628) (-900.055) * (-898.085) (-899.172) (-901.059) [-898.517] -- 0:00:30
531000 -- (-898.496) [-898.592] (-897.611) (-898.962) * (-898.420) (-898.508) [-898.987] (-900.185) -- 0:00:30
531500 -- (-899.231) [-897.992] (-901.192) (-899.839) * (-898.885) (-898.165) [-902.312] (-898.210) -- 0:00:30
532000 -- [-901.816] (-898.871) (-901.023) (-901.331) * (-898.469) (-901.291) [-898.449] (-904.320) -- 0:00:30
532500 -- [-901.381] (-900.494) (-904.121) (-900.852) * (-899.984) (-901.238) (-898.325) [-898.637] -- 0:00:30
533000 -- (-897.563) (-901.824) (-900.416) [-900.624] * (-898.906) (-901.885) (-901.206) [-898.943] -- 0:00:30
533500 -- (-903.558) (-901.779) (-899.539) [-899.281] * (-900.439) [-899.084] (-899.350) (-897.580) -- 0:00:30
534000 -- [-899.617] (-900.592) (-897.233) (-898.545) * (-900.567) (-898.551) [-898.273] (-900.636) -- 0:00:30
534500 -- (-903.965) [-900.484] (-898.572) (-898.125) * [-900.439] (-900.211) (-898.461) (-897.927) -- 0:00:30
535000 -- (-899.787) [-897.947] (-899.995) (-897.607) * (-897.762) (-898.948) (-899.477) [-898.625] -- 0:00:30
Average standard deviation of split frequencies: 0.010761
535500 -- (-900.554) (-898.438) [-897.707] (-898.691) * (-899.440) (-899.262) (-902.505) [-898.329] -- 0:00:30
536000 -- (-898.275) (-897.939) (-900.795) [-897.861] * (-898.094) (-898.956) [-899.054] (-899.141) -- 0:00:30
536500 -- (-897.772) (-898.186) [-897.870] (-904.662) * (-899.058) (-898.931) [-898.987] (-897.492) -- 0:00:30
537000 -- (-900.849) [-899.224] (-898.346) (-899.250) * [-900.218] (-899.734) (-900.778) (-899.922) -- 0:00:30
537500 -- (-900.419) [-897.151] (-897.491) (-899.439) * (-900.302) [-899.347] (-899.006) (-900.313) -- 0:00:30
538000 -- (-900.354) [-899.343] (-897.183) (-898.627) * [-899.965] (-906.038) (-902.935) (-899.729) -- 0:00:30
538500 -- (-898.875) (-902.001) [-898.606] (-902.041) * (-900.546) (-902.761) [-897.475] (-898.325) -- 0:00:29
539000 -- (-899.211) (-898.915) [-899.224] (-897.953) * [-903.999] (-898.273) (-897.502) (-901.025) -- 0:00:29
539500 -- (-899.791) [-898.809] (-898.840) (-898.425) * (-899.458) (-899.263) (-897.272) [-899.111] -- 0:00:29
540000 -- [-898.344] (-899.687) (-898.112) (-897.901) * (-898.320) (-901.670) [-899.813] (-901.917) -- 0:00:29
Average standard deviation of split frequencies: 0.010408
540500 -- (-904.256) [-899.222] (-899.256) (-898.740) * [-899.962] (-900.666) (-897.201) (-901.528) -- 0:00:29
541000 -- (-898.311) [-898.587] (-899.153) (-903.662) * (-899.321) [-898.791] (-901.940) (-899.208) -- 0:00:29
541500 -- (-899.197) (-897.664) [-897.731] (-898.723) * (-901.910) (-901.086) (-901.295) [-897.670] -- 0:00:29
542000 -- (-900.786) (-898.512) [-897.069] (-898.069) * (-900.897) (-898.772) (-897.251) [-898.684] -- 0:00:29
542500 -- (-901.008) (-900.496) (-897.446) [-897.838] * [-898.949] (-898.627) (-897.753) (-898.460) -- 0:00:29
543000 -- (-901.008) (-902.325) [-897.215] (-897.930) * (-899.696) [-899.170] (-900.769) (-899.234) -- 0:00:29
543500 -- (-900.957) (-898.548) [-898.404] (-898.246) * [-899.497] (-900.326) (-897.674) (-900.145) -- 0:00:29
544000 -- (-898.013) (-898.009) (-898.606) [-897.912] * [-898.992] (-897.740) (-900.833) (-902.473) -- 0:00:29
544500 -- (-899.694) (-898.062) (-901.444) [-898.113] * (-899.123) (-899.417) (-901.116) [-899.641] -- 0:00:29
545000 -- (-898.060) (-901.849) (-903.795) [-897.534] * [-897.951] (-900.811) (-906.157) (-899.322) -- 0:00:29
Average standard deviation of split frequencies: 0.011376
545500 -- [-898.219] (-899.694) (-900.800) (-899.930) * (-902.358) (-898.482) [-902.250] (-898.377) -- 0:00:29
546000 -- (-898.114) (-898.705) (-902.020) [-897.158] * [-901.913] (-899.966) (-899.433) (-898.854) -- 0:00:29
546500 -- (-898.674) [-902.925] (-899.223) (-899.560) * (-898.794) (-897.461) (-899.925) [-898.546] -- 0:00:29
547000 -- [-898.974] (-899.404) (-898.441) (-898.425) * (-900.478) [-898.171] (-898.830) (-902.548) -- 0:00:29
547500 -- (-901.182) (-898.410) [-897.349] (-898.425) * (-897.938) (-898.952) [-898.290] (-899.463) -- 0:00:29
548000 -- [-903.059] (-898.756) (-897.838) (-900.840) * (-906.121) (-898.902) [-898.175] (-899.054) -- 0:00:29
548500 -- [-902.637] (-903.557) (-898.649) (-898.101) * [-898.198] (-898.068) (-900.493) (-897.725) -- 0:00:29
549000 -- [-901.709] (-902.529) (-906.050) (-898.141) * [-898.422] (-898.575) (-900.235) (-898.072) -- 0:00:29
549500 -- (-897.754) (-905.434) (-906.840) [-898.182] * [-897.555] (-901.332) (-899.611) (-897.968) -- 0:00:29
550000 -- [-897.359] (-901.461) (-897.596) (-904.022) * [-898.688] (-899.851) (-901.463) (-898.938) -- 0:00:29
Average standard deviation of split frequencies: 0.011431
550500 -- [-897.457] (-903.214) (-898.697) (-899.752) * (-898.443) [-898.724] (-901.290) (-903.937) -- 0:00:29
551000 -- (-898.127) (-900.311) (-898.697) [-900.258] * (-899.980) [-897.567] (-897.866) (-899.731) -- 0:00:29
551500 -- (-902.199) [-898.557] (-897.761) (-899.209) * (-898.137) [-900.714] (-898.428) (-900.878) -- 0:00:29
552000 -- (-901.962) (-899.177) [-898.015] (-899.862) * (-899.332) [-899.412] (-897.353) (-898.785) -- 0:00:29
552500 -- (-901.784) (-897.817) (-901.200) [-898.436] * (-897.153) (-899.253) [-897.113] (-900.632) -- 0:00:29
553000 -- (-905.277) (-897.508) (-899.876) [-898.803] * (-897.529) (-900.572) [-897.720] (-903.962) -- 0:00:29
553500 -- (-899.674) [-899.117] (-901.776) (-902.578) * (-899.278) [-901.094] (-899.087) (-898.991) -- 0:00:29
554000 -- (-902.516) (-898.088) (-898.294) [-901.775] * (-898.366) (-903.700) [-897.085] (-904.457) -- 0:00:28
554500 -- [-898.791] (-901.703) (-899.459) (-899.786) * (-899.370) (-901.151) (-900.553) [-898.903] -- 0:00:28
555000 -- [-900.178] (-897.342) (-898.240) (-897.981) * (-897.854) (-899.654) [-899.058] (-900.431) -- 0:00:28
Average standard deviation of split frequencies: 0.011552
555500 -- (-902.522) (-902.720) [-899.388] (-898.847) * (-897.232) (-898.895) (-902.083) [-900.138] -- 0:00:28
556000 -- [-899.729] (-898.922) (-899.557) (-899.572) * (-901.586) (-900.003) (-901.585) [-902.035] -- 0:00:28
556500 -- (-899.633) (-899.802) (-900.287) [-897.739] * (-901.340) [-897.944] (-898.484) (-898.650) -- 0:00:28
557000 -- (-903.219) (-899.329) (-902.239) [-898.017] * (-900.794) (-898.834) [-897.842] (-899.017) -- 0:00:28
557500 -- (-904.015) (-898.501) (-898.379) [-897.252] * (-899.500) [-897.672] (-897.592) (-898.704) -- 0:00:28
558000 -- (-901.366) [-898.683] (-902.208) (-902.536) * (-898.348) [-897.845] (-897.589) (-900.211) -- 0:00:28
558500 -- [-897.392] (-900.050) (-898.564) (-899.509) * [-897.759] (-906.263) (-898.103) (-900.771) -- 0:00:28
559000 -- (-898.654) (-898.374) [-898.036] (-898.871) * (-899.116) [-898.035] (-897.667) (-897.872) -- 0:00:28
559500 -- (-900.362) (-900.819) [-899.844] (-899.229) * (-899.655) (-899.901) [-897.908] (-898.294) -- 0:00:28
560000 -- (-907.594) [-898.520] (-899.534) (-897.565) * (-901.529) (-899.896) (-902.634) [-898.966] -- 0:00:28
Average standard deviation of split frequencies: 0.010650
560500 -- [-902.818] (-899.667) (-897.756) (-900.497) * (-899.520) [-898.464] (-898.604) (-897.405) -- 0:00:28
561000 -- (-900.513) [-901.062] (-897.339) (-901.033) * [-901.053] (-899.885) (-900.071) (-898.615) -- 0:00:28
561500 -- (-903.560) (-899.774) (-897.913) [-900.470] * (-900.782) [-903.416] (-898.053) (-898.898) -- 0:00:28
562000 -- (-898.780) [-897.508] (-897.794) (-900.196) * [-899.530] (-903.036) (-897.810) (-899.851) -- 0:00:28
562500 -- [-899.394] (-898.561) (-897.194) (-899.154) * (-900.856) (-897.120) (-897.424) [-904.487] -- 0:00:28
563000 -- [-899.651] (-898.139) (-901.200) (-897.119) * (-900.686) (-897.441) (-899.675) [-899.056] -- 0:00:28
563500 -- (-897.783) (-898.874) (-902.273) [-898.989] * (-898.989) [-897.244] (-903.667) (-898.875) -- 0:00:28
564000 -- (-897.635) [-897.944] (-897.402) (-901.453) * (-898.629) [-897.537] (-898.960) (-898.493) -- 0:00:28
564500 -- (-901.231) (-900.550) [-897.217] (-898.189) * (-897.915) (-900.196) [-900.764] (-903.417) -- 0:00:28
565000 -- (-898.870) [-901.705] (-898.625) (-900.166) * (-900.003) (-900.437) (-900.697) [-901.057] -- 0:00:28
Average standard deviation of split frequencies: 0.010328
565500 -- (-898.332) (-902.837) (-899.377) [-897.607] * (-899.703) [-897.914] (-900.996) (-899.285) -- 0:00:28
566000 -- (-898.737) [-898.124] (-900.217) (-901.522) * (-900.506) [-896.950] (-899.198) (-899.170) -- 0:00:28
566500 -- (-900.511) (-898.340) [-899.304] (-899.436) * [-899.010] (-896.987) (-904.064) (-898.758) -- 0:00:28
567000 -- (-899.853) (-897.279) [-899.040] (-898.144) * (-898.828) (-901.815) [-903.030] (-898.655) -- 0:00:28
567500 -- (-899.447) (-902.600) (-898.718) [-899.413] * (-898.699) (-901.256) (-899.156) [-902.088] -- 0:00:28
568000 -- [-901.655] (-898.739) (-899.328) (-898.036) * (-903.583) (-899.474) [-899.642] (-899.650) -- 0:00:28
568500 -- (-900.703) [-898.036] (-898.810) (-898.232) * (-899.006) (-897.936) [-904.874] (-899.253) -- 0:00:28
569000 -- (-900.225) [-898.048] (-901.868) (-900.261) * (-897.481) (-900.669) (-898.393) [-899.292] -- 0:00:28
569500 -- (-899.299) (-899.930) [-897.679] (-900.958) * (-897.115) (-900.930) [-897.667] (-898.560) -- 0:00:27
570000 -- [-898.930] (-901.773) (-899.779) (-897.503) * (-899.986) (-900.088) (-898.187) [-899.941] -- 0:00:27
Average standard deviation of split frequencies: 0.009858
570500 -- (-898.728) (-899.528) (-899.169) [-898.524] * (-899.615) [-899.066] (-897.804) (-900.104) -- 0:00:27
571000 -- (-898.113) [-898.024] (-901.386) (-899.280) * (-900.249) [-897.982] (-899.427) (-897.759) -- 0:00:27
571500 -- (-898.478) (-899.434) (-898.709) [-897.550] * (-898.939) (-898.304) [-899.709] (-902.717) -- 0:00:27
572000 -- (-898.554) (-899.440) [-900.039] (-900.962) * [-898.036] (-897.859) (-898.945) (-900.117) -- 0:00:27
572500 -- (-900.671) (-897.667) (-900.218) [-899.340] * (-903.650) [-899.328] (-898.035) (-898.754) -- 0:00:27
573000 -- (-902.495) (-900.049) [-897.188] (-897.185) * (-900.251) (-902.076) (-910.086) [-900.764] -- 0:00:27
573500 -- [-898.631] (-898.999) (-898.295) (-897.737) * (-899.215) [-899.612] (-901.486) (-899.249) -- 0:00:27
574000 -- (-899.461) (-898.424) [-898.394] (-901.704) * (-898.236) (-899.653) (-901.711) [-898.408] -- 0:00:27
574500 -- [-900.502] (-901.169) (-898.858) (-902.184) * (-900.631) (-899.249) (-903.114) [-898.305] -- 0:00:27
575000 -- (-899.078) (-903.902) [-898.393] (-902.987) * [-898.556] (-899.452) (-898.142) (-897.696) -- 0:00:27
Average standard deviation of split frequencies: 0.009207
575500 -- (-898.872) (-899.667) [-898.119] (-900.764) * (-897.587) (-897.811) [-899.083] (-898.006) -- 0:00:27
576000 -- (-901.005) (-899.886) [-898.723] (-900.960) * (-899.779) [-902.111] (-899.483) (-898.389) -- 0:00:27
576500 -- (-898.472) (-899.748) [-903.829] (-898.048) * (-897.381) [-900.256] (-899.194) (-902.050) -- 0:00:27
577000 -- (-898.523) (-898.838) [-901.108] (-901.227) * (-897.377) [-900.069] (-897.871) (-899.947) -- 0:00:27
577500 -- (-900.682) (-898.860) [-897.416] (-902.346) * (-898.097) (-901.595) [-897.289] (-903.037) -- 0:00:27
578000 -- [-898.787] (-898.922) (-898.308) (-899.347) * (-898.514) (-901.601) [-899.876] (-899.980) -- 0:00:27
578500 -- (-897.543) (-899.573) (-899.430) [-898.604] * [-899.474] (-899.235) (-898.661) (-900.473) -- 0:00:27
579000 -- (-897.387) (-904.359) [-899.104] (-897.991) * (-901.204) [-900.785] (-898.896) (-899.634) -- 0:00:27
579500 -- (-897.284) [-899.315] (-898.863) (-901.048) * (-903.110) [-898.455] (-898.139) (-897.684) -- 0:00:27
580000 -- [-899.531] (-898.578) (-899.601) (-900.246) * [-897.578] (-897.600) (-898.347) (-898.482) -- 0:00:27
Average standard deviation of split frequencies: 0.009438
580500 -- [-900.108] (-898.848) (-897.721) (-899.149) * (-897.996) (-901.448) (-898.087) [-898.123] -- 0:00:27
581000 -- (-901.281) [-897.942] (-898.453) (-898.287) * (-899.687) [-900.118] (-899.704) (-900.566) -- 0:00:27
581500 -- (-898.812) (-898.045) (-899.003) [-901.714] * (-901.058) (-901.392) [-899.178] (-899.081) -- 0:00:27
582000 -- (-902.606) (-898.335) [-900.353] (-900.207) * (-903.335) [-898.739] (-898.507) (-899.281) -- 0:00:27
582500 -- (-901.378) (-901.384) [-898.316] (-900.318) * (-900.481) (-899.822) (-899.253) [-900.034] -- 0:00:27
583000 -- (-898.332) (-899.741) (-899.271) [-898.295] * (-899.255) (-901.001) [-901.930] (-898.588) -- 0:00:27
583500 -- (-900.208) [-902.488] (-899.296) (-897.447) * (-899.948) (-898.251) (-898.667) [-898.924] -- 0:00:27
584000 -- (-898.992) (-898.804) [-897.392] (-897.081) * [-897.682] (-899.647) (-901.635) (-903.251) -- 0:00:27
584500 -- [-897.824] (-897.935) (-897.516) (-902.333) * [-897.840] (-898.180) (-898.545) (-907.630) -- 0:00:27
585000 -- [-897.887] (-898.309) (-899.570) (-901.381) * [-900.957] (-898.088) (-901.467) (-901.848) -- 0:00:26
Average standard deviation of split frequencies: 0.009600
585500 -- (-897.026) (-898.625) (-899.761) [-897.509] * (-902.354) (-897.621) (-898.986) [-900.250] -- 0:00:26
586000 -- [-897.157] (-898.342) (-900.006) (-901.786) * [-901.596] (-899.459) (-901.783) (-905.954) -- 0:00:26
586500 -- (-897.355) (-903.670) [-900.303] (-902.563) * [-902.425] (-899.248) (-900.399) (-904.839) -- 0:00:26
587000 -- (-901.461) (-901.668) (-900.265) [-900.732] * (-900.780) [-900.371] (-901.186) (-903.565) -- 0:00:26
587500 -- [-900.007] (-898.314) (-899.554) (-900.772) * (-900.572) (-903.212) [-898.326] (-898.808) -- 0:00:26
588000 -- [-897.444] (-898.021) (-899.095) (-901.514) * [-900.871] (-900.295) (-898.562) (-899.194) -- 0:00:26
588500 -- (-897.256) [-897.719] (-898.794) (-898.885) * (-901.919) (-900.859) (-898.232) [-899.289] -- 0:00:26
589000 -- (-900.244) [-899.066] (-897.208) (-900.363) * [-901.473] (-899.781) (-900.180) (-902.285) -- 0:00:26
589500 -- (-902.933) (-900.273) (-897.659) [-899.621] * (-900.873) [-900.443] (-900.783) (-900.990) -- 0:00:26
590000 -- [-899.219] (-901.567) (-897.916) (-899.707) * (-899.633) (-901.505) [-898.779] (-898.983) -- 0:00:26
Average standard deviation of split frequencies: 0.009471
590500 -- [-899.329] (-897.276) (-898.613) (-899.515) * (-898.239) [-898.898] (-900.691) (-899.398) -- 0:00:26
591000 -- (-898.578) [-899.930] (-898.456) (-899.688) * (-899.198) [-899.692] (-900.347) (-900.195) -- 0:00:26
591500 -- [-897.226] (-897.184) (-901.460) (-900.612) * (-901.174) [-897.891] (-900.170) (-900.976) -- 0:00:26
592000 -- [-898.037] (-897.212) (-901.364) (-898.542) * (-897.964) (-898.865) (-900.261) [-899.855] -- 0:00:26
592500 -- [-897.663] (-899.578) (-902.208) (-901.228) * (-898.061) (-897.727) (-899.630) [-898.176] -- 0:00:26
593000 -- (-899.510) (-899.280) [-897.643] (-901.766) * [-898.642] (-897.948) (-903.770) (-898.491) -- 0:00:26
593500 -- (-899.971) (-899.641) [-898.760] (-898.726) * (-899.881) (-897.821) [-898.602] (-901.060) -- 0:00:26
594000 -- [-899.661] (-899.607) (-899.231) (-904.389) * (-897.310) (-898.182) [-900.002] (-898.753) -- 0:00:25
594500 -- [-896.982] (-899.106) (-898.388) (-902.813) * (-900.906) (-899.285) [-899.325] (-899.835) -- 0:00:25
595000 -- [-896.959] (-897.620) (-899.815) (-902.770) * (-901.327) [-904.999] (-897.487) (-898.438) -- 0:00:26
Average standard deviation of split frequencies: 0.009491
595500 -- (-898.144) (-898.213) (-898.277) [-900.542] * (-897.652) (-900.776) (-900.477) [-899.343] -- 0:00:26
596000 -- (-897.936) (-898.275) (-897.506) [-900.520] * (-899.613) (-897.620) [-899.499] (-897.893) -- 0:00:26
596500 -- (-897.304) (-900.454) (-898.757) [-901.003] * (-901.866) (-898.159) [-898.887] (-898.605) -- 0:00:26
597000 -- [-897.496] (-899.939) (-899.759) (-901.963) * (-903.197) [-898.947] (-899.556) (-897.627) -- 0:00:26
597500 -- (-899.764) [-898.253] (-898.378) (-899.639) * (-906.265) [-897.145] (-899.877) (-897.526) -- 0:00:26
598000 -- (-900.460) [-899.953] (-896.967) (-901.022) * (-898.355) [-897.793] (-899.074) (-897.493) -- 0:00:26
598500 -- (-902.006) (-901.155) [-897.590] (-898.044) * [-899.276] (-901.379) (-899.263) (-897.838) -- 0:00:26
599000 -- (-899.680) (-898.072) (-897.718) [-899.938] * (-898.687) (-898.917) (-898.438) [-897.628] -- 0:00:26
599500 -- (-898.442) [-899.774] (-899.517) (-902.391) * (-898.084) (-899.075) [-899.383] (-900.519) -- 0:00:26
600000 -- (-898.828) (-899.433) [-899.514] (-899.724) * (-898.582) [-899.502] (-898.355) (-900.016) -- 0:00:25
Average standard deviation of split frequencies: 0.009679
600500 -- [-903.555] (-898.891) (-897.662) (-900.970) * (-898.467) (-899.739) (-899.847) [-899.068] -- 0:00:25
601000 -- (-902.434) (-897.301) (-900.532) [-901.417] * (-898.357) (-898.959) [-898.245] (-898.694) -- 0:00:25
601500 -- (-905.081) [-898.742] (-903.606) (-901.207) * (-897.642) [-897.564] (-898.700) (-901.667) -- 0:00:25
602000 -- (-898.890) (-899.572) (-901.536) [-898.123] * (-901.075) (-898.682) (-897.937) [-897.965] -- 0:00:25
602500 -- (-902.252) [-897.774] (-898.188) (-900.543) * (-899.978) [-900.780] (-897.725) (-897.122) -- 0:00:25
603000 -- (-908.311) [-897.490] (-899.721) (-900.131) * (-900.014) [-899.114] (-898.388) (-898.676) -- 0:00:25
603500 -- (-898.330) (-899.852) [-897.593] (-903.165) * [-898.439] (-897.783) (-897.789) (-901.766) -- 0:00:25
604000 -- (-897.995) [-898.902] (-899.844) (-902.807) * [-899.373] (-897.028) (-899.227) (-899.228) -- 0:00:25
604500 -- (-900.082) [-900.782] (-898.265) (-897.771) * (-897.390) (-897.854) [-898.116] (-898.854) -- 0:00:25
605000 -- (-899.194) [-901.260] (-898.071) (-897.314) * [-897.406] (-897.887) (-897.276) (-897.935) -- 0:00:25
Average standard deviation of split frequencies: 0.009594
605500 -- (-900.111) (-902.412) [-902.752] (-897.702) * (-899.871) (-897.889) [-896.927] (-898.419) -- 0:00:25
606000 -- (-897.452) (-902.945) [-898.239] (-897.952) * [-898.942] (-899.143) (-897.907) (-898.231) -- 0:00:25
606500 -- (-897.995) (-902.460) (-898.640) [-897.697] * (-900.963) [-901.634] (-905.469) (-899.757) -- 0:00:25
607000 -- (-898.889) (-906.289) [-899.111] (-898.537) * (-898.587) (-898.438) [-900.408] (-900.373) -- 0:00:25
607500 -- (-900.198) (-897.445) [-899.134] (-899.430) * (-897.349) (-902.717) (-902.045) [-901.891] -- 0:00:25
608000 -- (-901.966) [-900.459] (-897.904) (-900.259) * (-901.501) (-898.859) (-900.000) [-902.590] -- 0:00:25
608500 -- [-896.943] (-899.713) (-904.931) (-902.566) * (-898.964) (-901.067) (-898.010) [-901.956] -- 0:00:25
609000 -- (-898.695) [-899.322] (-897.190) (-900.460) * [-902.659] (-901.565) (-897.209) (-898.936) -- 0:00:25
609500 -- (-898.633) (-901.279) [-898.518] (-900.047) * (-903.894) (-900.025) (-898.518) [-898.833] -- 0:00:24
610000 -- (-902.422) (-898.787) (-900.374) [-905.361] * (-902.934) (-902.755) [-900.778] (-898.909) -- 0:00:24
Average standard deviation of split frequencies: 0.009881
610500 -- [-900.573] (-897.660) (-898.479) (-901.019) * (-899.273) (-899.739) (-902.332) [-897.820] -- 0:00:24
611000 -- (-902.525) [-899.021] (-901.962) (-900.739) * (-897.546) (-902.769) (-899.878) [-897.053] -- 0:00:25
