--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:24:15 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2518/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -533.08          -537.23
2       -533.14          -536.21
--------------------------------------
TOTAL     -533.11          -536.84
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.890637    0.087046    0.346414    1.456484    0.857326   1330.55   1415.78    1.002
r(A<->C){all}   0.160190    0.021631    0.000015    0.455892    0.118878    158.98    172.83    1.005
r(A<->G){all}   0.174044    0.021294    0.000104    0.464696    0.138300    134.69    233.13    1.002
r(A<->T){all}   0.164650    0.019856    0.000068    0.453064    0.127073    125.82    139.23    1.000
r(C<->G){all}   0.169999    0.022380    0.000108    0.470889    0.124624    202.31    222.61    1.000
r(C<->T){all}   0.170193    0.020121    0.000015    0.457106    0.136268     86.98     96.64    1.001
r(G<->T){all}   0.160924    0.018495    0.000076    0.430477    0.125231    238.56    289.59    1.002
pi(A){all}      0.200522    0.000395    0.162896    0.239556    0.200186    981.98   1181.36    1.000
pi(C){all}      0.266610    0.000483    0.225301    0.311423    0.266179   1289.01   1296.62    1.000
pi(G){all}      0.332670    0.000557    0.286995    0.377635    0.332160   1326.63   1365.20    1.000
pi(T){all}      0.200198    0.000401    0.162755    0.241033    0.200020    940.06   1188.10    1.000
alpha{1,2}      0.408215    0.220875    0.000126    1.359506    0.242012    754.30    822.74    1.000
alpha{3}        0.463612    0.236763    0.000128    1.404857    0.300600   1387.67   1444.33    1.000
pinvar{all}     0.995865    0.000026    0.986891    0.999998    0.997475   1267.84   1354.03    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-513.956977
Model 2: PositiveSelection	-513.957012
Model 0: one-ratio	-513.957046
Model 7: beta	-513.956866
Model 8: beta&w>1	-513.956866


Model 0 vs 1	1.3799999987895717E-4

Model 2 vs 1	6.999999982326699E-5

Model 8 vs 7	0.0
>C1
VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
>C2
VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
>C3
VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
>C4
VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
>C5
VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
>C6
VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=130 

C1              VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
C2              VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
C3              VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
C4              VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
C5              VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
C6              VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
                **************************************************

C1              DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
C2              DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
C3              DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
C4              DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
C5              DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
C6              DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
                **************************************************

C1              NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
C2              NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
C3              NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
C4              NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
C5              NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
C6              NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
                ******************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  130 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  130 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3900]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [3900]--->[3900]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.462 Mb, Max= 30.660 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
C2              VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
C3              VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
C4              VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
C5              VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
C6              VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
                **************************************************

C1              DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
C2              DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
C3              DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
C4              DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
C5              DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
C6              DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
                **************************************************

C1              NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
C2              NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
C3              NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
C4              NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
C5              NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
C6              NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
                ******************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT
C2              GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT
C3              GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT
C4              GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT
C5              GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT
C6              GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT
                **************************************************

C1              GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC
C2              GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC
C3              GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC
C4              GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC
C5              GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC
C6              GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC
                **************************************************

C1              GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG
C2              GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG
C3              GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG
C4              GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG
C5              GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG
C6              GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG
                **************************************************

C1              GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG
C2              GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG
C3              GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG
C4              GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG
C5              GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG
C6              GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG
                **************************************************

C1              TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG
C2              TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG
C3              TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG
C4              TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG
C5              TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG
C6              TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG
                **************************************************

C1              TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC
C2              TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC
C3              TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC
C4              TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC
C5              TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC
C6              TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC
                **************************************************

C1              AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT
C2              AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT
C3              AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT
C4              AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT
C5              AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT
C6              AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT
                **************************************************

C1              CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG
C2              CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG
C3              CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG
C4              CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG
C5              CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG
C6              CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG
                ****************************************



>C1
GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT
GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC
GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG
GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG
TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG
TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC
AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT
CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG
>C2
GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT
GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC
GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG
GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG
TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG
TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC
AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT
CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG
>C3
GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT
GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC
GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG
GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG
TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG
TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC
AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT
CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG
>C4
GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT
GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC
GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG
GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG
TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG
TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC
AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT
CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG
>C5
GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT
GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC
GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG
GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG
TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG
TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC
AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT
CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG
>C6
GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT
GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC
GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG
GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG
TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG
TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC
AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT
CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG
>C1
VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
>C2
VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
>C3
VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
>C4
VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
>C5
VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
>C6
VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
NVDPKRKVRFLPYGIAVSVLDSHQESTQQL


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 390 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579857766
      Setting output file names to "/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 2073541575
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5137492014
      Seed = 1358813117
      Swapseed = 1579857766
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -872.838696 -- -24.965149