611500 -- (-900.850) (-899.020) [-897.857] (-902.350) * (-897.494) (-902.389) (-898.797) [-899.834] -- 0:00:25
612000 -- (-902.270) [-904.068] (-897.701) (-898.732) * (-899.101) [-899.631] (-899.693) (-899.381) -- 0:00:25
612500 -- (-900.008) (-900.654) [-897.768] (-899.382) * [-898.497] (-898.217) (-900.377) (-899.791) -- 0:00:25
613000 -- (-897.967) [-900.132] (-904.587) (-899.432) * (-898.532) (-901.076) [-898.692] (-901.350) -- 0:00:25
613500 -- (-897.967) (-902.193) (-902.528) [-902.867] * (-897.845) (-901.347) [-900.781] (-899.138) -- 0:00:25
614000 -- (-899.000) [-897.838] (-906.406) (-897.857) * (-897.965) (-898.898) (-899.826) [-899.636] -- 0:00:25
614500 -- (-899.460) (-899.655) [-898.165] (-898.095) * [-899.108] (-907.434) (-900.767) (-901.028) -- 0:00:25
615000 -- [-900.136] (-897.760) (-898.915) (-903.011) * [-898.908] (-903.823) (-898.180) (-905.115) -- 0:00:25
Average standard deviation of split frequencies: 0.010204
615500 -- (-898.033) (-901.176) (-900.075) [-899.937] * (-899.829) (-902.361) (-902.257) [-898.441] -- 0:00:24
616000 -- [-899.448] (-898.495) (-898.190) (-900.718) * (-900.229) (-901.552) (-898.271) [-901.345] -- 0:00:24
616500 -- (-898.149) (-898.053) [-899.797] (-901.302) * (-901.828) [-901.705] (-900.434) (-900.780) -- 0:00:24
617000 -- (-899.970) (-900.059) [-898.938] (-898.244) * (-902.409) [-898.989] (-900.666) (-899.477) -- 0:00:24
617500 -- [-900.075] (-897.717) (-901.460) (-900.597) * (-898.501) [-900.406] (-903.486) (-898.014) -- 0:00:24
618000 -- (-900.440) [-898.545] (-900.705) (-897.328) * (-899.363) (-897.798) [-898.676] (-900.213) -- 0:00:24
618500 -- (-898.716) (-901.928) (-897.965) [-897.354] * [-897.409] (-897.171) (-898.997) (-899.319) -- 0:00:24
619000 -- [-898.945] (-903.104) (-900.749) (-899.088) * (-899.514) [-898.531] (-898.876) (-901.277) -- 0:00:24
619500 -- [-899.805] (-903.101) (-899.397) (-900.423) * [-898.255] (-898.044) (-900.222) (-898.412) -- 0:00:24
620000 -- (-899.841) (-902.675) [-898.265] (-898.328) * (-899.411) (-900.509) (-897.532) [-897.160] -- 0:00:24
Average standard deviation of split frequencies: 0.009772
620500 -- (-898.011) (-902.095) [-899.525] (-897.619) * (-898.610) (-898.932) (-898.063) [-897.281] -- 0:00:24
621000 -- (-898.636) (-900.449) (-898.273) [-898.598] * [-899.085] (-897.872) (-898.434) (-897.931) -- 0:00:24
621500 -- [-897.587] (-900.796) (-901.490) (-900.282) * [-897.043] (-899.121) (-899.204) (-897.589) -- 0:00:24
622000 -- (-897.583) (-900.638) [-903.940] (-900.702) * (-898.895) [-902.401] (-897.001) (-898.356) -- 0:00:24
622500 -- (-899.462) (-899.037) [-900.136] (-897.966) * (-898.800) (-898.366) [-898.395] (-898.209) -- 0:00:24
623000 -- [-899.633] (-899.291) (-897.627) (-899.101) * (-898.562) (-898.094) [-898.696] (-898.802) -- 0:00:24
623500 -- (-898.457) (-899.072) [-899.677] (-898.696) * (-899.545) (-900.599) (-897.880) [-899.153] -- 0:00:24
624000 -- (-902.176) (-899.705) (-903.523) [-899.139] * [-898.834] (-899.919) (-898.075) (-898.704) -- 0:00:24
624500 -- [-901.599] (-901.421) (-904.048) (-900.682) * [-899.134] (-900.897) (-901.838) (-899.094) -- 0:00:24
625000 -- (-903.112) [-898.472] (-906.859) (-899.519) * [-898.337] (-898.831) (-898.700) (-899.030) -- 0:00:24
Average standard deviation of split frequencies: 0.009739
625500 -- (-905.623) [-898.812] (-902.246) (-899.631) * (-902.621) [-903.852] (-901.102) (-901.864) -- 0:00:23
626000 -- (-898.480) (-897.923) (-904.781) [-898.930] * (-899.913) (-899.832) (-901.240) [-902.915] -- 0:00:23
626500 -- (-897.892) [-897.858] (-899.538) (-900.346) * (-898.171) [-898.147] (-897.790) (-900.341) -- 0:00:23
627000 -- (-899.587) [-899.710] (-898.584) (-902.101) * (-900.492) (-898.719) [-897.895] (-899.719) -- 0:00:24
627500 -- (-899.837) (-899.044) (-899.080) [-900.911] * [-897.624] (-899.296) (-898.169) (-898.298) -- 0:00:24
628000 -- (-898.803) (-899.508) (-899.004) [-900.808] * [-897.973] (-898.145) (-898.499) (-898.482) -- 0:00:24
628500 -- (-897.609) [-899.487] (-900.802) (-897.759) * (-897.427) (-899.347) [-904.560] (-899.360) -- 0:00:24
629000 -- (-897.070) (-898.813) (-898.791) [-898.754] * [-898.896] (-899.270) (-899.336) (-910.333) -- 0:00:24
629500 -- (-899.383) [-899.797] (-897.219) (-898.791) * [-900.211] (-900.069) (-897.400) (-898.307) -- 0:00:24
630000 -- [-897.470] (-899.678) (-902.340) (-900.050) * (-899.885) (-900.016) [-898.156] (-902.427) -- 0:00:24
Average standard deviation of split frequencies: 0.010278
630500 -- (-898.312) [-899.312] (-903.983) (-900.966) * (-899.114) (-898.557) (-898.902) [-901.795] -- 0:00:24
631000 -- (-899.466) (-899.859) (-899.537) [-900.750] * [-901.251] (-897.917) (-900.753) (-903.839) -- 0:00:23
631500 -- [-898.198] (-898.229) (-901.079) (-898.331) * [-896.945] (-896.987) (-905.161) (-902.542) -- 0:00:23
632000 -- [-899.855] (-898.961) (-898.750) (-899.034) * (-899.594) [-897.698] (-902.373) (-897.356) -- 0:00:23
632500 -- (-899.661) (-899.315) [-900.636] (-900.453) * [-898.369] (-899.629) (-899.989) (-900.051) -- 0:00:23
633000 -- [-901.084] (-899.252) (-901.789) (-900.816) * (-897.968) [-898.864] (-898.256) (-899.816) -- 0:00:23
633500 -- [-897.712] (-897.228) (-900.326) (-900.305) * [-898.887] (-902.162) (-898.173) (-899.947) -- 0:00:23
634000 -- (-897.231) (-899.257) [-899.490] (-897.692) * [-897.711] (-899.715) (-897.944) (-899.129) -- 0:00:23
634500 -- (-897.209) (-900.800) [-899.119] (-899.547) * [-897.144] (-898.638) (-898.296) (-905.764) -- 0:00:23
635000 -- (-897.119) (-903.166) [-900.362] (-897.490) * [-897.234] (-902.092) (-898.177) (-898.446) -- 0:00:23
Average standard deviation of split frequencies: 0.010031
635500 -- [-899.633] (-900.946) (-899.233) (-899.777) * (-897.917) [-899.549] (-897.338) (-900.045) -- 0:00:23
636000 -- [-902.739] (-898.395) (-899.793) (-899.216) * [-900.367] (-898.920) (-897.950) (-897.981) -- 0:00:23
636500 -- (-902.428) (-901.437) (-901.701) [-897.946] * (-898.617) (-898.703) [-898.463] (-898.022) -- 0:00:23
637000 -- (-900.753) [-898.244] (-900.359) (-900.592) * [-899.993] (-898.120) (-899.290) (-901.922) -- 0:00:23
637500 -- (-903.158) [-897.822] (-902.136) (-901.378) * [-897.576] (-898.199) (-897.740) (-904.937) -- 0:00:23
638000 -- (-898.640) (-900.847) (-898.165) [-899.372] * (-897.371) (-897.539) (-898.958) [-903.700] -- 0:00:23
638500 -- (-898.014) [-897.874] (-898.854) (-897.394) * [-902.540] (-896.826) (-898.838) (-898.773) -- 0:00:23
639000 -- [-897.427] (-897.959) (-902.859) (-897.480) * (-897.852) [-897.545] (-906.600) (-903.745) -- 0:00:23
639500 -- (-898.802) [-901.021] (-899.542) (-898.853) * (-898.462) (-899.059) [-897.487] (-898.615) -- 0:00:23
640000 -- [-900.337] (-902.239) (-903.091) (-898.540) * [-898.535] (-900.936) (-900.671) (-897.968) -- 0:00:23
Average standard deviation of split frequencies: 0.009811
640500 -- (-898.734) [-899.321] (-903.486) (-898.726) * [-899.903] (-898.993) (-898.078) (-900.754) -- 0:00:23
641000 -- [-898.130] (-900.942) (-901.241) (-898.085) * (-903.599) [-900.949] (-897.946) (-899.017) -- 0:00:22
641500 -- (-898.549) [-900.427] (-900.567) (-898.989) * (-899.274) [-899.328] (-901.027) (-900.881) -- 0:00:22
642000 -- (-898.280) (-902.967) (-897.991) [-899.450] * (-898.822) (-902.296) [-897.635] (-897.298) -- 0:00:22
642500 -- [-902.814] (-902.944) (-897.615) (-897.155) * [-901.945] (-897.787) (-897.446) (-898.189) -- 0:00:22
643000 -- (-897.868) (-901.316) (-897.887) [-899.191] * (-906.240) [-898.944] (-899.474) (-900.203) -- 0:00:22
643500 -- (-899.332) [-900.278] (-899.123) (-898.347) * (-898.207) (-898.180) (-899.647) [-901.174] -- 0:00:23
644000 -- (-898.299) [-898.154] (-898.856) (-901.094) * (-897.390) [-898.161] (-898.773) (-902.544) -- 0:00:23
644500 -- (-900.299) (-898.280) (-898.841) [-898.458] * (-897.726) (-899.855) [-897.889] (-900.965) -- 0:00:23
645000 -- [-898.841] (-900.674) (-900.442) (-900.237) * (-898.370) (-904.705) (-899.405) [-899.242] -- 0:00:23
Average standard deviation of split frequencies: 0.009486
645500 -- (-900.213) [-898.973] (-899.152) (-898.401) * [-902.777] (-899.109) (-902.923) (-898.924) -- 0:00:23
646000 -- (-902.113) (-898.060) (-899.470) [-898.748] * [-898.403] (-900.369) (-899.042) (-900.845) -- 0:00:23
646500 -- (-903.095) (-899.524) (-906.740) [-900.905] * [-898.726] (-898.305) (-897.792) (-900.847) -- 0:00:22
647000 -- (-901.233) [-898.784] (-897.510) (-900.924) * [-900.277] (-899.873) (-899.092) (-899.775) -- 0:00:22
647500 -- [-897.120] (-899.992) (-896.846) (-897.976) * (-899.547) (-899.885) [-901.556] (-899.773) -- 0:00:22
648000 -- (-897.879) (-898.953) [-898.983] (-900.134) * (-897.360) [-902.837] (-900.578) (-901.624) -- 0:00:22
648500 -- [-897.378] (-898.351) (-902.690) (-899.294) * (-898.856) (-900.985) [-899.001] (-907.904) -- 0:00:22
649000 -- (-900.231) (-900.140) (-899.738) [-898.464] * (-898.360) (-897.490) (-898.714) [-902.137] -- 0:00:22
649500 -- (-897.849) (-901.327) (-903.624) [-900.240] * (-900.181) (-899.475) (-899.141) [-897.462] -- 0:00:22
650000 -- (-900.162) (-900.727) (-898.392) [-897.487] * (-899.216) [-897.834] (-898.862) (-900.570) -- 0:00:22
Average standard deviation of split frequencies: 0.009370
650500 -- (-900.893) [-899.594] (-897.923) (-899.109) * (-899.562) [-897.858] (-903.139) (-898.324) -- 0:00:22
651000 -- [-900.463] (-900.616) (-901.466) (-900.615) * [-898.236] (-897.858) (-903.174) (-902.673) -- 0:00:22
651500 -- (-899.649) (-898.671) (-898.111) [-898.791] * (-899.822) (-900.139) [-899.878] (-898.696) -- 0:00:22
652000 -- (-899.811) (-901.006) [-899.039] (-898.054) * (-897.963) (-900.381) [-901.761] (-898.269) -- 0:00:22
652500 -- (-903.980) (-898.322) [-898.607] (-898.844) * (-901.779) (-899.200) [-899.734] (-901.501) -- 0:00:22
653000 -- [-898.483] (-898.667) (-900.362) (-899.090) * (-899.940) (-898.883) (-901.314) [-899.997] -- 0:00:22
653500 -- (-897.564) [-897.364] (-899.306) (-903.081) * (-900.333) [-901.267] (-905.003) (-898.075) -- 0:00:22
654000 -- [-900.624] (-897.588) (-900.602) (-899.900) * (-898.485) (-897.475) [-898.851] (-901.705) -- 0:00:22
654500 -- (-899.923) [-900.823] (-898.707) (-897.589) * [-899.610] (-897.471) (-898.986) (-898.228) -- 0:00:22
655000 -- [-900.179] (-898.799) (-898.491) (-897.405) * (-900.446) (-897.693) [-897.776] (-898.727) -- 0:00:22
Average standard deviation of split frequencies: 0.009294
655500 -- (-899.294) (-899.215) [-898.948] (-898.281) * (-899.647) (-897.014) (-899.571) [-897.916] -- 0:00:22
656000 -- (-898.302) (-898.068) [-899.134] (-900.036) * (-900.142) (-897.640) (-899.313) [-898.785] -- 0:00:22
656500 -- (-900.834) (-901.199) [-897.517] (-900.961) * (-903.684) [-900.159] (-900.847) (-901.520) -- 0:00:21
657000 -- [-898.991] (-898.734) (-896.948) (-902.551) * (-902.957) (-898.770) (-905.834) [-900.734] -- 0:00:21
657500 -- (-898.088) [-899.455] (-898.465) (-899.359) * (-897.588) (-902.990) (-900.113) [-900.308] -- 0:00:21
658000 -- (-898.644) [-897.908] (-898.960) (-900.781) * (-903.145) (-898.938) (-898.238) [-899.641] -- 0:00:21
658500 -- (-900.224) (-899.051) (-898.406) [-898.639] * (-902.317) (-897.648) (-898.552) [-902.314] -- 0:00:21
659000 -- (-900.110) (-900.407) (-898.760) [-898.625] * [-902.988] (-897.392) (-897.669) (-901.773) -- 0:00:21
659500 -- [-901.445] (-899.051) (-901.935) (-898.375) * (-900.461) (-897.494) [-897.588] (-902.002) -- 0:00:22
660000 -- (-897.154) [-903.755] (-900.375) (-898.055) * (-897.872) [-897.749] (-897.248) (-902.458) -- 0:00:22
Average standard deviation of split frequencies: 0.009561
660500 -- (-897.203) (-898.351) (-897.810) [-901.195] * (-899.196) (-898.988) [-897.335] (-899.320) -- 0:00:22
661000 -- (-900.010) (-901.955) (-898.185) [-899.258] * [-900.918] (-901.059) (-897.102) (-901.055) -- 0:00:22
661500 -- (-899.255) [-899.828] (-898.944) (-903.388) * (-898.229) [-898.794] (-897.999) (-902.126) -- 0:00:22
662000 -- (-898.289) [-898.619] (-897.871) (-899.819) * [-899.202] (-898.438) (-899.345) (-900.931) -- 0:00:21
662500 -- (-898.903) [-897.933] (-902.714) (-898.453) * [-900.403] (-898.849) (-898.737) (-899.872) -- 0:00:21
663000 -- (-900.871) (-898.795) (-898.803) [-897.662] * (-901.103) (-897.679) [-899.295] (-899.172) -- 0:00:21
663500 -- (-902.279) [-898.164] (-897.618) (-897.618) * (-898.723) (-897.713) (-899.009) [-899.256] -- 0:00:21
664000 -- (-899.747) [-898.778] (-899.218) (-897.481) * (-900.205) (-900.457) (-901.214) [-898.547] -- 0:00:21
664500 -- (-902.319) [-897.925] (-899.287) (-904.417) * (-901.271) (-904.573) (-902.218) [-898.644] -- 0:00:21
665000 -- (-903.483) (-898.686) (-900.621) [-902.874] * [-898.805] (-898.737) (-902.230) (-899.108) -- 0:00:21
Average standard deviation of split frequencies: 0.009154
665500 -- (-899.781) [-899.638] (-905.401) (-902.904) * (-898.497) (-899.203) [-903.583] (-899.230) -- 0:00:21
666000 -- (-898.577) (-904.160) [-902.334] (-901.464) * [-900.139] (-898.984) (-900.048) (-900.460) -- 0:00:21
666500 -- [-899.121] (-901.797) (-898.163) (-899.059) * (-898.504) [-897.854] (-897.468) (-899.102) -- 0:00:21
667000 -- (-898.264) (-897.714) [-898.038] (-900.157) * [-897.726] (-900.524) (-896.908) (-899.063) -- 0:00:21
667500 -- (-898.802) [-899.084] (-897.375) (-901.140) * [-897.537] (-904.957) (-901.375) (-897.256) -- 0:00:21
668000 -- (-899.697) [-899.057] (-899.835) (-902.010) * (-898.037) [-900.751] (-901.372) (-897.040) -- 0:00:21
668500 -- (-899.155) [-898.254] (-900.231) (-900.368) * (-897.301) [-899.267] (-898.409) (-898.200) -- 0:00:21
669000 -- (-899.135) [-897.299] (-899.226) (-902.868) * (-897.899) [-898.114] (-900.360) (-898.012) -- 0:00:21
669500 -- [-903.470] (-899.982) (-898.317) (-902.007) * (-898.988) (-898.312) (-898.186) [-897.841] -- 0:00:21
670000 -- (-898.960) (-898.970) (-899.454) [-901.037] * (-898.377) (-902.684) (-900.266) [-897.288] -- 0:00:21
Average standard deviation of split frequencies: 0.009700
670500 -- (-900.127) (-900.210) [-898.307] (-904.196) * [-898.374] (-899.991) (-905.947) (-897.319) -- 0:00:21
671000 -- (-901.056) (-899.039) (-899.259) [-897.360] * (-900.440) (-900.132) (-901.171) [-897.598] -- 0:00:21
671500 -- (-899.797) (-898.518) (-899.046) [-897.064] * (-901.129) (-898.788) [-898.756] (-902.178) -- 0:00:21
672000 -- [-897.499] (-899.114) (-898.773) (-900.384) * (-900.756) [-899.921] (-901.224) (-898.536) -- 0:00:20
672500 -- (-902.113) (-900.186) (-899.054) [-897.800] * (-897.061) (-900.380) [-901.185] (-899.960) -- 0:00:20
673000 -- (-902.346) [-901.384] (-899.184) (-901.393) * (-897.251) (-900.041) [-898.062] (-897.443) -- 0:00:20
673500 -- (-898.163) (-901.457) [-897.267] (-899.840) * (-897.211) (-900.956) [-903.499] (-897.936) -- 0:00:20
674000 -- (-898.559) [-899.201] (-898.624) (-900.585) * (-899.564) (-897.597) (-901.833) [-897.677] -- 0:00:20
674500 -- (-900.120) (-898.831) (-900.907) [-898.358] * (-901.335) (-899.506) [-901.936] (-899.236) -- 0:00:20
675000 -- [-898.033] (-899.393) (-899.194) (-905.359) * (-902.257) [-897.449] (-903.013) (-898.225) -- 0:00:20
Average standard deviation of split frequencies: 0.010135
675500 -- [-897.958] (-901.234) (-899.422) (-900.147) * (-899.074) (-900.036) [-904.578] (-901.690) -- 0:00:21
676000 -- (-897.676) (-899.593) (-900.077) [-901.174] * (-901.750) [-897.337] (-903.534) (-902.528) -- 0:00:21
676500 -- (-898.909) [-899.603] (-899.715) (-902.306) * (-899.296) [-898.929] (-901.193) (-904.559) -- 0:00:21
677000 -- (-899.877) (-898.063) [-900.931] (-898.787) * (-902.835) [-898.502] (-897.861) (-900.146) -- 0:00:20
677500 -- (-899.488) (-897.436) [-897.954] (-897.332) * (-899.556) [-898.978] (-898.781) (-900.143) -- 0:00:20
678000 -- (-899.618) [-897.742] (-898.705) (-898.741) * (-898.132) (-898.899) [-901.985] (-900.382) -- 0:00:20
678500 -- [-898.649] (-898.022) (-898.492) (-897.203) * [-899.220] (-899.898) (-899.141) (-908.858) -- 0:00:20
679000 -- (-898.765) (-897.941) (-899.023) [-900.414] * (-898.224) (-903.485) [-900.441] (-906.616) -- 0:00:20
679500 -- [-897.583] (-898.162) (-900.079) (-900.628) * (-907.709) (-897.317) [-902.387] (-903.759) -- 0:00:20
680000 -- (-898.976) (-897.931) (-900.274) [-897.781] * [-902.499] (-898.591) (-898.373) (-899.469) -- 0:00:20
Average standard deviation of split frequencies: 0.010712
680500 -- (-899.895) (-898.734) [-898.469] (-898.586) * (-899.963) (-897.831) (-897.714) [-899.589] -- 0:00:20
681000 -- (-900.385) [-899.810] (-902.710) (-899.912) * (-899.181) (-899.448) (-899.576) [-899.304] -- 0:00:20
681500 -- [-897.352] (-900.861) (-899.989) (-899.050) * [-899.553] (-898.661) (-899.744) (-897.802) -- 0:00:20
682000 -- [-897.719] (-904.662) (-900.237) (-901.583) * (-898.962) (-898.556) [-900.118] (-902.317) -- 0:00:20
682500 -- (-901.372) [-902.006] (-900.270) (-898.933) * (-898.993) (-898.593) (-899.596) [-900.406] -- 0:00:20
683000 -- (-899.515) [-899.424] (-899.841) (-902.003) * (-897.813) [-899.371] (-900.825) (-899.512) -- 0:00:20
683500 -- (-899.833) (-898.561) [-899.834] (-898.724) * [-901.850] (-900.684) (-900.665) (-900.274) -- 0:00:20
684000 -- (-901.458) (-898.792) (-898.195) [-900.544] * [-900.920] (-897.780) (-901.100) (-899.325) -- 0:00:20
684500 -- (-901.040) [-897.266] (-898.559) (-900.142) * [-898.155] (-896.948) (-898.900) (-898.308) -- 0:00:20
685000 -- (-901.759) (-898.346) [-902.236] (-898.985) * (-897.484) [-897.532] (-899.652) (-899.066) -- 0:00:20
Average standard deviation of split frequencies: 0.011086
685500 -- (-899.893) (-898.312) [-898.516] (-902.793) * [-898.301] (-897.350) (-898.011) (-899.496) -- 0:00:20
686000 -- (-899.073) (-897.766) [-899.081] (-898.669) * [-897.621] (-904.712) (-900.460) (-902.043) -- 0:00:20
686500 -- [-899.301] (-900.320) (-902.841) (-898.906) * (-899.238) (-906.871) [-897.420] (-900.499) -- 0:00:20
687000 -- [-898.508] (-898.678) (-902.285) (-901.404) * (-905.724) (-901.563) [-899.887] (-903.510) -- 0:00:20
687500 -- (-899.908) (-900.034) [-898.290] (-900.653) * (-899.096) (-900.006) (-899.080) [-898.077] -- 0:00:20
688000 -- (-898.706) (-900.041) (-897.440) [-901.153] * (-899.019) [-897.395] (-899.584) (-898.742) -- 0:00:19
688500 -- [-897.217] (-900.684) (-898.011) (-898.271) * [-899.729] (-898.721) (-900.759) (-898.827) -- 0:00:19
689000 -- (-897.840) (-897.900) (-898.611) [-897.099] * (-898.431) [-899.563] (-904.563) (-898.693) -- 0:00:19
689500 -- (-897.550) (-899.558) [-897.244] (-897.897) * [-899.161] (-897.776) (-898.507) (-899.389) -- 0:00:19
690000 -- (-897.589) (-898.375) [-897.785] (-902.066) * (-898.284) [-897.985] (-897.597) (-898.964) -- 0:00:19
Average standard deviation of split frequencies: 0.011467
690500 -- (-898.214) (-898.275) [-898.876] (-899.708) * (-904.238) (-900.288) [-897.958] (-900.526) -- 0:00:19
691000 -- (-898.139) (-899.224) [-900.677] (-900.250) * [-899.388] (-904.275) (-899.540) (-900.314) -- 0:00:19
691500 -- (-900.297) (-901.129) [-900.009] (-899.201) * (-898.725) (-900.147) [-902.032] (-899.149) -- 0:00:20
692000 -- (-898.741) [-899.514] (-899.329) (-898.746) * (-902.004) (-901.337) [-901.331] (-899.998) -- 0:00:20
692500 -- (-899.670) [-899.206] (-897.807) (-899.371) * (-901.072) (-900.789) [-897.581] (-899.391) -- 0:00:19
693000 -- (-901.035) (-899.709) [-898.268] (-898.283) * [-899.782] (-898.311) (-902.088) (-899.192) -- 0:00:19
693500 -- (-903.373) (-898.611) [-897.723] (-901.285) * (-902.236) (-898.671) [-903.547] (-904.916) -- 0:00:19
694000 -- (-899.230) [-899.056] (-897.747) (-899.041) * [-899.228] (-900.594) (-902.708) (-900.964) -- 0:00:19
694500 -- (-900.151) [-900.015] (-897.931) (-898.160) * (-898.229) (-897.171) (-904.510) [-898.168] -- 0:00:19
695000 -- (-897.495) (-900.604) [-897.986] (-901.049) * (-898.373) [-897.572] (-901.326) (-898.110) -- 0:00:19
Average standard deviation of split frequencies: 0.011243
695500 -- (-901.791) (-899.849) (-897.441) [-897.634] * (-900.862) [-898.049] (-898.392) (-898.587) -- 0:00:19
696000 -- (-898.224) (-898.749) [-897.706] (-897.276) * (-898.397) (-902.015) [-897.079] (-900.552) -- 0:00:19
696500 -- (-901.523) [-900.758] (-899.149) (-902.652) * (-898.758) (-897.392) (-897.692) [-901.116] -- 0:00:19
697000 -- [-897.647] (-899.960) (-898.198) (-899.209) * (-898.091) [-898.663] (-897.724) (-898.469) -- 0:00:19
697500 -- (-898.346) (-900.096) (-897.872) [-897.039] * [-898.190] (-898.167) (-901.576) (-899.513) -- 0:00:19
698000 -- (-898.329) (-898.537) (-899.227) [-899.602] * [-900.421] (-899.410) (-898.377) (-899.673) -- 0:00:19
698500 -- (-899.793) [-899.511] (-897.649) (-901.439) * [-898.976] (-899.259) (-898.265) (-901.089) -- 0:00:19
699000 -- [-898.395] (-898.590) (-898.549) (-900.176) * (-898.989) (-899.070) (-898.729) [-899.793] -- 0:00:19
699500 -- (-898.175) [-897.531] (-900.076) (-898.791) * [-898.206] (-898.753) (-900.224) (-898.709) -- 0:00:19
700000 -- (-898.038) (-897.608) [-899.740] (-898.318) * (-897.346) (-902.503) (-903.583) [-897.812] -- 0:00:19
Average standard deviation of split frequencies: 0.010810
700500 -- (-904.221) [-900.483] (-897.126) (-900.701) * (-897.647) (-903.610) (-898.565) [-898.890] -- 0:00:19
701000 -- [-901.656] (-899.648) (-905.012) (-899.973) * (-898.268) (-901.633) [-898.971] (-897.540) -- 0:00:19
701500 -- (-902.926) [-898.746] (-899.957) (-898.462) * (-899.121) (-897.535) [-898.054] (-899.361) -- 0:00:19
702000 -- (-899.190) (-900.057) [-903.304] (-898.815) * [-898.878] (-898.181) (-897.594) (-900.180) -- 0:00:19
702500 -- (-899.172) (-899.551) (-898.363) [-899.316] * (-898.517) [-899.065] (-897.066) (-897.383) -- 0:00:19
703000 -- (-902.285) (-902.648) [-897.639] (-901.198) * [-900.503] (-899.696) (-899.284) (-900.828) -- 0:00:19
703500 -- (-898.078) (-897.994) (-897.346) [-898.093] * (-897.166) [-900.012] (-903.367) (-898.972) -- 0:00:18
704000 -- (-902.707) [-898.439] (-900.539) (-900.190) * (-897.235) (-897.759) [-898.431] (-898.508) -- 0:00:18
704500 -- (-900.879) (-902.548) (-903.071) [-897.101] * (-899.290) (-898.918) [-898.334] (-899.716) -- 0:00:18
705000 -- [-897.315] (-900.711) (-899.046) (-901.022) * (-898.712) [-903.309] (-900.772) (-900.014) -- 0:00:18
Average standard deviation of split frequencies: 0.010683
705500 -- (-898.983) [-898.466] (-897.186) (-898.281) * [-899.283] (-899.339) (-899.596) (-899.922) -- 0:00:18
706000 -- [-897.670] (-898.584) (-897.181) (-901.865) * (-899.102) [-899.170] (-900.668) (-898.789) -- 0:00:18
706500 -- [-897.021] (-900.262) (-899.294) (-898.206) * [-897.917] (-898.678) (-902.786) (-899.070) -- 0:00:18
707000 -- (-898.077) (-899.917) [-898.395] (-900.294) * (-897.977) (-897.851) (-900.965) [-897.250] -- 0:00:18
707500 -- (-899.265) [-901.557] (-899.196) (-898.219) * [-897.881] (-897.713) (-898.428) (-898.322) -- 0:00:18
708000 -- (-898.990) (-900.212) [-903.239] (-898.609) * (-897.394) (-900.618) (-901.447) [-898.597] -- 0:00:18
708500 -- [-901.139] (-899.585) (-897.739) (-902.834) * [-897.585] (-905.150) (-898.398) (-897.101) -- 0:00:18
709000 -- (-900.172) (-901.865) (-898.531) [-900.455] * (-897.430) (-898.850) (-899.726) [-900.684] -- 0:00:18
709500 -- (-899.210) [-899.866] (-897.690) (-904.644) * (-897.152) (-899.317) [-899.421] (-899.558) -- 0:00:18
710000 -- (-898.696) (-900.712) [-897.809] (-899.030) * (-898.281) [-899.180] (-898.264) (-899.459) -- 0:00:18
Average standard deviation of split frequencies: 0.010392
710500 -- (-899.348) (-897.432) [-897.280] (-901.596) * (-897.704) (-899.309) [-897.857] (-898.653) -- 0:00:18
711000 -- (-903.616) (-903.668) [-901.071] (-906.960) * (-898.096) (-897.827) (-897.975) [-898.302] -- 0:00:18
711500 -- (-900.070) [-898.622] (-903.357) (-903.734) * (-898.417) (-899.498) (-900.395) [-899.023] -- 0:00:18
712000 -- (-898.829) (-900.776) [-898.579] (-898.378) * (-898.888) [-901.900] (-900.087) (-898.354) -- 0:00:18
712500 -- (-898.252) (-898.398) [-897.137] (-897.089) * [-899.013] (-904.700) (-898.673) (-900.672) -- 0:00:18
713000 -- (-898.838) (-898.970) (-901.495) [-897.186] * (-897.730) (-897.650) [-899.746] (-901.555) -- 0:00:18
713500 -- (-898.104) [-900.718] (-901.749) (-901.445) * [-898.009] (-902.307) (-902.311) (-898.950) -- 0:00:18
714000 -- [-898.598] (-902.643) (-900.762) (-900.751) * (-898.066) (-904.814) (-899.203) [-899.190] -- 0:00:18
714500 -- (-898.326) (-901.494) (-899.324) [-900.338] * (-900.778) (-900.640) [-899.531] (-900.828) -- 0:00:18
715000 -- (-897.852) [-899.210] (-899.870) (-897.469) * (-897.324) (-901.195) [-899.098] (-899.921) -- 0:00:18
Average standard deviation of split frequencies: 0.009832
715500 -- (-898.553) [-897.740] (-899.631) (-900.014) * [-897.940] (-897.887) (-900.236) (-900.051) -- 0:00:18
716000 -- (-900.058) [-898.994] (-899.262) (-899.576) * (-898.856) (-898.001) [-900.150] (-901.209) -- 0:00:18
716500 -- (-898.606) (-898.818) [-905.981] (-901.059) * (-899.803) [-898.910] (-902.394) (-901.015) -- 0:00:18
717000 -- (-898.968) (-901.987) (-901.023) [-898.283] * [-898.739] (-902.081) (-898.307) (-903.721) -- 0:00:18
717500 -- (-898.711) (-899.386) [-900.618] (-901.652) * (-900.046) [-900.659] (-901.133) (-899.026) -- 0:00:18
718000 -- (-899.219) (-899.181) [-899.470] (-899.672) * (-903.183) (-900.882) [-898.736] (-901.859) -- 0:00:18
718500 -- (-901.142) (-900.144) [-900.646] (-898.978) * (-899.873) [-900.967] (-897.692) (-898.983) -- 0:00:18
719000 -- (-898.928) (-898.903) (-900.488) [-902.968] * (-898.010) [-903.441] (-897.729) (-898.874) -- 0:00:17
719500 -- [-900.637] (-898.602) (-898.886) (-896.919) * [-900.264] (-898.854) (-898.343) (-899.920) -- 0:00:17
720000 -- (-901.284) (-899.827) (-898.833) [-898.337] * [-898.362] (-898.349) (-899.312) (-899.953) -- 0:00:17
Average standard deviation of split frequencies: 0.009681
720500 -- (-899.958) (-901.262) (-903.078) [-902.057] * (-897.967) (-897.922) (-897.973) [-898.373] -- 0:00:17
721000 -- (-900.118) [-898.876] (-906.522) (-899.631) * (-902.308) (-902.384) (-898.353) [-903.279] -- 0:00:17
721500 -- (-899.833) [-897.967] (-900.881) (-898.197) * (-898.050) (-904.725) (-898.107) [-900.274] -- 0:00:17
722000 -- [-899.992] (-899.702) (-900.346) (-897.545) * (-899.602) (-905.999) [-897.504] (-898.780) -- 0:00:17
722500 -- (-900.877) (-898.187) (-899.710) [-900.133] * (-901.671) (-900.321) [-899.790] (-902.842) -- 0:00:17
723000 -- [-901.185] (-898.650) (-897.582) (-900.167) * (-898.604) (-898.188) [-897.970] (-900.124) -- 0:00:17
723500 -- (-899.313) [-899.416] (-899.449) (-898.608) * (-900.073) [-897.971] (-897.664) (-898.586) -- 0:00:17
724000 -- (-900.326) (-901.485) [-899.380] (-898.603) * (-900.154) [-898.346] (-897.778) (-898.357) -- 0:00:17
724500 -- (-898.526) (-898.011) (-899.472) [-898.579] * (-899.607) [-899.031] (-897.775) (-900.300) -- 0:00:17
725000 -- [-901.001] (-898.568) (-900.533) (-899.799) * [-900.005] (-900.691) (-898.595) (-898.635) -- 0:00:17
Average standard deviation of split frequencies: 0.009696
725500 -- [-903.016] (-901.302) (-899.487) (-899.541) * (-900.902) [-899.006] (-902.005) (-900.238) -- 0:00:17
726000 -- (-902.347) (-899.482) [-897.620] (-898.659) * (-909.254) (-897.488) [-898.469] (-899.068) -- 0:00:17
726500 -- (-899.951) (-899.702) (-898.290) [-899.409] * (-899.493) (-902.313) (-898.183) [-898.811] -- 0:00:17
727000 -- [-899.815] (-903.367) (-903.001) (-898.942) * [-897.948] (-901.178) (-899.569) (-904.343) -- 0:00:17
727500 -- (-903.183) [-898.413] (-897.205) (-898.864) * (-902.759) [-898.105] (-898.309) (-899.868) -- 0:00:17
728000 -- (-902.997) (-897.606) [-898.287] (-898.989) * (-899.642) (-897.158) [-898.742] (-898.633) -- 0:00:17
728500 -- (-901.397) (-898.824) [-900.472] (-900.402) * (-898.587) [-900.642] (-898.439) (-898.487) -- 0:00:17
729000 -- (-900.491) [-897.474] (-899.740) (-899.697) * (-898.955) (-900.549) [-900.918] (-899.678) -- 0:00:17
729500 -- (-898.400) [-901.770] (-900.038) (-899.424) * [-901.375] (-900.266) (-899.219) (-900.074) -- 0:00:17
730000 -- (-899.414) (-898.898) (-901.678) [-899.662] * [-899.942] (-899.886) (-897.910) (-898.155) -- 0:00:17
Average standard deviation of split frequencies: 0.009462
730500 -- (-898.202) (-899.959) [-902.054] (-898.310) * (-902.738) (-901.615) (-897.399) [-898.130] -- 0:00:17
731000 -- (-898.107) (-899.055) [-899.138] (-897.701) * (-902.561) [-897.975] (-900.088) (-897.699) -- 0:00:17
731500 -- [-899.165] (-898.125) (-898.908) (-898.358) * [-900.224] (-898.135) (-901.663) (-900.456) -- 0:00:17
732000 -- (-900.584) (-898.547) [-898.035] (-899.556) * (-898.413) [-897.455] (-898.716) (-897.664) -- 0:00:17
732500 -- (-900.941) (-899.103) (-898.734) [-899.792] * [-899.545] (-900.631) (-897.926) (-900.171) -- 0:00:17
733000 -- [-899.373] (-900.017) (-902.677) (-900.547) * (-900.184) [-900.250] (-899.076) (-897.685) -- 0:00:17
733500 -- (-898.891) [-902.839] (-899.348) (-898.132) * (-901.157) (-898.262) (-899.433) [-898.071] -- 0:00:17
734000 -- [-896.990] (-897.590) (-907.069) (-900.238) * (-899.860) [-897.422] (-902.946) (-904.922) -- 0:00:17
734500 -- [-897.088] (-900.048) (-900.820) (-898.871) * (-897.367) (-897.171) [-900.207] (-901.750) -- 0:00:16
735000 -- (-898.357) [-900.866] (-898.252) (-898.111) * (-898.742) [-898.273] (-898.117) (-899.448) -- 0:00:16
Average standard deviation of split frequencies: 0.009607
735500 -- (-906.738) [-897.572] (-898.367) (-897.861) * (-898.974) [-898.273] (-903.724) (-899.225) -- 0:00:16
736000 -- (-898.756) [-901.583] (-899.496) (-908.041) * (-899.609) (-901.006) (-901.027) [-904.125] -- 0:00:16
736500 -- (-900.068) (-904.555) (-898.050) [-904.076] * (-901.389) (-898.749) (-898.027) [-897.172] -- 0:00:16
737000 -- (-898.357) (-900.000) [-897.316] (-897.931) * (-898.672) (-899.372) [-897.984] (-898.943) -- 0:00:16
737500 -- (-898.560) (-902.162) [-898.139] (-902.373) * (-900.099) [-900.599] (-897.821) (-899.867) -- 0:00:16
738000 -- [-898.556] (-900.715) (-900.541) (-900.965) * (-901.006) (-899.222) [-898.948] (-899.060) -- 0:00:16
738500 -- [-899.205] (-898.620) (-902.906) (-898.842) * [-899.023] (-904.904) (-898.239) (-898.103) -- 0:00:16
739000 -- (-904.354) [-900.380] (-898.212) (-898.116) * (-901.182) [-903.330] (-904.830) (-897.183) -- 0:00:16
739500 -- (-899.254) (-899.954) (-899.015) [-899.573] * [-901.671] (-898.303) (-897.313) (-897.236) -- 0:00:16
740000 -- (-901.289) (-899.410) (-898.473) [-900.042] * (-898.865) [-899.013] (-897.307) (-898.074) -- 0:00:16
Average standard deviation of split frequencies: 0.009250
740500 -- (-897.845) (-899.660) [-900.415] (-900.901) * [-900.972] (-899.286) (-899.388) (-899.571) -- 0:00:16
741000 -- (-902.278) [-903.404] (-897.805) (-897.701) * [-900.639] (-897.716) (-900.352) (-902.554) -- 0:00:16
741500 -- (-897.745) (-897.421) (-898.737) [-898.070] * (-899.138) (-898.290) [-897.436] (-901.600) -- 0:00:16
742000 -- (-897.780) (-897.288) (-902.880) [-897.379] * [-900.439] (-897.340) (-898.222) (-898.476) -- 0:00:16
742500 -- (-897.940) (-898.595) (-903.758) [-900.165] * (-897.691) [-897.502] (-898.460) (-897.937) -- 0:00:16
743000 -- (-899.021) (-899.045) [-897.902] (-900.013) * (-897.492) [-898.681] (-897.416) (-899.961) -- 0:00:16
743500 -- [-896.858] (-901.031) (-899.294) (-900.676) * (-897.589) (-900.146) (-901.272) [-900.096] -- 0:00:16
744000 -- (-898.087) [-900.071] (-900.145) (-900.183) * [-897.580] (-906.286) (-901.169) (-899.621) -- 0:00:16
744500 -- (-898.145) (-899.260) [-898.678] (-899.741) * [-897.066] (-900.707) (-899.593) (-902.235) -- 0:00:16
745000 -- (-901.278) [-897.878] (-898.788) (-899.153) * [-897.954] (-901.553) (-899.450) (-897.327) -- 0:00:16
Average standard deviation of split frequencies: 0.008931
745500 -- (-898.252) [-898.610] (-901.833) (-898.453) * (-898.134) (-902.689) (-900.221) [-897.434] -- 0:00:16
746000 -- (-899.814) (-897.591) [-899.950] (-898.258) * [-897.610] (-899.501) (-898.554) (-899.402) -- 0:00:16
746500 -- [-898.728] (-900.020) (-899.605) (-901.255) * [-897.891] (-898.899) (-899.501) (-904.396) -- 0:00:16
747000 -- [-896.981] (-902.663) (-899.693) (-903.646) * [-900.148] (-898.488) (-897.272) (-898.527) -- 0:00:16
747500 -- (-898.269) [-901.970] (-898.491) (-900.522) * (-899.849) (-899.250) [-897.231] (-899.725) -- 0:00:16
748000 -- (-898.365) (-902.463) [-899.722] (-904.436) * [-898.369] (-898.426) (-898.562) (-899.698) -- 0:00:16
748500 -- (-897.856) (-899.998) [-898.710] (-904.521) * (-898.615) (-898.818) [-899.353] (-898.729) -- 0:00:16
749000 -- [-897.348] (-900.893) (-898.074) (-899.074) * [-897.858] (-901.579) (-901.689) (-902.733) -- 0:00:16
749500 -- [-899.032] (-899.029) (-898.209) (-898.710) * (-898.436) (-898.695) [-899.308] (-897.694) -- 0:00:16
750000 -- (-901.571) (-901.255) [-897.545] (-899.706) * (-898.773) (-900.944) (-897.412) [-901.347] -- 0:00:16
Average standard deviation of split frequencies: 0.009127
750500 -- (-905.639) [-902.885] (-898.058) (-899.048) * (-899.138) (-899.118) (-897.312) [-899.415] -- 0:00:15
751000 -- (-902.755) (-899.291) (-897.829) [-899.755] * (-897.750) (-903.094) [-899.164] (-900.814) -- 0:00:15
751500 -- (-897.762) (-898.239) [-899.049] (-899.352) * [-898.921] (-898.462) (-898.574) (-899.932) -- 0:00:15
752000 -- (-898.161) (-899.903) (-902.390) [-897.912] * [-899.131] (-898.972) (-897.435) (-900.632) -- 0:00:15
752500 -- (-899.627) (-904.825) (-900.032) [-897.539] * (-898.260) (-897.902) [-898.985] (-906.687) -- 0:00:15
753000 -- [-900.983] (-898.717) (-902.142) (-898.202) * (-899.024) (-898.344) [-897.049] (-904.285) -- 0:00:15
753500 -- (-899.161) (-899.203) [-899.459] (-899.292) * (-897.752) (-898.787) [-897.065] (-899.991) -- 0:00:15
754000 -- (-898.973) (-899.737) (-901.169) [-900.822] * (-898.883) [-901.032] (-897.159) (-897.900) -- 0:00:15
754500 -- (-898.178) (-900.560) [-898.860] (-900.957) * (-898.688) (-907.372) [-897.679] (-900.863) -- 0:00:15
755000 -- (-897.265) [-898.653] (-900.740) (-900.176) * [-900.257] (-899.498) (-899.184) (-898.751) -- 0:00:15
Average standard deviation of split frequencies: 0.008647
755500 -- (-898.658) [-899.585] (-899.235) (-903.150) * [-903.738] (-899.266) (-897.712) (-900.478) -- 0:00:15
756000 -- [-898.636] (-897.595) (-901.323) (-897.878) * (-906.190) [-900.384] (-897.727) (-897.993) -- 0:00:15
756500 -- (-898.981) [-897.397] (-897.848) (-901.296) * [-899.105] (-898.140) (-900.028) (-897.515) -- 0:00:15
757000 -- (-904.053) [-897.367] (-902.344) (-903.929) * (-899.833) [-896.970] (-898.476) (-898.961) -- 0:00:15
757500 -- (-898.622) (-898.771) (-901.893) [-898.583] * (-899.136) (-896.947) (-898.007) [-901.124] -- 0:00:15
758000 -- (-898.845) (-897.817) [-898.327] (-901.074) * (-902.361) [-898.942] (-902.833) (-899.514) -- 0:00:15
758500 -- (-899.519) [-898.059] (-898.561) (-898.174) * (-897.804) (-900.019) [-898.266] (-900.129) -- 0:00:15
759000 -- [-898.762] (-901.900) (-899.349) (-899.072) * (-897.900) (-901.441) [-897.414] (-901.016) -- 0:00:15
759500 -- (-899.794) [-898.238] (-901.228) (-897.886) * (-898.920) [-900.876] (-899.628) (-899.324) -- 0:00:15
760000 -- [-899.740] (-897.640) (-900.173) (-898.911) * (-906.597) (-901.057) [-900.864] (-902.124) -- 0:00:15
Average standard deviation of split frequencies: 0.008841
760500 -- (-903.525) (-898.585) [-897.026] (-899.605) * (-900.698) (-899.757) [-902.482] (-898.210) -- 0:00:15
761000 -- (-900.551) (-899.888) [-898.394] (-898.323) * [-901.030] (-898.588) (-898.513) (-900.093) -- 0:00:15
761500 -- (-898.047) (-900.962) [-897.867] (-898.882) * (-899.709) (-902.907) [-901.786] (-899.798) -- 0:00:15
762000 -- (-903.513) [-897.842] (-900.476) (-897.641) * (-899.379) (-898.297) [-900.200] (-899.491) -- 0:00:15
762500 -- (-897.357) [-896.960] (-898.836) (-897.710) * (-900.097) (-905.515) [-899.017] (-898.547) -- 0:00:15
763000 -- (-898.613) (-899.168) (-899.046) [-897.710] * (-898.271) (-902.221) (-897.734) [-901.230] -- 0:00:15
763500 -- [-898.273] (-897.475) (-902.413) (-897.710) * [-904.368] (-900.599) (-898.213) (-899.907) -- 0:00:15
764000 -- (-897.319) (-899.003) [-899.743] (-901.949) * [-899.045] (-899.622) (-897.372) (-900.535) -- 0:00:15
764500 -- (-897.925) (-898.217) (-898.499) [-901.606] * (-902.418) (-900.265) [-899.427] (-897.701) -- 0:00:15
765000 -- [-897.509] (-899.407) (-909.010) (-900.203) * (-901.583) (-901.234) (-898.423) [-897.617] -- 0:00:15
Average standard deviation of split frequencies: 0.008821
765500 -- (-898.454) (-900.795) [-898.805] (-901.037) * (-899.519) (-901.831) (-897.731) [-899.638] -- 0:00:15
766000 -- [-897.808] (-897.806) (-897.475) (-899.177) * (-899.045) [-897.631] (-904.710) (-899.192) -- 0:00:14
766500 -- (-899.315) [-898.774] (-899.865) (-899.611) * (-900.662) [-897.676] (-903.408) (-899.835) -- 0:00:14
767000 -- [-900.426] (-901.311) (-901.016) (-899.235) * (-898.164) (-900.474) (-898.884) [-901.165] -- 0:00:14
767500 -- [-898.391] (-898.693) (-899.863) (-897.350) * (-902.877) (-899.863) (-899.021) [-899.121] -- 0:00:14
768000 -- (-903.150) [-907.131] (-899.132) (-901.277) * (-898.408) (-903.168) [-899.453] (-898.101) -- 0:00:14
768500 -- [-902.045] (-901.825) (-901.482) (-898.462) * (-900.930) (-900.901) [-897.415] (-898.851) -- 0:00:14
769000 -- (-900.629) (-897.939) (-897.364) [-898.520] * [-899.827] (-898.941) (-897.335) (-897.789) -- 0:00:14
769500 -- (-901.829) [-897.644] (-897.542) (-898.001) * (-900.726) (-901.736) [-899.480] (-899.526) -- 0:00:14
770000 -- [-901.429] (-901.190) (-898.185) (-899.640) * [-900.387] (-898.423) (-898.808) (-897.978) -- 0:00:14
Average standard deviation of split frequencies: 0.008971
770500 -- (-898.723) [-897.380] (-897.592) (-900.236) * [-899.870] (-899.671) (-902.163) (-899.689) -- 0:00:14
771000 -- [-903.739] (-898.798) (-899.719) (-900.794) * [-900.400] (-901.224) (-899.359) (-902.531) -- 0:00:14
771500 -- (-899.080) (-897.564) [-898.195] (-901.727) * (-897.931) (-897.659) [-897.753] (-900.262) -- 0:00:14
772000 -- [-899.331] (-900.753) (-898.617) (-903.816) * (-900.046) (-902.957) [-899.082] (-898.505) -- 0:00:14
772500 -- [-900.012] (-900.571) (-898.350) (-904.567) * (-900.890) (-899.290) [-900.109] (-898.641) -- 0:00:14
773000 -- (-902.452) (-903.902) [-899.556] (-902.196) * [-901.151] (-897.340) (-898.624) (-899.802) -- 0:00:14
773500 -- (-899.799) (-898.538) (-900.605) [-900.261] * (-901.842) (-899.267) [-899.669] (-898.857) -- 0:00:14
774000 -- (-898.921) (-898.500) [-899.770] (-904.314) * [-898.159] (-899.993) (-897.800) (-901.059) -- 0:00:14
774500 -- (-906.185) (-899.547) (-901.141) [-902.822] * [-897.592] (-900.620) (-897.186) (-898.329) -- 0:00:14
775000 -- (-900.070) [-898.503] (-900.368) (-901.164) * (-898.887) (-898.150) [-899.236] (-899.695) -- 0:00:14
Average standard deviation of split frequencies: 0.008829
775500 -- [-897.386] (-901.215) (-899.170) (-901.446) * [-900.663] (-898.952) (-900.713) (-899.087) -- 0:00:14
776000 -- (-900.733) [-899.545] (-901.842) (-900.278) * [-899.332] (-900.305) (-900.090) (-903.066) -- 0:00:14
776500 -- (-898.469) (-900.986) (-901.696) [-899.339] * (-900.698) (-901.753) [-898.352] (-897.679) -- 0:00:14
777000 -- (-897.130) (-898.003) [-899.495] (-898.806) * (-904.506) (-901.948) [-897.964] (-897.893) -- 0:00:14
777500 -- [-898.479] (-897.858) (-902.531) (-900.326) * (-898.886) (-915.257) [-897.464] (-899.236) -- 0:00:14
778000 -- [-899.080] (-898.904) (-898.867) (-900.616) * [-898.019] (-897.839) (-897.901) (-900.355) -- 0:00:14
778500 -- (-902.354) (-899.857) (-897.681) [-897.499] * (-898.449) (-897.644) [-902.436] (-897.692) -- 0:00:14
779000 -- (-903.501) (-898.962) (-896.868) [-900.321] * [-900.222] (-897.592) (-901.967) (-897.560) -- 0:00:14
779500 -- (-902.137) (-898.558) (-907.382) [-898.134] * (-897.300) [-899.130] (-899.364) (-903.222) -- 0:00:14
780000 -- [-899.803] (-898.021) (-899.783) (-896.959) * [-897.330] (-900.401) (-906.613) (-904.975) -- 0:00:14
Average standard deviation of split frequencies: 0.008534
780500 -- (-898.238) (-898.441) [-900.373] (-900.370) * (-899.158) (-902.216) [-899.068] (-897.384) -- 0:00:14
781000 -- [-897.247] (-901.857) (-903.316) (-899.320) * (-897.651) [-900.351] (-902.532) (-897.622) -- 0:00:14
781500 -- (-897.464) (-900.522) [-897.805] (-902.076) * [-897.682] (-897.962) (-899.543) (-897.509) -- 0:00:13
782000 -- (-897.869) [-898.375] (-900.047) (-902.557) * (-898.306) [-901.137] (-900.658) (-897.212) -- 0:00:13
782500 -- (-902.950) (-899.540) [-898.902] (-902.817) * (-904.869) [-899.776] (-897.820) (-898.692) -- 0:00:13
783000 -- [-904.165] (-903.380) (-901.057) (-900.573) * (-898.459) (-898.148) (-899.196) [-898.981] -- 0:00:13
783500 -- (-899.158) [-901.473] (-897.487) (-903.574) * [-898.754] (-901.405) (-902.813) (-900.539) -- 0:00:13
784000 -- (-899.413) (-901.263) [-898.874] (-901.620) * [-902.975] (-902.765) (-903.534) (-903.225) -- 0:00:13
784500 -- (-901.119) (-906.699) [-899.455] (-899.245) * (-901.069) (-898.123) (-910.402) [-903.428] -- 0:00:13
785000 -- (-899.075) (-902.533) (-900.910) [-898.094] * (-899.082) [-905.068] (-901.615) (-899.849) -- 0:00:13
Average standard deviation of split frequencies: 0.008397
785500 -- (-898.657) (-900.026) [-900.634] (-898.942) * (-901.845) (-900.380) (-897.925) [-899.562] -- 0:00:13
786000 -- (-899.080) (-904.184) (-896.967) [-899.627] * (-897.790) [-900.838] (-899.127) (-899.529) -- 0:00:13
786500 -- [-898.109] (-903.547) (-899.393) (-897.396) * (-899.237) (-901.312) (-900.929) [-898.942] -- 0:00:13
787000 -- [-899.618] (-899.870) (-898.992) (-902.185) * (-897.717) (-898.527) (-902.000) [-898.250] -- 0:00:13
787500 -- (-899.117) (-899.794) (-899.124) [-903.720] * (-897.771) (-898.401) [-897.953] (-897.708) -- 0:00:13
788000 -- [-898.514] (-902.307) (-898.702) (-903.284) * (-897.466) [-898.268] (-901.953) (-898.469) -- 0:00:13
788500 -- [-902.053] (-901.608) (-903.154) (-900.863) * (-902.315) [-899.074] (-903.596) (-898.325) -- 0:00:13
789000 -- (-905.993) (-900.711) [-898.708] (-901.191) * (-899.500) (-898.094) (-901.458) [-899.053] -- 0:00:13
789500 -- [-898.040] (-897.273) (-900.711) (-902.551) * (-899.462) (-900.297) [-899.305] (-898.561) -- 0:00:13
790000 -- (-900.444) [-898.648] (-898.370) (-900.938) * (-897.272) (-899.857) [-900.143] (-898.063) -- 0:00:13
Average standard deviation of split frequencies: 0.008267
790500 -- (-899.750) (-900.915) (-897.937) [-897.325] * (-899.347) (-898.747) (-899.915) [-899.961] -- 0:00:13
791000 -- (-899.258) [-904.309] (-898.670) (-897.016) * (-898.282) [-898.782] (-898.925) (-897.363) -- 0:00:13
791500 -- (-899.688) (-902.112) (-899.301) [-896.993] * (-900.684) (-899.671) (-898.975) [-897.363] -- 0:00:13
792000 -- (-900.775) [-898.908] (-900.751) (-897.801) * (-900.280) (-898.300) (-903.294) [-897.889] -- 0:00:13
792500 -- [-897.667] (-902.389) (-899.659) (-903.610) * (-898.338) (-898.407) (-898.885) [-896.964] -- 0:00:13
793000 -- (-900.551) (-898.781) (-899.339) [-898.194] * (-897.552) (-898.354) (-899.861) [-900.798] -- 0:00:13
793500 -- (-899.535) [-897.779] (-898.052) (-901.179) * (-898.491) (-897.511) (-898.577) [-898.647] -- 0:00:13
794000 -- (-901.995) [-897.779] (-899.215) (-900.129) * (-900.222) (-898.126) [-898.470] (-900.075) -- 0:00:13
794500 -- [-897.601] (-900.037) (-899.540) (-900.483) * (-900.385) [-897.174] (-898.328) (-900.865) -- 0:00:13
795000 -- (-897.355) [-899.655] (-900.066) (-900.603) * (-900.004) [-897.495] (-899.453) (-898.921) -- 0:00:13
Average standard deviation of split frequencies: 0.008528
795500 -- (-898.191) (-897.207) [-898.021] (-900.709) * (-901.347) [-898.608] (-899.334) (-900.258) -- 0:00:13
796000 -- (-897.265) [-897.288] (-898.049) (-899.301) * (-899.998) [-900.492] (-901.366) (-901.236) -- 0:00:13
796500 -- [-897.580] (-898.592) (-898.690) (-901.504) * (-897.292) (-900.192) (-900.957) [-899.692] -- 0:00:13
797000 -- (-900.375) (-899.307) (-899.969) [-897.939] * (-897.431) (-901.605) (-899.477) [-900.080] -- 0:00:12
797500 -- (-900.818) (-904.651) (-901.026) [-897.454] * (-899.287) (-899.934) (-899.843) [-899.342] -- 0:00:12
798000 -- [-897.773] (-900.936) (-903.500) (-899.663) * (-899.900) (-897.651) [-898.936] (-900.788) -- 0:00:12
798500 -- [-897.623] (-898.007) (-901.039) (-899.147) * (-900.756) (-898.531) (-898.696) [-898.946] -- 0:00:12
799000 -- (-903.141) (-899.461) [-899.393] (-899.350) * (-899.014) (-900.071) (-900.696) [-897.223] -- 0:00:12
799500 -- (-897.713) (-899.920) [-897.810] (-899.672) * (-898.596) (-897.635) [-902.977] (-899.056) -- 0:00:12
800000 -- (-898.976) (-900.584) [-904.037] (-906.881) * [-897.697] (-898.752) (-902.876) (-898.802) -- 0:00:12
Average standard deviation of split frequencies: 0.008714
800500 -- (-902.558) [-902.535] (-900.682) (-902.777) * (-897.881) [-901.581] (-901.614) (-903.296) -- 0:00:12
801000 -- (-903.764) (-898.642) (-900.705) [-898.428] * [-899.187] (-898.733) (-900.141) (-902.078) -- 0:00:12
801500 -- (-898.811) [-899.394] (-899.879) (-901.542) * (-897.280) (-898.973) [-898.743] (-898.673) -- 0:00:12
802000 -- (-898.087) (-898.947) (-898.789) [-898.119] * (-899.013) (-901.626) [-901.469] (-900.983) -- 0:00:12
802500 -- [-897.011] (-898.988) (-901.738) (-898.119) * (-899.121) (-902.514) (-897.995) [-899.770] -- 0:00:12
803000 -- (-898.194) [-897.864] (-898.978) (-898.362) * [-898.180] (-899.135) (-899.219) (-898.223) -- 0:00:12
803500 -- (-901.137) (-900.256) (-897.982) [-899.578] * [-897.731] (-898.479) (-898.099) (-902.763) -- 0:00:12
804000 -- (-899.348) (-899.719) (-898.882) [-897.717] * (-899.232) (-899.823) [-897.487] (-897.912) -- 0:00:12
804500 -- (-900.153) (-900.192) (-902.400) [-898.251] * [-901.225] (-898.982) (-898.816) (-898.865) -- 0:00:12
805000 -- (-901.625) [-899.472] (-906.213) (-899.563) * (-898.717) [-897.936] (-900.616) (-904.743) -- 0:00:12
Average standard deviation of split frequencies: 0.008539
805500 -- (-902.254) (-897.355) [-901.357] (-899.193) * (-900.140) (-897.935) [-898.803] (-902.688) -- 0:00:12
806000 -- (-899.371) [-898.700] (-900.970) (-900.691) * (-897.814) (-898.078) (-901.761) [-900.594] -- 0:00:12
806500 -- (-901.031) (-903.654) (-899.046) [-900.383] * (-897.987) [-897.894] (-899.964) (-900.810) -- 0:00:12
807000 -- (-899.886) (-900.148) (-904.155) [-897.295] * (-898.076) (-899.707) [-900.054] (-906.154) -- 0:00:12
807500 -- (-902.561) [-899.262] (-898.992) (-897.912) * (-898.389) [-897.890] (-900.037) (-901.067) -- 0:00:12
808000 -- (-898.541) (-901.778) [-896.986] (-898.409) * (-898.127) (-897.436) (-903.813) [-900.770] -- 0:00:12
808500 -- (-904.696) (-899.494) [-901.842] (-898.519) * (-897.568) (-897.498) [-898.546] (-902.299) -- 0:00:12
809000 -- (-901.550) [-900.918] (-897.211) (-901.007) * (-898.735) (-900.914) [-897.151] (-904.435) -- 0:00:12
809500 -- (-899.415) (-898.133) (-899.545) [-898.424] * [-898.037] (-898.530) (-898.023) (-901.386) -- 0:00:12
810000 -- (-901.232) (-899.526) (-902.073) [-900.240] * (-898.493) (-900.862) [-898.770] (-900.126) -- 0:00:12
Average standard deviation of split frequencies: 0.008645
810500 -- [-900.286] (-899.698) (-902.357) (-899.310) * (-901.687) [-899.678] (-898.226) (-901.494) -- 0:00:12
811000 -- (-897.755) (-899.715) (-901.091) [-901.107] * (-899.274) (-899.659) [-898.009] (-900.649) -- 0:00:12
811500 -- (-898.080) [-899.871] (-898.232) (-899.750) * (-898.985) (-902.948) [-897.185] (-900.452) -- 0:00:12
812000 -- [-897.049] (-904.027) (-899.890) (-903.220) * (-901.733) (-899.738) [-898.740] (-899.485) -- 0:00:12
812500 -- (-899.113) (-900.049) (-898.678) [-899.398] * (-899.540) (-898.121) [-897.762] (-898.326) -- 0:00:12
813000 -- (-899.310) (-901.343) [-898.716] (-898.798) * (-899.251) (-898.923) [-900.442] (-900.087) -- 0:00:11
813500 -- (-899.463) (-905.358) [-898.731] (-898.618) * [-900.711] (-900.063) (-900.192) (-900.179) -- 0:00:11
814000 -- (-897.786) (-897.750) (-897.809) [-897.874] * (-898.558) (-901.455) (-898.932) [-898.003] -- 0:00:11
814500 -- [-899.558] (-898.945) (-901.152) (-898.651) * (-899.192) (-899.911) [-898.379] (-905.631) -- 0:00:11
815000 -- (-902.487) (-897.935) (-899.371) [-899.825] * (-899.270) (-900.997) (-898.479) [-903.062] -- 0:00:11
Average standard deviation of split frequencies: 0.008743
815500 -- [-901.342] (-898.535) (-899.697) (-897.548) * [-899.545] (-900.955) (-899.724) (-901.945) -- 0:00:11
816000 -- [-898.240] (-900.200) (-902.690) (-896.999) * (-902.309) (-901.464) [-899.022] (-897.621) -- 0:00:11
816500 -- [-898.648] (-897.638) (-899.290) (-897.344) * (-899.111) [-899.540] (-898.714) (-897.813) -- 0:00:11
817000 -- (-897.740) (-899.155) (-900.569) [-897.658] * [-898.938] (-899.996) (-898.410) (-898.956) -- 0:00:11
817500 -- (-901.141) (-898.718) [-898.272] (-897.240) * [-897.752] (-900.169) (-899.962) (-898.199) -- 0:00:11
818000 -- (-899.823) (-899.314) (-901.070) [-896.857] * (-899.618) (-899.120) (-901.216) [-898.113] -- 0:00:11
818500 -- (-898.333) [-899.447] (-898.403) (-897.252) * [-899.289] (-903.986) (-901.147) (-899.955) -- 0:00:11
819000 -- [-898.541] (-900.550) (-899.786) (-898.570) * (-900.080) (-900.144) (-898.521) [-899.317] -- 0:00:11
819500 -- [-902.568] (-899.588) (-901.464) (-898.494) * [-911.779] (-900.539) (-900.560) (-899.977) -- 0:00:11
820000 -- (-902.212) [-899.295] (-903.242) (-899.691) * (-901.604) (-901.045) (-897.884) [-898.971] -- 0:00:11
Average standard deviation of split frequencies: 0.008923
820500 -- [-900.002] (-900.424) (-900.424) (-903.344) * (-898.197) [-900.603] (-898.432) (-901.838) -- 0:00:11
821000 -- [-899.513] (-897.530) (-897.841) (-902.440) * (-898.976) (-898.592) (-899.526) [-902.671] -- 0:00:11
821500 -- (-899.518) [-898.427] (-897.945) (-898.796) * (-896.968) (-898.432) [-900.425] (-900.082) -- 0:00:11
822000 -- (-905.677) [-900.149] (-899.802) (-898.155) * (-896.980) (-898.394) (-897.432) [-900.070] -- 0:00:11
822500 -- (-898.774) [-900.195] (-900.219) (-898.265) * (-899.921) [-899.141] (-897.472) (-900.367) -- 0:00:11
823000 -- (-899.911) (-900.227) [-905.507] (-897.860) * [-898.704] (-897.546) (-897.795) (-897.553) -- 0:00:11
823500 -- (-898.822) (-901.133) [-900.121] (-898.511) * (-900.649) (-899.562) [-898.711] (-897.310) -- 0:00:11
824000 -- [-898.543] (-904.760) (-901.574) (-902.569) * (-897.704) (-899.163) [-900.022] (-900.450) -- 0:00:11
824500 -- [-897.783] (-906.484) (-899.928) (-898.640) * (-898.629) (-901.682) (-897.619) [-899.077] -- 0:00:11
825000 -- (-904.018) (-900.496) (-900.238) [-897.855] * [-898.808] (-898.765) (-897.739) (-901.637) -- 0:00:11
Average standard deviation of split frequencies: 0.008979
825500 -- [-901.027] (-899.723) (-900.963) (-897.190) * [-897.530] (-900.695) (-898.910) (-905.570) -- 0:00:11
826000 -- (-900.562) [-898.494] (-900.587) (-899.118) * (-899.560) (-904.454) (-897.976) [-901.912] -- 0:00:11
826500 -- (-901.137) [-902.954] (-897.989) (-898.255) * [-905.723] (-900.128) (-901.906) (-904.208) -- 0:00:11
827000 -- (-900.629) (-899.643) [-897.875] (-898.184) * [-905.998] (-904.172) (-898.811) (-898.327) -- 0:00:11
827500 -- (-900.745) [-900.625] (-898.763) (-898.098) * (-900.849) (-900.361) [-900.771] (-897.633) -- 0:00:11
828000 -- [-900.080] (-898.704) (-899.738) (-901.637) * [-898.358] (-900.630) (-900.330) (-899.262) -- 0:00:11
828500 -- (-897.747) (-898.026) (-899.688) [-899.168] * (-898.498) [-899.087] (-897.721) (-898.631) -- 0:00:10
829000 -- (-898.406) (-897.318) [-899.517] (-900.517) * (-899.243) [-901.086] (-898.122) (-899.071) -- 0:00:10
829500 -- (-897.290) (-897.968) (-904.118) [-901.471] * (-899.363) [-898.032] (-902.653) (-897.771) -- 0:00:10
830000 -- (-898.374) (-904.000) [-903.041] (-899.330) * (-899.239) (-897.382) (-905.618) [-900.386] -- 0:00:10
Average standard deviation of split frequencies: 0.008626
830500 -- (-897.821) (-899.938) (-897.869) [-902.565] * [-898.766] (-897.127) (-898.507) (-901.002) -- 0:00:10
831000 -- (-899.798) (-897.465) [-899.214] (-897.555) * [-898.980] (-898.621) (-900.280) (-897.530) -- 0:00:10
831500 -- (-901.354) (-901.064) (-900.068) [-901.954] * (-899.847) [-897.414] (-901.091) (-901.479) -- 0:00:10
832000 -- (-903.427) [-900.193] (-898.723) (-900.252) * (-898.724) [-897.973] (-898.886) (-898.570) -- 0:00:10
832500 -- (-902.304) [-898.443] (-904.585) (-901.330) * [-899.317] (-900.603) (-897.431) (-898.687) -- 0:00:10
833000 -- (-899.565) (-901.994) (-899.995) [-898.042] * (-899.504) (-897.781) (-900.606) [-898.724] -- 0:00:10
833500 -- (-897.785) (-900.156) [-905.722] (-897.568) * (-899.403) (-899.625) [-899.096] (-898.983) -- 0:00:10
834000 -- (-901.975) (-900.420) [-898.865] (-898.969) * (-898.668) (-900.026) [-898.618] (-902.185) -- 0:00:10
834500 -- (-900.612) (-904.223) [-902.798] (-897.795) * (-899.575) [-903.206] (-900.214) (-898.887) -- 0:00:10
835000 -- (-901.155) (-905.512) [-898.867] (-897.896) * (-899.282) [-899.711] (-898.437) (-898.741) -- 0:00:10
Average standard deviation of split frequencies: 0.008609
835500 -- (-898.642) (-901.269) (-899.498) [-898.930] * [-901.461] (-898.186) (-899.089) (-900.618) -- 0:00:10
836000 -- (-901.662) (-900.860) [-899.621] (-900.423) * [-899.132] (-899.564) (-899.244) (-897.835) -- 0:00:10
836500 -- (-902.274) (-903.862) [-898.770] (-899.309) * [-900.991] (-901.457) (-900.789) (-897.847) -- 0:00:10
837000 -- (-902.022) (-900.047) (-899.939) [-900.087] * (-897.304) [-900.921] (-898.370) (-899.266) -- 0:00:10
837500 -- [-900.632] (-904.838) (-902.257) (-898.171) * [-899.683] (-899.570) (-900.208) (-900.537) -- 0:00:10
838000 -- (-907.579) [-899.280] (-902.126) (-899.069) * (-900.936) [-898.702] (-899.098) (-899.432) -- 0:00:10
838500 -- (-897.510) (-902.026) [-899.528] (-901.089) * [-899.396] (-897.843) (-900.359) (-899.543) -- 0:00:10
839000 -- (-898.244) (-898.456) (-900.391) [-898.105] * (-900.661) [-899.368] (-899.647) (-899.975) -- 0:00:10
839500 -- (-897.923) (-898.057) [-898.179] (-897.984) * [-901.139] (-901.024) (-901.138) (-897.264) -- 0:00:10
840000 -- (-898.736) (-900.698) (-899.334) [-898.417] * (-898.145) (-901.512) [-897.731] (-897.257) -- 0:00:10
Average standard deviation of split frequencies: 0.008636
840500 -- (-902.287) (-900.439) (-899.107) [-897.696] * (-902.708) [-900.444] (-898.450) (-899.845) -- 0:00:10
841000 -- (-900.784) [-899.442] (-900.065) (-897.374) * [-897.535] (-901.984) (-899.316) (-899.109) -- 0:00:10
841500 -- [-899.612] (-900.093) (-902.734) (-897.406) * [-898.826] (-901.366) (-903.563) (-899.149) -- 0:00:10
842000 -- (-900.967) (-904.866) (-897.571) [-901.475] * (-897.886) (-896.859) (-897.570) [-897.883] -- 0:00:10
842500 -- (-899.489) [-897.212] (-900.471) (-898.507) * (-897.959) [-897.951] (-899.912) (-899.590) -- 0:00:10
843000 -- [-899.106] (-897.179) (-904.335) (-899.580) * (-897.887) (-897.320) [-902.733] (-900.512) -- 0:00:10
843500 -- [-901.140] (-898.012) (-904.735) (-899.944) * (-898.381) (-904.882) (-898.957) [-900.468] -- 0:00:10
844000 -- (-900.016) (-904.998) (-904.421) [-900.233] * (-902.351) (-898.256) (-898.294) [-897.731] -- 0:00:09
844500 -- (-898.385) (-899.658) (-905.050) [-899.326] * (-901.093) (-897.744) (-897.638) [-899.070] -- 0:00:09
845000 -- [-900.098] (-898.999) (-898.724) (-898.951) * (-898.088) [-901.644] (-901.315) (-897.603) -- 0:00:09
Average standard deviation of split frequencies: 0.008433
845500 -- (-899.452) [-901.409] (-897.825) (-899.781) * [-897.899] (-900.940) (-899.639) (-898.615) -- 0:00:09
846000 -- (-899.232) (-899.534) (-900.713) [-898.365] * (-901.258) [-897.558] (-898.768) (-902.574) -- 0:00:09
846500 -- (-897.983) [-897.668] (-899.550) (-901.274) * (-898.920) [-898.672] (-902.836) (-902.315) -- 0:00:09
847000 -- (-899.340) [-897.592] (-898.026) (-897.777) * (-899.242) (-897.922) [-901.210] (-903.542) -- 0:00:09
847500 -- (-898.444) (-898.481) (-903.439) [-898.085] * (-897.196) (-899.085) [-897.972] (-898.863) -- 0:00:09
848000 -- (-897.717) (-898.227) (-903.323) [-899.656] * (-899.783) [-898.997] (-901.551) (-899.176) -- 0:00:09
848500 -- (-901.328) (-898.389) (-904.997) [-898.150] * (-899.549) (-900.666) [-903.074] (-902.424) -- 0:00:09
849000 -- (-899.534) [-897.629] (-898.762) (-901.062) * [-897.879] (-901.360) (-900.126) (-899.396) -- 0:00:09
849500 -- (-903.549) [-897.735] (-899.565) (-897.662) * (-900.291) (-900.190) (-898.732) [-898.689] -- 0:00:09
850000 -- [-903.068] (-897.986) (-903.202) (-901.518) * [-899.665] (-898.835) (-897.414) (-898.278) -- 0:00:09
Average standard deviation of split frequencies: 0.008128
850500 -- (-898.347) (-898.611) (-897.679) [-898.312] * (-905.945) [-900.624] (-898.720) (-898.503) -- 0:00:09
851000 -- [-898.948] (-897.971) (-899.333) (-898.474) * [-902.766] (-898.551) (-901.491) (-900.098) -- 0:00:09
851500 -- [-898.581] (-899.154) (-898.618) (-898.344) * [-898.774] (-900.298) (-901.488) (-902.246) -- 0:00:09
852000 -- (-899.302) (-897.775) [-898.184] (-898.556) * (-899.064) (-899.728) [-900.038] (-899.105) -- 0:00:09
852500 -- (-900.213) (-900.615) (-897.997) [-898.118] * (-898.650) (-898.736) [-903.114] (-901.653) -- 0:00:09
853000 -- (-898.614) [-899.708] (-901.720) (-897.366) * (-897.473) [-902.172] (-897.882) (-901.845) -- 0:00:09
853500 -- [-897.680] (-899.929) (-899.751) (-900.004) * (-898.936) [-898.559] (-897.882) (-899.795) -- 0:00:09
854000 -- (-900.169) (-899.899) (-899.009) [-899.623] * (-898.846) (-898.126) [-898.780] (-905.711) -- 0:00:09
854500 -- (-901.003) (-902.776) (-897.634) [-897.998] * (-899.351) (-900.385) (-899.932) [-901.901] -- 0:00:09
855000 -- (-898.112) [-898.154] (-899.710) (-897.832) * (-899.161) (-899.029) [-899.382] (-902.225) -- 0:00:09
Average standard deviation of split frequencies: 0.008371
855500 -- (-901.903) (-897.590) [-900.950] (-898.184) * (-899.508) (-898.394) [-898.692] (-903.682) -- 0:00:09
856000 -- [-901.289] (-899.738) (-898.168) (-901.612) * [-898.621] (-898.443) (-900.050) (-902.095) -- 0:00:09
856500 -- (-900.069) (-898.300) (-899.538) [-906.528] * (-902.272) (-901.574) [-899.706] (-900.323) -- 0:00:09
857000 -- (-901.646) (-899.371) [-899.484] (-899.076) * [-901.412] (-898.289) (-899.432) (-900.024) -- 0:00:09
857500 -- [-902.949] (-899.758) (-902.345) (-898.413) * (-897.996) (-903.964) (-898.235) [-904.624] -- 0:00:09
858000 -- (-900.807) [-898.184] (-899.350) (-897.849) * [-898.361] (-905.347) (-899.239) (-904.084) -- 0:00:09
858500 -- (-901.247) (-898.147) (-899.173) [-898.088] * (-901.776) (-899.750) [-897.768] (-901.713) -- 0:00:09
859000 -- (-901.311) (-898.452) (-899.362) [-898.337] * [-897.125] (-898.593) (-901.420) (-901.605) -- 0:00:09
859500 -- (-898.600) (-900.016) (-903.931) [-897.857] * (-900.827) (-897.747) (-899.407) [-898.961] -- 0:00:08
860000 -- (-906.103) (-898.831) (-899.043) [-897.008] * (-900.012) (-898.185) (-901.922) [-901.111] -- 0:00:08
Average standard deviation of split frequencies: 0.008289
860500 -- (-899.908) (-898.188) (-897.236) [-902.208] * (-897.940) [-898.053] (-903.013) (-901.641) -- 0:00:08
861000 -- [-897.761] (-898.644) (-906.264) (-897.873) * (-898.550) (-899.276) [-898.991] (-897.926) -- 0:00:09
861500 -- (-898.190) (-897.383) [-899.969] (-898.686) * (-899.179) (-899.713) [-898.856] (-901.244) -- 0:00:09
862000 -- (-898.998) [-900.649] (-898.762) (-902.058) * (-897.856) [-899.762] (-898.245) (-902.366) -- 0:00:08
862500 -- (-901.628) (-899.884) [-897.492] (-899.885) * (-898.520) (-899.234) [-897.949] (-899.155) -- 0:00:08
863000 -- [-899.390] (-898.659) (-897.305) (-898.395) * (-897.947) (-898.559) (-900.198) [-898.545] -- 0:00:08
863500 -- (-899.730) [-898.891] (-898.058) (-899.317) * (-901.306) (-902.650) (-898.061) [-901.359] -- 0:00:08
864000 -- (-898.282) (-897.007) (-903.591) [-899.489] * (-901.165) (-904.082) (-898.103) [-898.042] -- 0:00:08
864500 -- (-899.405) [-897.007] (-897.450) (-901.147) * (-900.526) [-899.024] (-897.372) (-902.255) -- 0:00:08
865000 -- (-899.141) (-901.786) [-897.353] (-898.929) * (-899.141) (-897.602) [-897.122] (-897.767) -- 0:00:08
Average standard deviation of split frequencies: 0.007875
865500 -- (-900.564) [-898.798] (-900.012) (-897.695) * (-898.317) (-897.932) [-898.155] (-899.369) -- 0:00:08
866000 -- (-898.577) (-897.684) [-904.936] (-898.238) * [-898.199] (-901.174) (-898.899) (-900.776) -- 0:00:08
866500 -- [-898.518] (-899.042) (-899.769) (-898.606) * (-899.611) (-899.595) [-897.553] (-898.365) -- 0:00:08
867000 -- (-899.087) (-898.366) [-899.023] (-898.378) * (-902.456) (-901.179) (-899.735) [-899.833] -- 0:00:08
867500 -- (-898.332) (-898.138) (-899.535) [-902.310] * (-900.940) (-897.139) (-899.087) [-897.736] -- 0:00:08
868000 -- (-897.252) (-897.548) (-900.274) [-900.722] * (-900.494) (-897.392) (-899.367) [-902.723] -- 0:00:08
868500 -- (-899.262) (-897.643) (-900.353) [-900.574] * (-899.974) (-903.317) (-899.946) [-898.317] -- 0:00:08
869000 -- (-899.343) (-901.783) [-900.146] (-900.379) * (-899.508) (-899.706) [-899.313] (-898.063) -- 0:00:08
869500 -- (-899.146) (-898.039) (-898.941) [-898.911] * (-898.923) [-897.661] (-898.841) (-900.421) -- 0:00:08
870000 -- [-898.359] (-897.830) (-901.342) (-901.056) * [-897.189] (-901.163) (-900.229) (-902.603) -- 0:00:08
Average standard deviation of split frequencies: 0.007869
870500 -- (-898.595) [-898.612] (-902.885) (-901.394) * (-898.397) (-898.193) [-904.390] (-907.202) -- 0:00:08
871000 -- (-902.826) (-898.955) (-900.717) [-898.597] * [-901.981] (-897.172) (-902.093) (-905.738) -- 0:00:08
871500 -- (-903.112) (-898.637) (-899.208) [-901.778] * (-897.373) (-898.363) (-907.028) [-900.957] -- 0:00:08
872000 -- [-898.716] (-900.705) (-898.775) (-903.866) * (-897.018) (-900.849) (-904.004) [-900.310] -- 0:00:08
872500 -- [-897.202] (-899.917) (-902.399) (-899.798) * (-898.650) [-901.535] (-897.872) (-901.679) -- 0:00:08
873000 -- (-899.188) [-900.626] (-899.052) (-897.409) * (-897.750) [-902.202] (-900.514) (-898.376) -- 0:00:08
873500 -- (-900.589) (-898.265) [-898.791] (-901.243) * (-901.187) (-900.492) [-898.030] (-897.142) -- 0:00:08
874000 -- (-899.236) [-899.627] (-898.018) (-899.319) * [-900.176] (-897.484) (-899.112) (-898.900) -- 0:00:08
874500 -- [-900.784] (-900.018) (-897.915) (-898.161) * [-900.022] (-897.323) (-901.144) (-898.812) -- 0:00:08
875000 -- (-902.604) (-900.257) (-897.406) [-898.671] * (-900.922) (-899.260) [-899.478] (-899.627) -- 0:00:08
Average standard deviation of split frequencies: 0.007570
875500 -- (-899.505) (-898.318) [-897.704] (-898.150) * (-897.875) [-897.264] (-899.756) (-898.838) -- 0:00:07
876000 -- (-898.974) (-898.572) (-897.762) [-897.425] * (-899.945) (-901.169) (-897.221) [-899.508] -- 0:00:08
876500 -- [-898.387] (-898.572) (-897.272) (-898.387) * (-901.073) [-904.005] (-898.948) (-899.518) -- 0:00:08
877000 -- (-899.710) (-898.058) [-897.277] (-898.250) * (-904.975) (-900.157) (-901.774) [-897.903] -- 0:00:07
877500 -- (-901.161) (-897.178) (-897.818) [-898.935] * (-897.316) [-899.861] (-900.305) (-901.587) -- 0:00:07
878000 -- [-900.276] (-903.570) (-898.436) (-898.663) * [-897.647] (-899.015) (-898.704) (-897.957) -- 0:00:07
878500 -- (-900.749) [-898.999] (-898.933) (-899.827) * (-902.229) (-899.858) (-899.326) [-902.841] -- 0:00:07
879000 -- [-899.603] (-900.588) (-899.249) (-898.501) * (-899.016) [-897.965] (-899.556) (-901.008) -- 0:00:07
879500 -- (-900.374) (-898.304) [-899.562] (-900.702) * (-903.843) (-904.437) [-903.016] (-897.480) -- 0:00:07
880000 -- (-901.348) (-899.066) (-900.996) [-900.547] * (-901.242) [-899.544] (-900.599) (-900.349) -- 0:00:07
Average standard deviation of split frequencies: 0.008101
880500 -- (-902.311) [-903.098] (-899.370) (-901.616) * [-900.768] (-898.751) (-898.004) (-898.791) -- 0:00:07
881000 -- (-898.160) [-901.385] (-899.240) (-898.428) * (-901.265) [-898.635] (-899.644) (-899.931) -- 0:00:07
881500 -- (-898.670) (-900.836) (-899.142) [-897.456] * [-901.574] (-901.964) (-901.233) (-899.443) -- 0:00:07
882000 -- [-900.072] (-899.711) (-899.033) (-897.884) * (-899.912) (-900.209) [-900.416] (-902.509) -- 0:00:07
882500 -- (-897.017) [-900.330] (-898.774) (-898.536) * (-901.287) (-900.479) [-898.313] (-902.001) -- 0:00:07
883000 -- (-898.598) (-899.320) [-899.076] (-897.655) * (-905.276) (-898.323) [-897.979] (-900.616) -- 0:00:07
883500 -- (-898.551) (-900.364) [-899.278] (-899.103) * (-899.541) (-901.451) [-897.572] (-899.014) -- 0:00:07
884000 -- (-898.157) (-899.082) [-900.272] (-900.575) * (-899.364) [-903.336] (-900.444) (-901.415) -- 0:00:07
884500 -- (-898.084) [-897.476] (-899.911) (-900.325) * [-898.911] (-897.636) (-898.059) (-898.194) -- 0:00:07
885000 -- (-898.592) (-898.330) (-900.208) [-897.939] * (-897.916) (-896.978) (-900.073) [-899.807] -- 0:00:07
Average standard deviation of split frequencies: 0.008442
885500 -- [-900.863] (-897.659) (-896.988) (-899.321) * [-897.855] (-898.277) (-898.096) (-898.829) -- 0:00:07
886000 -- [-903.175] (-897.167) (-897.624) (-901.025) * [-900.883] (-900.952) (-898.417) (-898.053) -- 0:00:07
886500 -- [-897.987] (-897.204) (-905.824) (-899.283) * (-899.322) (-900.866) [-898.928] (-897.311) -- 0:00:07
887000 -- (-899.332) [-897.160] (-901.770) (-899.580) * (-899.186) (-899.480) (-901.752) [-898.087] -- 0:00:07
887500 -- [-897.476] (-898.930) (-901.904) (-899.763) * (-899.718) [-898.948] (-899.283) (-898.970) -- 0:00:07
888000 -- (-897.272) (-903.008) (-899.610) [-897.925] * (-897.489) (-899.122) [-903.284] (-908.571) -- 0:00:07
888500 -- [-898.648] (-897.695) (-898.178) (-899.017) * (-898.852) [-898.751] (-905.381) (-898.332) -- 0:00:07
889000 -- [-900.699] (-903.602) (-897.714) (-898.055) * [-899.298] (-898.459) (-902.936) (-903.392) -- 0:00:07
889500 -- (-901.623) (-897.066) [-902.588] (-899.995) * (-904.336) (-897.777) (-901.700) [-899.908] -- 0:00:07
890000 -- (-897.647) (-897.991) (-898.740) [-898.507] * (-902.068) (-897.731) (-900.117) [-899.136] -- 0:00:07
Average standard deviation of split frequencies: 0.008292
890500 -- (-902.692) (-897.631) (-899.070) [-897.596] * [-902.782] (-898.882) (-902.760) (-899.393) -- 0:00:07
891000 -- (-901.312) (-898.713) (-902.383) [-897.667] * (-902.894) [-899.479] (-901.207) (-900.038) -- 0:00:07
891500 -- (-898.093) (-896.980) (-901.230) [-898.489] * (-898.774) (-898.415) [-896.873] (-900.451) -- 0:00:07
892000 -- (-899.792) (-900.815) (-898.599) [-898.292] * (-898.096) [-901.841] (-897.515) (-904.019) -- 0:00:07
892500 -- (-897.857) (-900.329) (-900.983) [-898.567] * [-901.003] (-902.265) (-900.455) (-902.538) -- 0:00:06
893000 -- [-899.132] (-899.457) (-902.225) (-898.255) * [-900.635] (-900.253) (-898.749) (-898.372) -- 0:00:06
893500 -- (-898.544) (-899.130) (-902.874) [-897.896] * [-905.999] (-899.468) (-899.458) (-898.064) -- 0:00:06
894000 -- (-898.540) [-899.741] (-898.803) (-903.436) * [-897.888] (-898.432) (-902.729) (-897.904) -- 0:00:06
894500 -- (-899.267) (-898.179) [-901.141] (-897.126) * (-899.191) (-897.899) (-903.062) [-897.812] -- 0:00:06
895000 -- (-897.111) (-897.430) (-899.160) [-897.324] * (-901.395) (-899.556) [-901.561] (-897.320) -- 0:00:06
Average standard deviation of split frequencies: 0.008523
895500 -- (-901.230) [-898.591] (-899.260) (-897.551) * (-902.968) (-900.525) (-899.212) [-899.042] -- 0:00:06
896000 -- (-904.840) [-898.666] (-898.915) (-899.894) * (-899.481) (-898.608) [-897.772] (-897.941) -- 0:00:06
896500 -- (-899.455) (-899.374) (-897.841) [-899.570] * [-901.112] (-898.782) (-897.296) (-899.615) -- 0:00:06
897000 -- (-901.017) (-899.249) (-903.558) [-898.772] * (-899.894) (-898.509) [-899.327] (-898.552) -- 0:00:06
897500 -- (-900.163) (-901.088) [-898.003] (-898.251) * (-902.289) [-900.640] (-900.572) (-906.237) -- 0:00:06
898000 -- (-900.285) (-900.920) [-902.468] (-897.594) * (-901.642) (-898.920) [-898.464] (-901.159) -- 0:00:06
898500 -- (-899.962) (-902.487) [-901.504] (-897.880) * (-898.205) (-899.606) [-900.004] (-900.129) -- 0:00:06
899000 -- (-899.406) (-899.237) (-900.205) [-898.164] * [-897.586] (-899.944) (-899.924) (-908.496) -- 0:00:06
899500 -- (-901.792) (-903.640) [-900.885] (-899.702) * (-899.253) [-898.424] (-900.899) (-904.133) -- 0:00:06
900000 -- (-898.822) (-897.063) (-899.022) [-899.312] * (-899.117) (-896.994) (-899.211) [-898.514] -- 0:00:06
Average standard deviation of split frequencies: 0.008305
900500 -- [-897.179] (-901.199) (-906.316) (-899.447) * (-901.469) [-896.994] (-897.405) (-900.163) -- 0:00:06
901000 -- [-897.834] (-897.842) (-897.991) (-899.704) * (-899.516) (-898.226) [-897.040] (-903.413) -- 0:00:06
901500 -- (-897.956) (-897.468) (-901.964) [-898.456] * [-896.843] (-899.426) (-898.438) (-902.605) -- 0:00:06
902000 -- (-898.326) [-899.667] (-898.254) (-897.386) * (-899.349) (-901.755) [-897.205] (-902.128) -- 0:00:06
902500 -- (-898.425) [-898.697] (-899.242) (-899.794) * (-900.410) (-899.298) [-897.691] (-899.106) -- 0:00:06
903000 -- (-899.796) [-900.548] (-899.051) (-899.267) * (-900.153) (-898.207) (-900.342) [-897.718] -- 0:00:06
903500 -- (-897.730) [-898.977] (-898.873) (-897.981) * (-902.149) [-898.280] (-901.851) (-898.408) -- 0:00:06
904000 -- (-902.361) (-900.015) [-899.612] (-897.841) * (-901.594) [-897.280] (-899.945) (-902.061) -- 0:00:06
904500 -- (-899.629) (-904.473) (-903.996) [-897.917] * (-897.229) [-898.576] (-899.200) (-902.852) -- 0:00:06
905000 -- (-898.972) (-900.351) (-900.611) [-899.076] * (-897.690) (-898.669) (-902.243) [-902.930] -- 0:00:06
Average standard deviation of split frequencies: 0.008221
905500 -- [-899.513] (-900.669) (-900.662) (-897.588) * (-899.326) (-898.645) (-898.860) [-897.642] -- 0:00:06
906000 -- [-899.213] (-898.722) (-900.368) (-899.331) * (-901.468) (-899.474) [-897.658] (-906.441) -- 0:00:06
906500 -- [-897.542] (-897.917) (-899.105) (-897.411) * [-899.378] (-900.205) (-898.354) (-901.870) -- 0:00:06
907000 -- [-898.904] (-898.577) (-899.280) (-898.759) * [-899.152] (-898.187) (-901.383) (-902.795) -- 0:00:06
907500 -- (-900.180) (-903.220) (-897.586) [-898.066] * (-898.457) (-898.571) [-898.172] (-899.617) -- 0:00:06
908000 -- (-901.240) (-902.381) (-900.733) [-902.842] * (-899.810) (-901.187) (-900.259) [-898.252] -- 0:00:05
908500 -- (-909.547) (-898.032) [-898.678] (-899.054) * (-898.948) (-904.282) [-904.074] (-902.435) -- 0:00:05
909000 -- (-901.754) (-900.620) (-900.764) [-898.886] * (-898.386) (-901.525) (-899.015) [-897.521] -- 0:00:05
909500 -- [-899.198] (-901.914) (-902.484) (-899.633) * [-898.656] (-899.422) (-898.664) (-898.686) -- 0:00:05
910000 -- (-898.003) (-899.780) [-898.222] (-897.890) * (-899.741) (-898.919) (-898.636) [-898.523] -- 0:00:05
Average standard deviation of split frequencies: 0.008489
910500 -- (-898.334) [-906.514] (-898.105) (-901.335) * (-897.324) (-903.184) [-897.259] (-897.515) -- 0:00:05
911000 -- [-899.437] (-899.135) (-900.589) (-897.994) * (-898.885) [-898.342] (-899.236) (-897.645) -- 0:00:05
911500 -- (-899.950) (-899.714) (-902.186) [-898.840] * (-903.008) (-898.522) (-897.196) [-898.406] -- 0:00:05
912000 -- (-899.944) (-903.353) [-900.838] (-899.403) * (-903.950) (-901.067) (-897.480) [-897.583] -- 0:00:05
912500 -- (-898.257) (-898.235) [-897.465] (-898.455) * (-899.227) (-898.673) [-897.850] (-899.154) -- 0:00:05
913000 -- (-897.995) (-898.283) [-898.481] (-897.059) * (-900.304) (-899.211) (-898.437) [-900.586] -- 0:00:05
913500 -- (-898.676) (-897.683) (-904.204) [-898.592] * (-900.219) (-898.190) [-899.570] (-899.717) -- 0:00:05
914000 -- [-898.419] (-899.498) (-901.179) (-897.778) * (-898.499) [-899.187] (-897.562) (-899.456) -- 0:00:05
914500 -- (-897.417) [-897.222] (-898.529) (-900.785) * (-904.693) (-903.012) [-898.149] (-900.375) -- 0:00:05
915000 -- [-898.505] (-903.412) (-902.333) (-900.724) * (-898.636) (-898.365) [-897.533] (-897.457) -- 0:00:05
Average standard deviation of split frequencies: 0.008200
915500 -- [-901.128] (-898.115) (-901.300) (-897.771) * (-897.783) (-897.264) (-898.965) [-898.052] -- 0:00:05
916000 -- [-898.458] (-897.544) (-900.918) (-901.553) * (-897.310) (-897.626) (-899.005) [-898.310] -- 0:00:05
916500 -- (-900.224) (-906.867) (-899.513) [-899.358] * (-899.864) (-899.133) (-899.669) [-899.376] -- 0:00:05
917000 -- (-898.866) (-899.241) [-898.764] (-899.139) * (-901.595) (-898.428) [-899.672] (-899.389) -- 0:00:05
917500 -- [-900.743] (-897.880) (-898.274) (-899.875) * (-900.118) [-897.475] (-904.233) (-898.742) -- 0:00:05
918000 -- (-898.985) (-897.878) [-897.614] (-902.913) * (-901.280) [-898.889] (-897.354) (-903.220) -- 0:00:05
918500 -- [-898.224] (-899.748) (-898.555) (-907.508) * (-898.838) [-898.355] (-897.521) (-899.569) -- 0:00:05
919000 -- (-902.076) (-899.695) [-898.261] (-898.607) * (-900.148) (-899.137) [-897.095] (-898.598) -- 0:00:05
919500 -- (-902.938) [-898.860] (-899.688) (-898.771) * (-899.233) (-901.983) (-898.382) [-897.781] -- 0:00:05
920000 -- (-902.281) [-897.990] (-898.313) (-897.952) * (-898.696) (-899.715) [-899.865] (-901.034) -- 0:00:05
Average standard deviation of split frequencies: 0.008431
920500 -- [-898.214] (-898.623) (-898.925) (-898.323) * (-900.634) (-899.459) [-898.548] (-897.982) -- 0:00:05
921000 -- (-898.435) [-897.189] (-898.569) (-897.091) * (-898.275) [-902.554] (-898.843) (-898.504) -- 0:00:05
921500 -- (-897.579) [-898.282] (-897.129) (-897.784) * (-897.939) [-903.192] (-897.950) (-900.805) -- 0:00:05
922000 -- (-897.480) [-897.443] (-897.529) (-898.218) * (-897.426) (-901.007) (-899.782) [-897.989] -- 0:00:05
922500 -- [-899.129] (-897.230) (-899.083) (-897.866) * (-898.831) (-903.741) [-898.954] (-897.605) -- 0:00:05
923000 -- (-897.890) (-898.204) (-898.362) [-899.462] * (-898.007) [-902.640] (-900.456) (-900.389) -- 0:00:05
923500 -- (-898.541) (-898.980) [-898.586] (-906.569) * (-900.171) (-904.544) [-897.476] (-900.856) -- 0:00:04
924000 -- (-906.936) (-898.342) [-899.405] (-905.060) * (-898.455) (-907.767) (-897.788) [-903.084] -- 0:00:04
924500 -- [-900.579] (-899.902) (-899.754) (-901.194) * (-899.048) [-900.089] (-897.553) (-901.524) -- 0:00:04
925000 -- (-898.389) [-897.329] (-901.387) (-903.950) * (-901.422) [-897.662] (-900.844) (-901.097) -- 0:00:04
Average standard deviation of split frequencies: 0.008281
925500 -- [-897.952] (-901.061) (-899.899) (-901.349) * (-898.804) (-900.617) (-898.336) [-899.971] -- 0:00:04
926000 -- [-901.384] (-898.985) (-899.732) (-900.839) * (-903.677) [-899.119] (-899.109) (-900.589) -- 0:00:04
926500 -- (-897.494) [-900.800] (-900.390) (-898.656) * (-898.495) (-899.923) [-900.242] (-897.543) -- 0:00:04
927000 -- (-898.088) (-898.768) [-899.572] (-899.129) * [-897.088] (-898.597) (-898.532) (-900.052) -- 0:00:04
927500 -- (-901.895) [-898.655] (-900.653) (-898.531) * (-897.569) [-899.142] (-897.387) (-898.897) -- 0:00:04
928000 -- (-899.998) [-899.529] (-900.708) (-897.859) * (-897.221) (-902.660) (-898.785) [-897.846] -- 0:00:04
928500 -- (-901.016) (-898.376) [-901.865] (-899.319) * (-902.047) (-901.658) (-897.812) [-900.301] -- 0:00:04
929000 -- (-901.924) [-898.164] (-902.103) (-899.626) * (-899.379) [-899.534] (-897.866) (-897.284) -- 0:00:04
929500 -- (-898.387) (-897.600) [-899.030] (-900.546) * [-898.244] (-898.174) (-899.238) (-898.053) -- 0:00:04
930000 -- (-899.814) (-899.280) (-899.469) [-903.133] * (-900.956) [-898.311] (-897.495) (-898.133) -- 0:00:04
Average standard deviation of split frequencies: 0.008003
930500 -- (-898.342) (-900.104) [-899.759] (-903.299) * (-899.787) (-899.633) (-899.397) [-898.036] -- 0:00:04
931000 -- [-898.634] (-901.249) (-899.186) (-899.858) * (-897.000) (-900.380) [-898.649] (-898.053) -- 0:00:04
931500 -- (-898.978) [-897.057] (-901.640) (-897.755) * [-901.534] (-898.082) (-902.509) (-898.163) -- 0:00:04
932000 -- (-903.966) [-898.896] (-902.897) (-902.835) * [-899.061] (-897.803) (-900.869) (-898.301) -- 0:00:04
932500 -- (-901.528) (-900.943) (-902.164) [-898.996] * (-901.941) (-903.461) (-901.294) [-898.356] -- 0:00:04
933000 -- [-899.824] (-899.193) (-900.098) (-898.809) * (-899.149) (-901.277) [-900.786] (-901.630) -- 0:00:04
933500 -- (-904.598) (-899.903) [-903.647] (-901.542) * [-899.196] (-904.784) (-898.245) (-902.166) -- 0:00:04
934000 -- (-905.511) [-898.042] (-899.784) (-901.218) * (-900.379) [-897.733] (-898.165) (-898.803) -- 0:00:04
934500 -- (-900.276) (-899.158) (-897.662) [-900.384] * [-898.938] (-897.986) (-899.565) (-900.492) -- 0:00:04
935000 -- (-899.106) (-897.686) [-898.529] (-898.413) * (-901.813) (-901.069) [-901.266] (-901.371) -- 0:00:04
Average standard deviation of split frequencies: 0.007790
935500 -- (-901.822) [-898.970] (-901.952) (-899.589) * (-899.866) (-898.547) (-899.650) [-899.984] -- 0:00:04
936000 -- (-899.664) (-899.707) (-898.972) [-899.283] * (-898.324) [-897.700] (-898.558) (-900.105) -- 0:00:04
936500 -- (-901.778) (-900.632) [-898.946] (-899.087) * (-897.373) [-897.724] (-899.898) (-898.942) -- 0:00:04
937000 -- (-899.561) (-900.182) (-897.827) [-898.185] * (-899.525) (-897.396) (-906.092) [-897.577] -- 0:00:04
937500 -- (-901.331) (-899.717) (-898.153) [-898.161] * (-897.705) (-897.436) [-901.958] (-898.340) -- 0:00:04
938000 -- (-898.137) (-898.212) (-898.561) [-898.754] * (-897.908) (-898.603) [-899.047] (-898.217) -- 0:00:04
938500 -- [-899.096] (-900.351) (-906.567) (-902.573) * (-901.889) (-901.979) (-899.969) [-899.363] -- 0:00:03
939000 -- (-900.082) [-904.550] (-899.807) (-900.401) * (-901.726) (-900.209) [-905.905] (-899.774) -- 0:00:03
939500 -- [-899.122] (-899.562) (-899.336) (-901.817) * (-902.412) [-898.185] (-896.922) (-899.551) -- 0:00:03
940000 -- [-898.435] (-898.776) (-899.628) (-898.340) * (-901.384) [-901.786] (-899.122) (-900.271) -- 0:00:03
Average standard deviation of split frequencies: 0.007684
940500 -- (-900.654) (-898.317) [-898.344] (-897.514) * (-900.053) (-902.538) (-899.705) [-898.748] -- 0:00:03
941000 -- [-902.497] (-897.999) (-897.898) (-898.185) * (-898.523) [-899.372] (-905.987) (-897.828) -- 0:00:03
941500 -- (-899.562) [-897.739] (-898.423) (-899.470) * [-897.640] (-898.031) (-898.102) (-897.395) -- 0:00:03
942000 -- [-898.009] (-899.039) (-899.613) (-898.203) * (-898.799) [-901.075] (-899.252) (-899.443) -- 0:00:03
942500 -- (-907.446) (-899.538) (-898.284) [-897.487] * (-898.743) (-900.485) (-900.063) [-898.179] -- 0:00:03
943000 -- [-900.943] (-900.599) (-899.643) (-897.983) * (-899.144) (-899.385) (-899.546) [-899.056] -- 0:00:03
943500 -- (-905.335) (-898.423) [-900.881] (-897.526) * (-899.018) (-898.901) (-898.203) [-899.174] -- 0:00:03
944000 -- [-899.576] (-901.833) (-901.855) (-898.123) * (-900.885) (-898.464) (-898.949) [-898.709] -- 0:00:03
944500 -- [-897.385] (-899.255) (-899.233) (-901.512) * [-899.278] (-899.541) (-898.092) (-903.318) -- 0:00:03
945000 -- (-900.534) (-901.267) (-899.144) [-903.814] * (-898.611) [-898.486] (-900.553) (-899.543) -- 0:00:03
Average standard deviation of split frequencies: 0.007641
945500 -- [-900.503] (-900.434) (-901.761) (-900.837) * (-900.516) (-897.993) [-898.596] (-898.102) -- 0:00:03
946000 -- (-904.240) [-899.450] (-898.915) (-902.427) * (-905.346) (-902.849) [-898.715] (-899.431) -- 0:00:03
946500 -- (-903.148) (-903.837) [-897.726] (-898.885) * [-899.721] (-898.103) (-897.654) (-901.074) -- 0:00:03
947000 -- (-899.190) (-897.484) [-897.922] (-898.731) * [-901.253] (-900.092) (-897.474) (-899.760) -- 0:00:03
947500 -- (-898.779) [-898.682] (-898.710) (-897.925) * [-897.906] (-899.248) (-898.709) (-903.863) -- 0:00:03
948000 -- [-898.631] (-902.827) (-900.028) (-899.755) * (-899.135) (-897.951) [-897.428] (-905.919) -- 0:00:03
948500 -- (-900.196) (-899.304) (-899.148) [-900.493] * (-899.539) (-898.640) (-897.298) [-900.642] -- 0:00:03
949000 -- [-897.836] (-900.058) (-902.013) (-897.366) * (-900.781) (-901.259) (-897.480) [-900.571] -- 0:00:03
949500 -- (-897.168) (-899.852) (-901.152) [-899.464] * (-901.073) (-902.958) [-897.569] (-900.325) -- 0:00:03
950000 -- (-900.093) (-897.804) [-899.935] (-899.882) * (-897.863) (-897.863) [-898.044] (-902.222) -- 0:00:03
Average standard deviation of split frequencies: 0.007504
950500 -- (-900.607) (-899.041) (-899.101) [-897.760] * [-898.341] (-897.620) (-897.603) (-899.813) -- 0:00:03
951000 -- (-898.927) (-897.733) [-899.374] (-902.406) * (-899.281) (-899.800) [-897.298] (-900.089) -- 0:00:03
951500 -- [-897.783] (-898.383) (-900.629) (-899.826) * (-900.972) (-898.230) [-897.009] (-898.154) -- 0:00:03
952000 -- [-897.887] (-901.289) (-899.952) (-900.799) * (-900.769) (-897.997) (-897.851) [-898.988] -- 0:00:03
952500 -- [-899.440] (-899.574) (-902.197) (-899.666) * (-901.470) (-899.578) [-898.604] (-898.374) -- 0:00:03
953000 -- [-900.282] (-901.600) (-898.014) (-900.240) * (-903.515) (-897.923) [-897.134] (-898.704) -- 0:00:03
953500 -- (-901.010) [-900.506] (-898.839) (-901.766) * (-900.027) [-897.687] (-897.428) (-898.285) -- 0:00:03
954000 -- (-897.923) (-900.521) (-901.343) [-900.398] * (-898.404) (-898.080) [-898.501] (-897.331) -- 0:00:02
954500 -- (-898.481) (-900.191) [-899.358] (-900.070) * (-899.303) [-898.677] (-900.792) (-897.362) -- 0:00:02
955000 -- [-897.063] (-899.736) (-898.830) (-897.514) * (-900.375) [-898.266] (-899.555) (-901.797) -- 0:00:02
Average standard deviation of split frequencies: 0.007495
955500 -- (-897.467) (-901.741) (-900.779) [-898.431] * (-900.539) (-901.637) [-902.227] (-899.883) -- 0:00:02
956000 -- [-898.602] (-898.615) (-898.869) (-899.998) * (-898.585) [-898.897] (-898.832) (-898.733) -- 0:00:02
956500 -- (-898.641) [-898.485] (-900.075) (-902.191) * (-902.499) (-899.426) (-898.623) [-899.079] -- 0:00:02
957000 -- (-900.129) (-898.432) [-898.205] (-900.203) * (-900.281) [-899.897] (-899.594) (-900.057) -- 0:00:02
957500 -- [-897.611] (-898.505) (-899.982) (-899.742) * (-898.732) (-898.753) (-904.523) [-900.076] -- 0:00:02
958000 -- (-899.583) (-899.172) (-899.005) [-897.075] * [-897.161] (-898.077) (-898.483) (-899.412) -- 0:00:02
958500 -- (-900.739) [-900.314] (-902.912) (-899.128) * [-899.893] (-899.473) (-899.671) (-897.712) -- 0:00:02
959000 -- [-900.378] (-898.378) (-903.407) (-898.222) * (-898.297) (-898.858) (-906.436) [-897.070] -- 0:00:02
959500 -- (-901.038) (-901.876) (-902.265) [-898.193] * (-897.907) (-898.973) (-899.334) [-900.504] -- 0:00:02
960000 -- (-900.776) [-902.059] (-898.405) (-896.829) * (-897.953) (-900.283) [-898.842] (-900.338) -- 0:00:02
Average standard deviation of split frequencies: 0.007590
960500 -- [-899.487] (-900.769) (-898.528) (-897.415) * (-900.478) [-900.075] (-899.929) (-897.324) -- 0:00:02
961000 -- (-901.706) (-897.234) [-897.845] (-898.545) * (-901.275) (-903.457) [-902.493] (-897.491) -- 0:00:02
961500 -- (-901.832) (-898.944) [-899.099] (-898.592) * (-898.486) (-903.434) [-899.846] (-900.513) -- 0:00:02
962000 -- (-902.804) [-898.969] (-899.602) (-897.766) * (-899.433) (-899.167) [-900.873] (-898.633) -- 0:00:02
962500 -- (-901.305) [-899.660] (-899.602) (-899.202) * [-900.449] (-900.261) (-898.337) (-899.017) -- 0:00:02
963000 -- (-906.209) [-898.047] (-898.328) (-899.173) * (-898.220) (-900.076) [-897.069] (-899.373) -- 0:00:02
963500 -- [-897.917] (-900.158) (-899.982) (-899.335) * [-897.425] (-897.816) (-897.509) (-900.205) -- 0:00:02
964000 -- (-900.643) (-901.304) [-897.994] (-902.071) * (-899.766) (-897.820) (-898.372) [-897.830] -- 0:00:02
964500 -- (-902.776) (-899.433) [-899.046] (-899.497) * (-901.318) (-897.122) (-896.968) [-897.373] -- 0:00:02
965000 -- [-899.342] (-904.819) (-898.191) (-900.155) * (-899.029) [-897.101] (-901.512) (-899.639) -- 0:00:02
Average standard deviation of split frequencies: 0.007320
965500 -- [-901.151] (-902.953) (-898.552) (-897.405) * [-898.410] (-897.585) (-898.302) (-905.456) -- 0:00:02
966000 -- (-899.900) [-901.797] (-897.834) (-901.184) * (-898.654) (-899.747) (-899.214) [-898.264] -- 0:00:02
966500 -- [-897.954] (-901.381) (-903.192) (-902.295) * [-898.741] (-900.553) (-899.988) (-900.187) -- 0:00:02
967000 -- (-900.930) (-901.387) (-897.431) [-899.473] * (-897.348) (-898.007) [-900.562] (-898.833) -- 0:00:02
967500 -- [-900.270] (-900.677) (-901.123) (-899.351) * [-900.446] (-897.864) (-899.885) (-901.711) -- 0:00:02
968000 -- (-900.955) (-899.659) (-899.803) [-898.114] * [-899.198] (-898.268) (-901.252) (-899.225) -- 0:00:02
968500 -- [-898.527] (-907.345) (-898.167) (-901.687) * [-900.386] (-900.132) (-900.227) (-898.942) -- 0:00:02
969000 -- (-903.192) (-900.242) [-901.549] (-901.953) * (-899.505) [-897.181] (-899.738) (-899.300) -- 0:00:02
969500 -- (-908.229) (-899.883) (-899.909) [-901.655] * (-902.016) [-897.142] (-897.731) (-898.161) -- 0:00:01
970000 -- [-900.322] (-902.783) (-898.957) (-899.626) * [-904.094] (-902.057) (-903.163) (-898.592) -- 0:00:01
Average standard deviation of split frequencies: 0.007285
970500 -- (-900.828) (-900.705) [-897.333] (-902.479) * [-901.984] (-904.798) (-900.367) (-900.323) -- 0:00:01
971000 -- (-901.263) [-899.415] (-901.207) (-901.855) * (-901.261) [-902.239] (-897.488) (-900.521) -- 0:00:01
971500 -- [-899.940] (-899.298) (-899.527) (-899.573) * (-899.040) [-898.816] (-900.494) (-897.628) -- 0:00:01
972000 -- (-901.050) (-899.173) [-898.192] (-899.289) * (-898.435) (-900.488) [-899.349] (-897.296) -- 0:00:01
972500 -- (-900.437) [-901.088] (-897.127) (-900.097) * (-901.920) (-897.985) [-899.106] (-898.866) -- 0:00:01
973000 -- (-900.052) (-903.012) (-900.103) [-900.758] * (-900.562) (-897.562) (-899.249) [-898.294] -- 0:00:01
973500 -- (-898.285) (-898.799) (-899.180) [-903.779] * [-899.795] (-898.274) (-899.275) (-901.981) -- 0:00:01
974000 -- (-899.108) (-898.544) (-899.013) [-899.544] * [-898.108] (-900.553) (-899.281) (-899.719) -- 0:00:01
974500 -- (-898.166) [-902.233] (-899.428) (-899.744) * (-898.603) [-897.989] (-900.711) (-899.683) -- 0:00:01
975000 -- (-897.729) (-898.292) (-903.736) [-898.820] * (-903.622) (-901.897) [-898.669] (-898.445) -- 0:00:01
Average standard deviation of split frequencies: 0.007245
975500 -- (-897.624) [-898.487] (-900.992) (-898.571) * (-904.789) [-898.470] (-898.528) (-899.060) -- 0:00:01
976000 -- (-897.667) (-897.702) [-898.349] (-898.546) * (-907.017) (-899.473) (-898.205) [-897.900] -- 0:00:01
976500 -- [-899.284] (-908.698) (-899.764) (-897.787) * (-899.379) (-898.264) (-898.112) [-899.039] -- 0:00:01
977000 -- (-899.270) (-898.742) (-897.778) [-897.881] * (-899.506) [-899.510] (-900.318) (-898.642) -- 0:00:01
977500 -- (-897.534) [-898.923] (-900.386) (-897.966) * [-905.312] (-898.414) (-900.769) (-897.468) -- 0:00:01
978000 -- (-900.087) [-900.685] (-900.345) (-898.419) * (-907.306) (-899.590) [-899.307] (-900.454) -- 0:00:01
978500 -- [-902.833] (-902.379) (-897.809) (-900.168) * (-903.424) (-900.820) [-901.346] (-899.546) -- 0:00:01
979000 -- (-898.821) [-899.581] (-901.177) (-898.831) * (-897.632) [-900.139] (-901.625) (-898.331) -- 0:00:01
979500 -- (-902.859) (-899.005) (-897.832) [-899.395] * (-901.159) (-901.885) [-898.990] (-900.532) -- 0:00:01
980000 -- (-902.266) [-901.914] (-900.190) (-905.028) * (-898.728) (-897.466) [-903.406] (-900.405) -- 0:00:01
Average standard deviation of split frequencies: 0.007178
980500 -- [-901.876] (-901.472) (-897.130) (-898.392) * [-899.145] (-898.998) (-897.844) (-900.056) -- 0:00:01
981000 -- [-902.482] (-898.208) (-897.669) (-898.146) * [-900.777] (-897.836) (-899.431) (-901.201) -- 0:00:01
981500 -- (-899.736) (-901.007) (-899.035) [-898.072] * (-900.812) (-897.243) (-898.511) [-897.802] -- 0:00:01
982000 -- (-898.502) [-899.122] (-900.141) (-897.824) * [-902.237] (-897.788) (-904.754) (-898.324) -- 0:00:01
982500 -- [-897.176] (-904.649) (-901.004) (-899.346) * (-901.933) (-897.744) (-899.283) [-897.895] -- 0:00:01
983000 -- (-899.511) (-902.113) (-899.749) [-897.335] * (-898.380) (-900.620) [-900.159] (-900.444) -- 0:00:01
983500 -- [-899.989] (-902.361) (-903.194) (-898.094) * (-899.792) (-899.248) [-897.645] (-898.230) -- 0:00:01
984000 -- (-898.145) [-898.114] (-897.885) (-898.975) * (-899.526) [-901.226] (-897.872) (-900.667) -- 0:00:01
984500 -- (-897.723) (-898.517) (-899.698) [-898.254] * (-898.415) (-901.009) [-897.279] (-899.192) -- 0:00:01
985000 -- (-897.200) (-897.652) (-900.275) [-899.081] * [-897.909] (-900.160) (-897.950) (-899.655) -- 0:00:00
Average standard deviation of split frequencies: 0.007331
985500 -- (-896.945) (-897.579) [-898.017] (-900.120) * (-906.647) (-899.170) [-900.428] (-898.980) -- 0:00:00
986000 -- (-896.975) [-900.848] (-904.421) (-899.234) * (-900.201) [-901.068] (-899.718) (-899.652) -- 0:00:00
986500 -- (-898.035) (-903.740) (-901.526) [-898.569] * [-898.769] (-901.639) (-905.799) (-899.449) -- 0:00:00
987000 -- [-897.626] (-904.270) (-903.388) (-902.081) * (-901.229) (-898.760) [-903.753] (-900.045) -- 0:00:00
987500 -- (-897.641) (-903.106) [-897.724] (-902.770) * (-897.451) (-901.105) [-897.426] (-897.978) -- 0:00:00
988000 -- (-899.354) (-900.438) (-897.183) [-901.287] * (-897.951) (-901.914) [-901.805] (-899.413) -- 0:00:00
988500 -- (-898.283) (-903.891) [-897.589] (-899.224) * [-899.473] (-900.741) (-900.950) (-897.398) -- 0:00:00
989000 -- (-898.433) (-897.124) (-897.582) [-899.196] * (-897.636) (-900.066) (-902.138) [-898.525] -- 0:00:00
989500 -- (-900.989) [-897.472] (-900.874) (-897.829) * (-902.466) (-899.499) (-899.362) [-897.443] -- 0:00:00
990000 -- (-899.612) (-900.531) [-901.807] (-898.025) * (-897.658) [-898.822] (-899.810) (-899.454) -- 0:00:00
Average standard deviation of split frequencies: 0.007169
990500 -- (-900.857) [-897.446] (-901.268) (-898.287) * (-898.831) (-899.655) (-897.730) [-898.389] -- 0:00:00
991000 -- (-900.274) (-897.368) (-902.353) [-898.884] * [-901.345] (-901.890) (-900.208) (-897.853) -- 0:00:00
991500 -- [-900.358] (-904.285) (-905.489) (-898.698) * (-899.631) (-898.133) [-898.575] (-898.715) -- 0:00:00
992000 -- (-897.989) (-900.630) [-900.821] (-901.078) * (-900.491) (-901.454) [-900.244] (-898.360) -- 0:00:00
992500 -- (-898.632) (-900.591) (-899.963) [-900.156] * [-900.071] (-897.123) (-901.881) (-898.029) -- 0:00:00
993000 -- (-899.507) [-900.522] (-897.872) (-900.002) * (-898.966) [-898.625] (-900.474) (-898.924) -- 0:00:00
993500 -- (-899.355) (-899.335) [-898.852] (-899.266) * (-900.188) (-902.147) [-898.462] (-898.018) -- 0:00:00
994000 -- (-900.230) (-899.519) [-899.593] (-902.072) * [-899.100] (-900.186) (-897.772) (-901.173) -- 0:00:00
994500 -- (-899.418) [-902.349] (-903.283) (-901.373) * (-899.879) (-898.001) [-902.584] (-901.185) -- 0:00:00
995000 -- [-899.567] (-897.768) (-897.495) (-900.041) * (-899.143) (-897.516) (-903.059) [-898.254] -- 0:00:00
Average standard deviation of split frequencies: 0.006879
995500 -- (-899.475) (-899.498) [-897.885] (-902.453) * [-900.283] (-897.229) (-901.249) (-900.772) -- 0:00:00
996000 -- (-902.850) (-899.572) [-898.156] (-903.633) * [-901.274] (-898.830) (-897.149) (-901.506) -- 0:00:00
996500 -- [-898.346] (-899.900) (-900.318) (-898.828) * (-898.386) (-899.272) [-897.169] (-900.745) -- 0:00:00
997000 -- (-899.969) (-905.862) (-900.508) [-900.670] * (-897.894) (-898.214) [-899.130] (-899.888) -- 0:00:00
997500 -- (-898.851) [-900.675] (-900.435) (-899.159) * (-903.739) [-897.857] (-902.863) (-900.969) -- 0:00:00
998000 -- (-900.739) (-897.843) [-897.863] (-903.278) * (-900.449) (-898.522) (-899.352) [-898.641] -- 0:00:00
998500 -- (-898.684) [-898.764] (-898.268) (-900.038) * [-898.641] (-898.952) (-901.017) (-898.636) -- 0:00:00
999000 -- (-898.412) [-905.343] (-905.719) (-900.133) * (-903.255) [-897.309] (-898.105) (-899.934) -- 0:00:00
999500 -- (-898.812) (-897.006) (-903.690) [-904.161] * (-898.264) [-897.551] (-903.570) (-903.390) -- 0:00:00
1000000 -- (-897.749) (-898.328) [-898.567] (-899.804) * [-903.636] (-898.184) (-900.314) (-900.224) -- 0:00:00
Average standard deviation of split frequencies: 0.006941
Analysis completed in 1 mins 5 seconds
Analysis used 63.70 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -896.77
Likelihood of best state for "cold" chain of run 2 was -896.77
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.6 % ( 68 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
28.1 % ( 28 %) Dirichlet(Pi{all})
30.4 % ( 27 %) Slider(Pi{all})
79.0 % ( 51 %) Multiplier(Alpha{1,2})
77.4 % ( 48 %) Multiplier(Alpha{3})
21.3 % ( 32 %) Slider(Pinvar{all})
98.7 % (100 %) ExtSPR(Tau{all},V{all})
70.0 % ( 65 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 82 %) ParsSPR(Tau{all},V{all})
28.2 % ( 26 %) Multiplier(V{all})
97.4 % (100 %) Nodeslider(V{all})
30.9 % ( 32 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.6 % ( 75 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
28.6 % ( 23 %) Dirichlet(Pi{all})
30.5 % ( 26 %) Slider(Pi{all})
78.6 % ( 42 %) Multiplier(Alpha{1,2})
77.9 % ( 44 %) Multiplier(Alpha{3})
21.8 % ( 30 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 77 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 88 %) ParsSPR(Tau{all},V{all})
28.3 % ( 33 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.6 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166729 0.82 0.67
3 | 165514 166689 0.84
4 | 166863 167215 166990
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.63 0.50
2 | 166795 0.82 0.67
3 | 167343 166721 0.84
4 | 166728 166091 166322
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -898.39
| 2 |
|2 1 |
| 1 1 1 |
| 1 1 1 1 1 1 1 1 |
| 2 2 1 1 * 1 22 1 2 * |
| 22 1 2 1 122 * 1 2 |
| 2 * 121 1 2 1 2 2 1 2|
|1 11 22 1 1 2 2 2 1 12 1 2 1 12 1 |
| 2 2 1 11 211 2 2 1 * 1* |
| 21 1 2 2 22 1 |
| 22 1 2 11 212 2 1 1|
| 2 22 2 2 2 2 |
| 2 2 2 |
| 2 |
| 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -900.32
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -898.46 -901.82
2 -898.52 -904.67
--------------------------------------
TOTAL -898.49 -904.04
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893153 0.092773 0.344270 1.495126 0.860419 1325.41 1413.20 1.000
r(A<->C){all} 0.168024 0.020461 0.000120 0.454267 0.128141 210.06 241.85 1.002
r(A<->G){all} 0.160458 0.018576 0.000046 0.431137 0.124720 222.50 252.07 1.004
r(A<->T){all} 0.170328 0.020066 0.000057 0.441223 0.135058 190.82 193.00 1.000
r(C<->G){all} 0.163176 0.019673 0.000021 0.449285 0.127114 175.82 208.39 1.000
r(C<->T){all} 0.170122 0.019850 0.000017 0.457311 0.134358 311.95 346.32 1.002
r(G<->T){all} 0.167892 0.019637 0.000002 0.444960 0.132083 175.79 208.16 1.003
pi(A){all} 0.198099 0.000249 0.166921 0.229249 0.198015 998.96 1141.58 1.000
pi(C){all} 0.325817 0.000337 0.291298 0.362966 0.325626 1085.77 1174.25 1.000
pi(G){all} 0.270779 0.000301 0.238609 0.306377 0.270298 1258.75 1379.88 1.000
pi(T){all} 0.205305 0.000249 0.174513 0.235169 0.205056 1193.40 1302.86 1.000
alpha{1,2} 0.431451 0.254073 0.000212 1.447037 0.251592 1013.83 1171.88 1.000
alpha{3} 0.478884 0.252378 0.000524 1.462121 0.316489 1198.92 1239.20 1.000
pinvar{all} 0.997585 0.000008 0.991730 0.999999 0.998533 1140.02 1213.22 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.***
8 -- ..*..*
9 -- ...**.
10 -- .**...
11 -- ...*.*
12 -- .*...*
13 -- ....**
14 -- .***.*
15 -- .**.**
16 -- ..****
17 -- .*..*.
18 -- ..*.*.
19 -- .*.*..
20 -- .****.
21 -- ..**..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 462 0.153897 0.003769 0.151233 0.156562 2
8 452 0.150566 0.015075 0.139907 0.161226 2
9 442 0.147235 0.011306 0.139241 0.155230 2
10 441 0.146902 0.007066 0.141905 0.151899 2
11 439 0.146236 0.022141 0.130580 0.161892 2
12 438 0.145903 0.001884 0.144570 0.147235 2
13 436 0.145237 0.010364 0.137908 0.152565 2
14 433 0.144237 0.000471 0.143904 0.144570 2
15 426 0.141905 0.002827 0.139907 0.143904 2
16 424 0.141239 0.000942 0.140573 0.141905 2
17 415 0.138241 0.007066 0.133245 0.143238 2
18 415 0.138241 0.008009 0.132578 0.143904 2
19 405 0.134910 0.007066 0.129913 0.139907 2
20 400 0.133245 0.005653 0.129247 0.137242 2
21 381 0.126915 0.000471 0.126582 0.127249 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099484 0.009986 0.000025 0.306337 0.067225 1.000 2
length{all}[2] 0.096910 0.010062 0.000002 0.293866 0.066080 1.000 2
length{all}[3] 0.098934 0.010348 0.000006 0.293782 0.065598 1.000 2
length{all}[4] 0.100583 0.009574 0.000007 0.299254 0.071045 1.000 2
length{all}[5] 0.101311 0.010315 0.000008 0.305434 0.070889 1.000 2
length{all}[6] 0.096348 0.009039 0.000100 0.293134 0.068600 1.000 2
length{all}[7] 0.098835 0.007522 0.000058 0.261924 0.076075 1.009 2
length{all}[8] 0.103778 0.011830 0.000319 0.323799 0.070053 1.004 2
length{all}[9] 0.106659 0.013453 0.000067 0.338961 0.069392 0.999 2
length{all}[10] 0.100550 0.009948 0.000417 0.316080 0.070175 0.999 2
length{all}[11] 0.095365 0.011748 0.000167 0.277343 0.060991 1.001 2
length{all}[12] 0.102096 0.008779 0.000293 0.284225 0.074931 1.003 2
length{all}[13] 0.097768 0.010523 0.000151 0.280134 0.059570 0.998 2
length{all}[14] 0.104406 0.009368 0.000132 0.282788 0.076527 0.998 2
length{all}[15] 0.102587 0.011431 0.000386 0.295339 0.072907 1.008 2
length{all}[16] 0.099300 0.009945 0.000155 0.286245 0.070384 0.998 2
length{all}[17] 0.098540 0.008922 0.000506 0.281979 0.070865 0.998 2
length{all}[18] 0.104413 0.010113 0.000105 0.278694 0.080844 1.002 2
length{all}[19] 0.097216 0.008416 0.000300 0.260949 0.071651 0.999 2
length{all}[20] 0.099870 0.010294 0.000568 0.283542 0.072054 1.003 2
length{all}[21] 0.103587 0.012388 0.000002 0.329376 0.072261 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006941
Maximum standard deviation of split frequencies = 0.022141
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.009
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/-------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\---------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 657
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 53 patterns at 219 / 219 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 53 patterns at 219 / 219 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
51728 bytes for conP
4664 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.029002 0.066536 0.101932 0.062269 0.061539 0.071547 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -943.751029
Iterating by ming2
Initial: fx= 943.751029
x= 0.02900 0.06654 0.10193 0.06227 0.06154 0.07155 0.30000 1.30000
1 h-m-p 0.0000 0.0001 529.1350 ++ 906.326656 m 0.0001 13 | 1/8
2 h-m-p 0.0012 0.0254 52.3467 -----------.. | 1/8
3 h-m-p 0.0000 0.0002 485.0556 ++ 870.804096 m 0.0002 44 | 2/8
4 h-m-p 0.0014 0.0289 45.9981 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 436.3448 ++ 870.161397 m 0.0000 75 | 3/8
6 h-m-p 0.0001 0.0350 39.5952 ---------.. | 3/8
7 h-m-p 0.0000 0.0000 377.6142 ++ 867.342695 m 0.0000 104 | 4/8
8 h-m-p 0.0002 0.0469 29.4678 ----------.. | 4/8
9 h-m-p 0.0000 0.0000 308.1721 ++ 865.135775 m 0.0000 134 | 5/8
10 h-m-p 0.0003 0.0709 19.4224 ----------.. | 5/8
11 h-m-p 0.0000 0.0001 217.4778 ++ 858.415304 m 0.0001 164 | 6/8
12 h-m-p 0.8093 8.0000 0.0000 ++ 858.415304 m 8.0000 175 | 6/8
13 h-m-p 0.2181 8.0000 0.0004 +++ 858.415304 m 8.0000 189 | 6/8
14 h-m-p 0.0160 8.0000 0.7355 ++++C 858.415299 0 4.0297 206 | 6/8
15 h-m-p 1.6000 8.0000 0.1708 +Y 858.415299 0 4.6897 220 | 6/8
16 h-m-p 1.6000 8.0000 0.0707 Y 858.415299 0 0.7098 233 | 6/8
17 h-m-p 1.6000 8.0000 0.0041 Y 858.415299 0 0.1789 246 | 6/8
18 h-m-p 1.6000 8.0000 0.0003 ----------------.. | 6/8
19 h-m-p 0.0160 8.0000 0.0000 +++++ 858.415299 m 8.0000 289 | 6/8
20 h-m-p 0.0087 4.3717 0.4684 +++++ 858.415053 m 4.3717 305 | 7/8
21 h-m-p 1.6000 8.0000 0.2891 ++ 858.415024 m 8.0000 318 | 7/8
22 h-m-p 0.7828 8.0000 2.9543 -------------C 858.415024 0 0.0000 343 | 7/8
23 h-m-p 0.1072 8.0000 0.0000 --C 858.415024 0 0.0017 356 | 7/8
24 h-m-p 0.1203 8.0000 0.0000 Y 858.415024 0 0.0301 368
Out..
lnL = -858.415024
369 lfun, 369 eigenQcodon, 2214 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.024163 0.041654 0.011180 0.020271 0.020613 0.038662 0.629271 0.608152 0.559020
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 7.922845
np = 9
lnL0 = -892.150375
Iterating by ming2
Initial: fx= 892.150375
x= 0.02416 0.04165 0.01118 0.02027 0.02061 0.03866 0.62927 0.60815 0.55902
1 h-m-p 0.0000 0.0001 524.9454 ++ 877.779888 m 0.0001 14 | 1/9
2 h-m-p 0.0001 0.0006 137.3711 ++ 867.983222 m 0.0006 26 | 2/9
3 h-m-p 0.0000 0.0000 702.2311 ++ 867.706484 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0000 710.7078 ++ 865.267429 m 0.0000 50 | 4/9
5 h-m-p 0.0000 0.0001 1198.4412 ++ 858.991651 m 0.0001 62 | 5/9
6 h-m-p 0.0000 0.0000 2956.6522 ++ 858.415244 m 0.0000 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 858.415244 m 8.0000 86 | 6/9
8 h-m-p 0.0014 0.6905 0.9412 --------C 858.415244 0 0.0000 109 | 6/9
9 h-m-p 0.0160 8.0000 0.0003 +++++ 858.415244 m 8.0000 127 | 6/9
10 h-m-p 0.0008 0.3103 2.8769 ---------C 858.415244 0 0.0000 151 | 6/9
11 h-m-p 0.0160 8.0000 0.0001 +++++ 858.415244 m 8.0000 166 | 6/9
12 h-m-p 0.0007 0.3305 1.9319 +++++ 858.415241 m 0.3305 184 | 6/9
13 h-m-p 0.1497 1.3715 4.2660 ---------------.. | 6/9
14 h-m-p 0.0160 8.0000 0.0002 +++++ 858.415241 m 8.0000 224 | 6/9
15 h-m-p 0.0006 0.0031 0.4664 --------Y 858.415241 0 0.0000 247 | 6/9
16 h-m-p 0.0016 0.8131 0.0004 +++++ 858.415240 m 0.8131 265 | 6/9
17 h-m-p 0.0065 3.2736 0.3086 ---------Y 858.415240 0 0.0000 289 | 6/9
18 h-m-p 0.0160 8.0000 0.0005 +++++ 858.415240 m 8.0000 307 | 6/9
19 h-m-p 0.0011 0.0055 0.6965 ---------Y 858.415240 0 0.0000 331 | 6/9
20 h-m-p 0.0160 8.0000 0.0078 -----------C 858.415240 0 0.0000 357 | 6/9
21 h-m-p 0.0070 3.5053 0.0006 +++++ 858.415240 m 3.5053 375 | 6/9
22 h-m-p 0.0036 1.1686 0.6263 ---------Y 858.415240 0 0.0000 399 | 6/9
23 h-m-p 0.0160 8.0000 0.0000 ------Y 858.415240 0 0.0000 420 | 6/9
24 h-m-p 0.0160 8.0000 0.0000 +++++ 858.415240 m 8.0000 438 | 6/9
25 h-m-p 0.0001 0.0003 0.4979 -----C 858.415240 0 0.0000 458 | 6/9
26 h-m-p 0.0009 0.4452 0.0003 --------N 858.415240 0 0.0000 481 | 6/9
27 h-m-p 0.0160 8.0000 0.0000 +++++ 858.415240 m 8.0000 499 | 6/9
28 h-m-p 0.0002 0.0320 0.5268 -------Y 858.415240 0 0.0000 521 | 6/9
29 h-m-p 0.0160 8.0000 0.0000 ---N 858.415240 0 0.0001 539 | 6/9
30 h-m-p 0.0160 8.0000 0.0113 +++++ 858.415228 m 8.0000 557 | 6/9
31 h-m-p 0.0746 0.3728 0.6006 ------------C 858.415228 0 0.0000 584 | 6/9
32 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/9
33 h-m-p 0.0160 8.0000 0.0002 +++++ 858.415227 m 8.0000 628 | 6/9
34 h-m-p 0.0018 0.0089 0.2638 ----------Y 858.415227 0 0.0000 653 | 6/9
35 h-m-p 0.0021 1.0570 0.0003 +++++ 858.415227 m 1.0570 671 | 6/9
36 h-m-p 0.0076 3.7783 0.3006 -------------.. | 6/9
37 h-m-p 0.0160 8.0000 0.0002 +++++ 858.415227 m 8.0000 715 | 6/9
38 h-m-p 0.0014 0.0070 0.2643 -----------.. | 6/9
39 h-m-p 0.0160 8.0000 0.0002 +++++ 858.415226 m 8.0000 757 | 6/9
40 h-m-p 0.0028 0.0142 0.2629 ----------Y 858.415226 0 0.0000 782 | 6/9
41 h-m-p 0.0160 8.0000 0.0310 +++++ 858.415120 m 8.0000 800 | 6/9
42 h-m-p 0.1411 0.7057 0.3536 ------------Y 858.415120 0 0.0000 827 | 6/9
43 h-m-p 0.0160 8.0000 0.0034 +++++ 858.415102 m 8.0000 845 | 6/9
44 h-m-p 0.1299 3.9717 0.2115 ------------Y 858.415102 0 0.0000 872 | 6/9
45 h-m-p 0.0160 8.0000 0.0001 -----Y 858.415102 0 0.0000 892 | 6/9
46 h-m-p 0.0055 2.7615 0.1387 -----------C 858.415102 0 0.0000 918 | 6/9
47 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/9
48 h-m-p 0.0160 8.0000 0.0009 +++++ 858.415095 m 8.0000 962 | 6/9
49 h-m-p 0.0533 8.0000 0.1382 ------------Y 858.415095 0 0.0000 989 | 6/9
50 h-m-p 0.0160 8.0000 0.0008 +++++ 858.415092 m 8.0000 1007 | 6/9
51 h-m-p 0.0195 0.2592 0.3188 -------------.. | 6/9
52 h-m-p 0.0160 8.0000 0.0010 +++++ 858.415084 m 8.0000 1051 | 6/9
53 h-m-p 0.0598 8.0000 0.1333 ------------Y 858.415084 0 0.0000 1078 | 6/9
54 h-m-p 0.0029 1.4374 0.0050 +++++ 858.415077 m 1.4374 1096 | 7/9
55 h-m-p 0.0491 0.8578 0.1004 ------------Y 858.415077 0 0.0000 1123 | 7/9
56 h-m-p 0.0160 8.0000 0.0000 +++++ 858.415077 m 8.0000 1140 | 7/9
57 h-m-p 0.0003 0.1409 0.4184 ----------.. | 7/9
58 h-m-p 0.0160 8.0000 0.0008 +++++ 858.415071 m 8.0000 1179 | 7/9
59 h-m-p 0.0349 4.9822 0.1875 --------------.. | 7/9
60 h-m-p 0.0160 8.0000 0.0008 +++++ 858.415065 m 8.0000 1222 | 7/9
61 h-m-p 0.0368 5.1066 0.1843 -------------Y 858.415065 0 0.0000 1249 | 7/9
62 h-m-p 0.0025 1.2607 0.0477 +++++ 858.415002 m 1.2607 1266 | 8/9
63 h-m-p 0.5039 8.0000 0.0195 ----------C 858.415002 0 0.0000 1290 | 8/9
64 h-m-p 0.0160 8.0000 0.0000 +++++ 858.415002 m 8.0000 1306 | 8/9
65 h-m-p 0.0160 8.0000 7.5240 -------------.. | 8/9
66 h-m-p 0.0160 8.0000 0.0001 +++++ 858.415002 m 8.0000 1345 | 8/9
67 h-m-p 0.0160 8.0000 0.2598 ---------C 858.415002 0 0.0000 1367 | 8/9
68 h-m-p 0.0160 8.0000 0.0001 +++++ 858.415002 m 8.0000 1383 | 8/9
69 h-m-p 0.0160 8.0000 0.7349 -----------N 858.415002 0 0.0000 1407 | 8/9
70 h-m-p 0.0160 8.0000 0.0000 +++++ 858.415002 m 8.0000 1423 | 8/9
71 h-m-p 0.0160 8.0000 0.6276 ------------Y 858.415002 0 0.0000 1448 | 8/9
72 h-m-p 0.0160 8.0000 0.0000 -C 858.415002 0 0.0010 1462 | 8/9
73 h-m-p 0.0160 8.0000 0.0000 +++++ 858.415002 m 8.0000 1478 | 8/9
74 h-m-p 0.0001 0.0306 1.2429 +++++ 858.415000 m 0.0306 1494 | 9/9
75 h-m-p 0.0160 8.0000 0.0000 N 858.415000 0 0.0160 1506 | 9/9
76 h-m-p 0.0160 8.0000 0.0000 N 858.415000 0 0.0160 1518
Out..
lnL = -858.415000
1519 lfun, 4557 eigenQcodon, 18228 P(t)
Time used: 0:06
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.018743 0.105150 0.040445 0.040542 0.033447 0.061538 0.000100 0.916613 0.273552 0.140762 2.018728
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.305692
np = 11
lnL0 = -917.678322
Iterating by ming2
Initial: fx= 917.678322
x= 0.01874 0.10515 0.04045 0.04054 0.03345 0.06154 0.00011 0.91661 0.27355 0.14076 2.01873
1 h-m-p 0.0000 0.0000 442.8978 ++ 916.921556 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0010 157.1888 ++++ 895.799062 m 0.0010 32 | 2/11
3 h-m-p 0.0002 0.0012 172.1959 ++ 872.779213 m 0.0012 46 | 3/11
4 h-m-p 0.0000 0.0002 677.6182 ++ 870.976307 m 0.0002 60 | 4/11
5 h-m-p 0.0000 0.0001 4269.7110 ++ 867.632408 m 0.0001 74 | 5/11
6 h-m-p 0.0000 0.0000 603192.9260 ++ 867.617503 m 0.0000 88 | 6/11
7 h-m-p 0.0000 0.0001 5326.7918 ++ 866.140379 m 0.0001 102 | 7/11
8 h-m-p 0.0001 0.0006 1766.3948 ++ 858.415268 m 0.0006 116 | 8/11
9 h-m-p 1.6000 8.0000 0.0001 ++ 858.415268 m 8.0000 130 | 8/11
10 h-m-p 0.0160 8.0000 0.1181 +++++ 858.415235 m 8.0000 150 | 8/11
11 h-m-p 0.1881 8.0000 5.0253 -------------Y 858.415235 0 0.0000 180 | 8/11
12 h-m-p 0.0160 8.0000 0.0004 ------N 858.415235 0 0.0000 200 | 8/11
13 h-m-p 0.0160 8.0000 0.0029 +++++ 858.415233 m 8.0000 220 | 8/11
14 h-m-p 0.0160 8.0000 1.6443 ----------Y 858.415233 0 0.0000 247 | 8/11
15 h-m-p 0.0160 8.0000 0.0020 +++++ 858.415232 m 8.0000 264 | 8/11
16 h-m-p 0.0160 8.0000 1.9888 -------------.. | 8/11
17 h-m-p 0.0160 8.0000 0.0001 +++++ 858.415232 m 8.0000 309 | 8/11
18 h-m-p 0.0022 0.0413 0.2516 +++ 858.415232 m 0.0413 327 | 9/11
19 h-m-p 0.0160 8.0000 1.2948 ------------Y 858.415232 0 0.0000 356 | 9/11
20 h-m-p 0.0160 8.0000 0.0002 +++++ 858.415232 m 8.0000 373 | 9/11
21 h-m-p 0.0160 8.0000 2.5125 -----------Y 858.415232 0 0.0000 400 | 9/11
22 h-m-p 0.0160 8.0000 0.0000 +++++ 858.415232 m 8.0000 417 | 8/11
23 h-m-p 0.0160 8.0000 0.0007 +++++ 858.415231 m 8.0000 436 | 8/11
24 h-m-p 0.0160 8.0000 12.6729 +++YY 858.415038 1 1.0240 457 | 8/11
25 h-m-p 1.6000 8.0000 0.2264 ++ 858.415037 m 8.0000 471 | 8/11
26 h-m-p 1.6000 8.0000 0.5578 Y 858.415037 0 0.7068 488 | 8/11
27 h-m-p 1.6000 8.0000 0.0185 C 858.415037 0 2.3746 505 | 8/11
28 h-m-p 1.6000 8.0000 0.0001 ++ 858.415037 m 8.0000 522 | 8/11
29 h-m-p 0.0160 8.0000 4.1658 -------------.. | 8/11
30 h-m-p 0.0160 8.0000 0.0000 +++++ 858.415037 m 8.0000 567 | 8/11
31 h-m-p 0.0247 8.0000 0.0060 +++++ 858.415036 m 8.0000 587 | 8/11
32 h-m-p 0.0360 8.0000 1.3370 ----------C 858.415036 0 0.0000 614 | 8/11
33 h-m-p 0.0160 8.0000 0.0000 ----Y 858.415036 0 0.0000 632 | 8/11
34 h-m-p 0.0160 8.0000 0.0000 -----C 858.415036 0 0.0000 654
Out..
lnL = -858.415036
655 lfun, 2620 eigenQcodon, 11790 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -858.452579 S = -858.415724 -0.014193
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:09
did 20 / 53 patterns 0:09
did 30 / 53 patterns 0:09
did 40 / 53 patterns 0:09
did 50 / 53 patterns 0:09
did 53 / 53 patterns 0:09
Time used: 0:09
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.064949 0.065170 0.062790 0.072676 0.061398 0.092166 0.978556 0.470877 1.202239
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 11.955458
np = 9
lnL0 = -943.116163
Iterating by ming2
Initial: fx= 943.116163
x= 0.06495 0.06517 0.06279 0.07268 0.06140 0.09217 0.97856 0.47088 1.20224
1 h-m-p 0.0000 0.0003 469.2056 +++ 869.342098 m 0.0003 15 | 1/9
2 h-m-p 0.0001 0.0007 53.3709 ++ 867.904565 m 0.0007 27 | 2/9
3 h-m-p 0.0000 0.0000 21401.0242 ++ 866.267414 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 14778.0226 ++ 866.146986 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0000 5788.6625 ++ 863.352758 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0001 2036.0172 ++ 858.415128 m 0.0001 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0002 ++ 858.415128 m 8.0000 87 | 6/9
8 h-m-p 0.0160 8.0000 0.1934 -------------.. | 6/9
9 h-m-p 0.0160 8.0000 0.0003 +++++ 858.415127 m 8.0000 131 | 6/9
10 h-m-p 0.0160 8.0000 0.2552 -----------C 858.415127 0 0.0000 157 | 6/9
11 h-m-p 0.0160 8.0000 0.0003 +++++ 858.415127 m 8.0000 175 | 6/9
12 h-m-p 0.0160 8.0000 0.2790 -------------.. | 6/9
13 h-m-p 0.0160 8.0000 0.0003 +++++ 858.415126 m 8.0000 219 | 6/9
14 h-m-p 0.0160 8.0000 0.2520 ----------Y 858.415126 0 0.0000 244 | 6/9
15 h-m-p 0.0160 8.0000 0.0001 -----Y 858.415126 0 0.0000 264 | 6/9
16 h-m-p 0.0160 8.0000 0.0010 +++++ 858.415124 m 8.0000 282 | 6/9
17 h-m-p 0.0296 7.8273 0.2689 ------------Y 858.415124 0 0.0000 309 | 6/9
18 h-m-p 0.0160 8.0000 0.0002 +++++ 858.415123 m 8.0000 327 | 6/9
19 h-m-p 0.0160 8.0000 0.2932 -------------.. | 6/9
20 h-m-p 0.0160 8.0000 0.0003 +++++ 858.415122 m 8.0000 371 | 6/9
21 h-m-p 0.0160 8.0000 0.2439 -----------C 858.415122 0 0.0000 397 | 6/9
22 h-m-p 0.0160 8.0000 0.0005 +++++ 858.415121 m 8.0000 415 | 6/9
23 h-m-p 0.0079 2.8211 0.5356 ----------C 858.415121 0 0.0000 440 | 6/9
24 h-m-p 0.0160 8.0000 0.0133 +++++ 858.415093 m 8.0000 458 | 6/9
25 h-m-p 0.2016 3.1689 0.5287 ---------------.. | 6/9
26 h-m-p 0.0160 8.0000 0.0004 +++++ 858.415091 m 8.0000 504 | 6/9
27 h-m-p 0.0177 8.0000 0.1987 ------------Y 858.415091 0 0.0000 531 | 6/9
28 h-m-p 0.0052 2.5896 0.0424 +++++ 858.415031 m 2.5896 549 | 7/9
29 h-m-p 1.6000 8.0000 0.0016 ++ 858.415031 m 8.0000 564 | 7/9
30 h-m-p 0.0160 8.0000 6.8763 ----------N 858.415031 0 0.0000 588 | 7/9
31 h-m-p 0.0201 8.0000 0.0000 -Y 858.415031 0 0.0013 601 | 7/9
32 h-m-p 0.0160 8.0000 0.0000 ---C 858.415031 0 0.0001 618
Out..
lnL = -858.415031
619 lfun, 6809 eigenQcodon, 37140 P(t)
Time used: 0:19
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.052714 0.040782 0.101547 0.086234 0.095461 0.045762 0.937296 0.900000 0.962413 1.130320 2.073045
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 7.851872
np = 11
lnL0 = -942.641759
Iterating by ming2
Initial: fx= 942.641759
x= 0.05271 0.04078 0.10155 0.08623 0.09546 0.04576 0.93730 0.90000 0.96241 1.13032 2.07304
1 h-m-p 0.0000 0.0002 454.9479 +++ 895.691652 m 0.0002 17 | 1/11
2 h-m-p 0.0000 0.0001 255.0168 ++ 890.479977 m 0.0001 31 | 2/11
3 h-m-p 0.0000 0.0000 1668.4744 ++ 884.787825 m 0.0000 45 | 3/11
4 h-m-p 0.0001 0.0005 429.2418 ++ 863.485080 m 0.0005 59 | 4/11
5 h-m-p 0.0004 0.0022 135.8115 ++ 859.696863 m 0.0022 73 | 5/11
6 h-m-p 0.0000 0.0002 928.9006 ++ 858.415283 m 0.0002 87 | 6/11
7 h-m-p 1.6000 8.0000 0.0011 ++ 858.415283 m 8.0000 101 | 6/11
8 h-m-p 0.0139 1.1631 0.6262 -----------C 858.415283 0 0.0000 131 | 6/11
9 h-m-p 0.0160 8.0000 0.0002 +++++ 858.415283 m 8.0000 153 | 6/11
10 h-m-p 0.0031 1.3103 0.6182 ---------Y 858.415283 0 0.0000 181 | 6/11
11 h-m-p 0.0160 8.0000 0.0003 +++++ 858.415282 m 8.0000 203 | 6/11
12 h-m-p 0.0045 1.7203 0.4451 ---------C 858.415282 0 0.0000 231 | 6/11
13 h-m-p 0.0160 8.0000 0.0001 -------------.. | 6/11
14 h-m-p 0.0160 8.0000 0.0001 +++++ 858.415282 m 8.0000 283 | 6/11
15 h-m-p 0.0028 1.4180 0.4519 ----------C 858.415282 0 0.0000 312 | 6/11
16 h-m-p 0.0160 8.0000 0.0290 +++++ 858.415251 m 8.0000 334 | 6/11
17 h-m-p 0.3354 1.6768 0.5241 ------------C 858.415251 0 0.0000 365 | 6/11
18 h-m-p 0.0160 8.0000 0.0002 +++++ 858.415251 m 8.0000 387 | 6/11
19 h-m-p 0.0048 2.4103 0.5095 ---------C 858.415251 0 0.0000 415 | 6/11
20 h-m-p 0.0160 8.0000 0.0140 +++++ 858.415239 m 8.0000 437 | 6/11
21 h-m-p 0.2064 2.4948 0.5410 ---------------.. | 6/11
22 h-m-p 0.0160 8.0000 0.0002 +++++ 858.415238 m 8.0000 491 | 6/11
23 h-m-p 0.0070 3.4884 0.2678 ----------C 858.415238 0 0.0000 520 | 6/11
24 h-m-p 0.0160 8.0000 0.0003 +++++ 858.415238 m 8.0000 542 | 6/11
25 h-m-p 0.0100 5.0126 0.3036 ----------N 858.415238 0 0.0000 571 | 6/11
26 h-m-p 0.0160 8.0000 0.0044 +++++ 858.415232 m 8.0000 593 | 6/11
27 h-m-p 0.1080 5.0427 0.3224 ------------Y 858.415232 0 0.0000 624 | 6/11
28 h-m-p 0.0160 8.0000 0.0015 +++++ 858.415231 m 8.0000 646 | 6/11
29 h-m-p 0.0398 5.8298 0.3096 -----------C 858.415231 0 0.0000 676 | 6/11
30 h-m-p 0.0160 8.0000 0.0001 -------------.. | 6/11
31 h-m-p 0.0160 8.0000 0.0003 +++++ 858.415230 m 8.0000 728 | 6/11
32 h-m-p 0.0088 3.9569 0.2437 -----------Y 858.415230 0 0.0000 758 | 6/11
33 h-m-p 0.0160 8.0000 0.0033 +++++ 858.415223 m 8.0000 780 | 6/11
34 h-m-p 0.1005 3.8442 0.2637 ------------Y 858.415223 0 0.0000 811 | 6/11
35 h-m-p 0.0160 8.0000 0.0024 +++++ 858.415217 m 8.0000 833 | 6/11
36 h-m-p 0.0793 4.5592 0.2426 -------------Y 858.415217 0 0.0000 865 | 6/11
37 h-m-p 0.0160 8.0000 0.0004 +++++ 858.415217 m 8.0000 887 | 6/11
38 h-m-p 0.0078 3.5347 0.3609 ----------C 858.415217 0 0.0000 916 | 6/11
39 h-m-p 0.0160 8.0000 0.0011 +++++ 858.415215 m 8.0000 938 | 6/11
40 h-m-p 0.0214 3.3540 0.4251 -------------.. | 6/11
41 h-m-p 0.0160 8.0000 0.0003 +++++ 858.415214 m 8.0000 990 | 6/11
42 h-m-p 0.0125 4.7350 0.2157 ----------Y 858.415214 0 0.0000 1019 | 6/11
43 h-m-p 0.0002 0.1211 0.0061 +++++ 858.415213 m 0.1211 1041 | 7/11
44 h-m-p 0.0102 5.1004 0.4000 +++++ 858.415050 m 5.1004 1063
QuantileBeta(0.15, 0.00494, 0.83646) = 6.741209e-162 2000 rounds
| 8/11
45 h-m-p 0.3156 1.5779 1.8463 ++ 858.415000 m 1.5779 1081 | 9/11
46 h-m-p 0.2217 1.1087 1.5581 ++ 858.415000 m 1.1087 1095 | 9/11
47 h-m-p 1.6000 8.0000 0.9962 -------Y 858.415000 0 0.0000 1116 | 9/11
48 h-m-p 1.6000 8.0000 0.0000 Y 858.415000 0 1.6000 1132 | 9/11
49 h-m-p 0.1712 0.9361 0.0000 Y 858.415000 0 0.0625 1148 | 9/11
50 h-m-p 0.2049 2.8603 0.0000 Y 858.415000 0 0.2049 1164 | 9/11
51 h-m-p 0.1674 8.0000 0.0000 C 858.415000 0 0.0419 1180 | 9/11
52 h-m-p 0.2513 8.0000 0.0000 -Y 858.415000 0 0.0157 1197 | 9/11
53 h-m-p 0.3796 8.0000 0.0000 -N 858.415000 0 0.0237 1214
Out..
lnL = -858.415000
1215 lfun, 14580 eigenQcodon, 80190 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -858.472572 S = -858.415898 -0.025164
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:42
did 20 / 53 patterns 0:42
did 30 / 53 patterns 0:42
did 40 / 53 patterns 0:42
did 50 / 53 patterns 0:42
did 53 / 53 patterns 0:42
Time used: 0:42
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=219
NC_011896_1_WP_010908934_1_2672_MLBR_RS12710 MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
NC_002677_1_NP_302615_1_1487_ML2498 MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
NZ_LVXE01000003_1_WP_010908934_1_1332_A3216_RS02350 MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
NZ_LYPH01000044_1_WP_010908934_1_1731_A8144_RS08245 MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
NZ_CP029543_1_WP_010908934_1_2702_DIJ64_RS13760 MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
NZ_AP014567_1_WP_010908934_1_2769_JK2ML_RS14095 MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA
**************************************************
NC_011896_1_WP_010908934_1_2672_MLBR_RS12710 LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
NC_002677_1_NP_302615_1_1487_ML2498 LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
NZ_LVXE01000003_1_WP_010908934_1_1332_A3216_RS02350 LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
NZ_LYPH01000044_1_WP_010908934_1_1731_A8144_RS08245 LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
NZ_CP029543_1_WP_010908934_1_2702_DIJ64_RS13760 LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
NZ_AP014567_1_WP_010908934_1_2769_JK2ML_RS14095 LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA
**************************************************
NC_011896_1_WP_010908934_1_2672_MLBR_RS12710 FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
NC_002677_1_NP_302615_1_1487_ML2498 FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
NZ_LVXE01000003_1_WP_010908934_1_1332_A3216_RS02350 FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
NZ_LYPH01000044_1_WP_010908934_1_1731_A8144_RS08245 FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
NZ_CP029543_1_WP_010908934_1_2702_DIJ64_RS13760 FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
NZ_AP014567_1_WP_010908934_1_2769_JK2ML_RS14095 FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA
**************************************************
NC_011896_1_WP_010908934_1_2672_MLBR_RS12710 ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
NC_002677_1_NP_302615_1_1487_ML2498 ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
NZ_LVXE01000003_1_WP_010908934_1_1332_A3216_RS02350 ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
NZ_LYPH01000044_1_WP_010908934_1_1731_A8144_RS08245 ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
NZ_CP029543_1_WP_010908934_1_2702_DIJ64_RS13760 ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
NZ_AP014567_1_WP_010908934_1_2769_JK2ML_RS14095 ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL
**************************************************
NC_011896_1_WP_010908934_1_2672_MLBR_RS12710 GVIKQTMFGHAAAALSANA
NC_002677_1_NP_302615_1_1487_ML2498 GVIKQTMFGHAAAALSANA
NZ_LVXE01000003_1_WP_010908934_1_1332_A3216_RS02350 GVIKQTMFGHAAAALSANA
NZ_LYPH01000044_1_WP_010908934_1_1731_A8144_RS08245 GVIKQTMFGHAAAALSANA
NZ_CP029543_1_WP_010908934_1_2702_DIJ64_RS13760 GVIKQTMFGHAAAALSANA
NZ_AP014567_1_WP_010908934_1_2769_JK2ML_RS14095 GVIKQTMFGHAAAALSANA
*******************
>NC_011896_1_WP_010908934_1_2672_MLBR_RS12710 ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC CAATGCC >NC_002677_1_NP_302615_1_1487_ML2498 ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC CAATGCC >NZ_LVXE01000003_1_WP_010908934_1_1332_A3216_RS02350 ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC CAATGCC >NZ_LYPH01000044_1_WP_010908934_1_1731_A8144_RS08245 ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC CAATGCC >NZ_CP029543_1_WP_010908934_1_2702_DIJ64_RS13760 ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC CAATGCC >NZ_AP014567_1_WP_010908934_1_2769_JK2ML_RS14095 ATGACCATCGCCGTGCATTATGACGAAAAAATCGCCATCCTCGAACTTGG TGATGACGAAAATCGTTTCACATCTGTCTTTCTTGAAGAAATCAACTCCC ACCTCGACGAAATCATAGCCAGCGGTGCCAACGGCTTGGTGACGACGGCA CTTGGCAAGTTCTATTCCAACGGGCTAGACCTGGACTGGCTGTCCGCACA CCGTGACCAGACTCAGTGGTATGTCGGCAAGGTCCAGGGACTCCTGGCTC GCCTCCTCACGCTGCCCATCCCTACCGCAGCGGCCGTCGTTGGTCACGCG TTCGGCGCCGGAGCAATGTTGGCCATGGCGCACGATTTTCGTGTTATGCG TGCAGATCGCGGCTACTTCTGTTTTCCCGAAGTGGATATCCGCATCCCGT TCACGCCCGGCATGGCCGCACTGATACAAGCCAAACTTGCTCCCCAGGCA GCAACTGCGTCAATGACCACCGGGCGCCGGTTCGGCGGCGGCGAAGCCGC CCGCCTCGGAATTGTCGACAATACGGCAGCCGAGGATGCCGTTACCGCCG TGGCGGTCGACCTGCTTCATCCGCTCGGCGGCAAAGATCCAGGCACGCTG GGCGTCATCAAACAGACCATGTTCGGCCACGCCGCGGCTGCTCTTTCTGC CAATGCC
>NC_011896_1_WP_010908934_1_2672_MLBR_RS12710 MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL GVIKQTMFGHAAAALSANA >NC_002677_1_NP_302615_1_1487_ML2498 MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL GVIKQTMFGHAAAALSANA >NZ_LVXE01000003_1_WP_010908934_1_1332_A3216_RS02350 MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL GVIKQTMFGHAAAALSANA >NZ_LYPH01000044_1_WP_010908934_1_1731_A8144_RS08245 MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL GVIKQTMFGHAAAALSANA >NZ_CP029543_1_WP_010908934_1_2702_DIJ64_RS13760 MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL GVIKQTMFGHAAAALSANA >NZ_AP014567_1_WP_010908934_1_2769_JK2ML_RS14095 MTIAVHYDEKIAILELGDDENRFTSVFLEEINSHLDEIIASGANGLVTTA LGKFYSNGLDLDWLSAHRDQTQWYVGKVQGLLARLLTLPIPTAAAVVGHA FGAGAMLAMAHDFRVMRADRGYFCFPEVDIRIPFTPGMAALIQAKLAPQA ATASMTTGRRFGGGEAARLGIVDNTAAEDAVTAVAVDLLHPLGGKDPGTL GVIKQTMFGHAAAALSANA
#NEXUS
[ID: 5684953126]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908934_1_2672_MLBR_RS12710
NC_002677_1_NP_302615_1_1487_ML2498
NZ_LVXE01000003_1_WP_010908934_1_1332_A3216_RS02350
NZ_LYPH01000044_1_WP_010908934_1_1731_A8144_RS08245
NZ_CP029543_1_WP_010908934_1_2702_DIJ64_RS13760
NZ_AP014567_1_WP_010908934_1_2769_JK2ML_RS14095
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908934_1_2672_MLBR_RS12710,
2 NC_002677_1_NP_302615_1_1487_ML2498,
3 NZ_LVXE01000003_1_WP_010908934_1_1332_A3216_RS02350,
4 NZ_LYPH01000044_1_WP_010908934_1_1731_A8144_RS08245,
5 NZ_CP029543_1_WP_010908934_1_2702_DIJ64_RS13760,
6 NZ_AP014567_1_WP_010908934_1_2769_JK2ML_RS14095
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06722512,2:0.06607983,3:0.06559764,4:0.07104507,5:0.07088862,6:0.06859999);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06722512,2:0.06607983,3:0.06559764,4:0.07104507,5:0.07088862,6:0.06859999);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -898.46 -901.82
2 -898.52 -904.67
--------------------------------------
TOTAL -898.49 -904.04
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2498/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893153 0.092773 0.344270 1.495126 0.860419 1325.41 1413.20 1.000
r(A<->C){all} 0.168024 0.020461 0.000120 0.454267 0.128141 210.06 241.85 1.002
r(A<->G){all} 0.160458 0.018576 0.000046 0.431137 0.124720 222.50 252.07 1.004
r(A<->T){all} 0.170328 0.020066 0.000057 0.441223 0.135058 190.82 193.00 1.000
r(C<->G){all} 0.163176 0.019673 0.000021 0.449285 0.127114 175.82 208.39 1.000
r(C<->T){all} 0.170122 0.019850 0.000017 0.457311 0.134358 311.95 346.32 1.002
r(G<->T){all} 0.167892 0.019637 0.000002 0.444960 0.132083 175.79 208.16 1.003
pi(A){all} 0.198099 0.000249 0.166921 0.229249 0.198015 998.96 1141.58 1.000
pi(C){all} 0.325817 0.000337 0.291298 0.362966 0.325626 1085.77 1174.25 1.000
pi(G){all} 0.270779 0.000301 0.238609 0.306377 0.270298 1258.75 1379.88 1.000
pi(T){all} 0.205305 0.000249 0.174513 0.235169 0.205056 1193.40 1302.86 1.000
alpha{1,2} 0.431451 0.254073 0.000212 1.447037 0.251592 1013.83 1171.88 1.000
alpha{3} 0.478884 0.252378 0.000524 1.462121 0.316489 1198.92 1239.20 1.000
pinvar{all} 0.997585 0.000008 0.991730 0.999999 0.998533 1140.02 1213.22 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2498/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 219
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 1 1 1 1 1 1
TTC 7 7 7 7 7 7 | TCC 3 3 3 3 3 3 | TAC 1 1 1 1 1 1 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 6 6 6 6 6 6 | Pro CCT 1 1 1 1 1 1 | His CAT 2 2 2 2 2 2 | Arg CGT 4 4 4 4 4 4
CTC 7 7 7 7 7 7 | CCC 4 4 4 4 4 4 | CAC 5 5 5 5 5 5 | CGC 5 5 5 5 5 5
CTA 1 1 1 1 1 1 | CCA 1 1 1 1 1 1 | Gln CAA 1 1 1 1 1 1 | CGA 0 0 0 0 0 0
CTG 7 7 7 7 7 7 | CCG 2 2 2 2 2 2 | CAG 5 5 5 5 5 5 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 2 2 2 2 2 2 | Asn AAT 3 3 3 3 3 3 | Ser AGT 0 0 0 0 0 0
ATC 9 9 9 9 9 9 | ACC 6 6 6 6 6 6 | AAC 3 3 3 3 3 3 | AGC 1 1 1 1 1 1
ATA 2 2 2 2 2 2 | ACA 1 1 1 1 1 1 | Lys AAA 4 4 4 4 4 4 | Arg AGA 0 0 0 0 0 0
Met ATG 7 7 7 7 7 7 | ACG 6 6 6 6 6 6 | AAG 2 2 2 2 2 2 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 4 4 4 4 4 4 | Asp GAT 6 6 6 6 6 6 | Gly GGT 3 3 3 3 3 3
GTC 7 7 7 7 7 7 | GCC 17 17 17 17 17 17 | GAC 8 8 8 8 8 8 | GGC 14 14 14 14 14 14
GTA 0 0 0 0 0 0 | GCA 9 9 9 9 9 9 | Glu GAA 8 8 8 8 8 8 | GGA 3 3 3 3 3 3
GTG 4 4 4 4 4 4 | GCG 6 6 6 6 6 6 | GAG 1 1 1 1 1 1 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908934_1_2672_MLBR_RS12710
position 1: T:0.11416 C:0.23744 A:0.21461 G:0.43379
position 2: T:0.30137 C:0.29680 A:0.23744 G:0.16438
position 3: T:0.20091 C:0.44292 A:0.14155 G:0.21461
Average T:0.20548 C:0.32572 A:0.19787 G:0.27093
#2: NC_002677_1_NP_302615_1_1487_ML2498
position 1: T:0.11416 C:0.23744 A:0.21461 G:0.43379
position 2: T:0.30137 C:0.29680 A:0.23744 G:0.16438
position 3: T:0.20091 C:0.44292 A:0.14155 G:0.21461
Average T:0.20548 C:0.32572 A:0.19787 G:0.27093
#3: NZ_LVXE01000003_1_WP_010908934_1_1332_A3216_RS02350
position 1: T:0.11416 C:0.23744 A:0.21461 G:0.43379
position 2: T:0.30137 C:0.29680 A:0.23744 G:0.16438
position 3: T:0.20091 C:0.44292 A:0.14155 G:0.21461
Average T:0.20548 C:0.32572 A:0.19787 G:0.27093
#4: NZ_LYPH01000044_1_WP_010908934_1_1731_A8144_RS08245
position 1: T:0.11416 C:0.23744 A:0.21461 G:0.43379
position 2: T:0.30137 C:0.29680 A:0.23744 G:0.16438
position 3: T:0.20091 C:0.44292 A:0.14155 G:0.21461
Average T:0.20548 C:0.32572 A:0.19787 G:0.27093
#5: NZ_CP029543_1_WP_010908934_1_2702_DIJ64_RS13760
position 1: T:0.11416 C:0.23744 A:0.21461 G:0.43379
position 2: T:0.30137 C:0.29680 A:0.23744 G:0.16438
position 3: T:0.20091 C:0.44292 A:0.14155 G:0.21461
Average T:0.20548 C:0.32572 A:0.19787 G:0.27093
#6: NZ_AP014567_1_WP_010908934_1_2769_JK2ML_RS14095
position 1: T:0.11416 C:0.23744 A:0.21461 G:0.43379
position 2: T:0.30137 C:0.29680 A:0.23744 G:0.16438
position 3: T:0.20091 C:0.44292 A:0.14155 G:0.21461
Average T:0.20548 C:0.32572 A:0.19787 G:0.27093
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 18 | Ser S TCT 12 | Tyr Y TAT 18 | Cys C TGT 6
TTC 42 | TCC 18 | TAC 6 | TGC 0
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 0 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 36 | Pro P CCT 6 | His H CAT 12 | Arg R CGT 24
CTC 42 | CCC 24 | CAC 30 | CGC 30
CTA 6 | CCA 6 | Gln Q CAA 6 | CGA 0
CTG 42 | CCG 12 | CAG 30 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 12 | Asn N AAT 18 | Ser S AGT 0
ATC 54 | ACC 36 | AAC 18 | AGC 6
ATA 12 | ACA 6 | Lys K AAA 24 | Arg R AGA 0
Met M ATG 42 | ACG 36 | AAG 12 | AGG 0
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 24 | Asp D GAT 36 | Gly G GGT 18
GTC 42 | GCC 102 | GAC 48 | GGC 84
GTA 0 | GCA 54 | Glu E GAA 48 | GGA 18
GTG 24 | GCG 36 | GAG 6 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.11416 C:0.23744 A:0.21461 G:0.43379
position 2: T:0.30137 C:0.29680 A:0.23744 G:0.16438
position 3: T:0.20091 C:0.44292 A:0.14155 G:0.21461
Average T:0.20548 C:0.32572 A:0.19787 G:0.27093
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -858.415024 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.629271 0.000100
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908934_1_2672_MLBR_RS12710: 0.000004, NC_002677_1_NP_302615_1_1487_ML2498: 0.000004, NZ_LVXE01000003_1_WP_010908934_1_1332_A3216_RS02350: 0.000004, NZ_LYPH01000044_1_WP_010908934_1_1731_A8144_RS08245: 0.000004, NZ_CP029543_1_WP_010908934_1_2702_DIJ64_RS13760: 0.000004, NZ_AP014567_1_WP_010908934_1_2769_JK2ML_RS14095: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.62927
omega (dN/dS) = 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 493.4 163.6 0.0001 0.0000 0.0000 0.0 0.0
7..2 0.000 493.4 163.6 0.0001 0.0000 0.0000 0.0 0.0
7..3 0.000 493.4 163.6 0.0001 0.0000 0.0000 0.0 0.0
7..4 0.000 493.4 163.6 0.0001 0.0000 0.0000 0.0 0.0
7..5 0.000 493.4 163.6 0.0001 0.0000 0.0000 0.0 0.0
7..6 0.000 493.4 163.6 0.0001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -858.415000 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908934_1_2672_MLBR_RS12710: 0.000004, NC_002677_1_NP_302615_1_1487_ML2498: 0.000004, NZ_LVXE01000003_1_WP_010908934_1_1332_A3216_RS02350: 0.000004, NZ_LYPH01000044_1_WP_010908934_1_1731_A8144_RS08245: 0.000004, NZ_CP029543_1_WP_010908934_1_2702_DIJ64_RS13760: 0.000004, NZ_AP014567_1_WP_010908934_1_2769_JK2ML_RS14095: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 506.8 150.2 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 506.8 150.2 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 506.8 150.2 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 506.8 150.2 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 506.8 150.2 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 506.8 150.2 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -858.415036 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.978556 0.995320 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908934_1_2672_MLBR_RS12710: 0.000004, NC_002677_1_NP_302615_1_1487_ML2498: 0.000004, NZ_LVXE01000003_1_WP_010908934_1_1332_A3216_RS02350: 0.000004, NZ_LYPH01000044_1_WP_010908934_1_1731_A8144_RS08245: 0.000004, NZ_CP029543_1_WP_010908934_1_2702_DIJ64_RS13760: 0.000004, NZ_AP014567_1_WP_010908934_1_2769_JK2ML_RS14095: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.97856
MLEs of dN/dS (w) for site classes (K=3)
p: 0.99532 0.00000 0.00468
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 488.5 168.5 0.0047 0.0000 0.0000 0.0 0.0
7..2 0.000 488.5 168.5 0.0047 0.0000 0.0000 0.0 0.0
7..3 0.000 488.5 168.5 0.0047 0.0000 0.0000 0.0 0.0
7..4 0.000 488.5 168.5 0.0047 0.0000 0.0000 0.0 0.0
7..5 0.000 488.5 168.5 0.0047 0.0000 0.0000 0.0 0.0
7..6 0.000 488.5 168.5 0.0047 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908934_1_2672_MLBR_RS12710)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:09
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -858.415031 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.937296 0.005000 1.278759
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908934_1_2672_MLBR_RS12710: 0.000004, NC_002677_1_NP_302615_1_1487_ML2498: 0.000004, NZ_LVXE01000003_1_WP_010908934_1_1332_A3216_RS02350: 0.000004, NZ_LYPH01000044_1_WP_010908934_1_1731_A8144_RS08245: 0.000004, NZ_CP029543_1_WP_010908934_1_2702_DIJ64_RS13760: 0.000004, NZ_AP014567_1_WP_010908934_1_2769_JK2ML_RS14095: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.93730
Parameters in M7 (beta):
p = 0.00500 q = 1.27876
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 489.0 168.0 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 489.0 168.0 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 489.0 168.0 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 489.0 168.0 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 489.0 168.0 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 489.0 168.0 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:19
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -858.415000 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 0.709337 1.000017
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908934_1_2672_MLBR_RS12710: 0.000004, NC_002677_1_NP_302615_1_1487_ML2498: 0.000004, NZ_LVXE01000003_1_WP_010908934_1_1332_A3216_RS02350: 0.000004, NZ_LYPH01000044_1_WP_010908934_1_1731_A8144_RS08245: 0.000004, NZ_CP029543_1_WP_010908934_1_2702_DIJ64_RS13760: 0.000004, NZ_AP014567_1_WP_010908934_1_2769_JK2ML_RS14095: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 0.70934
(p1 = 0.00001) w = 1.00002
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00006 1.00002
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 506.8 150.2 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 506.8 150.2 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 506.8 150.2 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 506.8 150.2 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 506.8 150.2 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 506.8 150.2 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908934_1_2672_MLBR_RS12710)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.096 0.097 0.098 0.099 0.099 0.100 0.101 0.102 0.103 0.104
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.104 0.103 0.102 0.101 0.100 0.100 0.099 0.098 0.097 0.096
Time used: 0:42
Model 1: NearlyNeutral -858.415 Model 2: PositiveSelection -858.415036 Model 0: one-ratio -858.415024 Model 7: beta -858.415031 Model 8: beta&w>1 -858.415 Model 0 vs 1 4.8000000106185325E-5 Model 2 vs 1 7.200000004559115E-5 Model 8 vs 7 6.200000007083872E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
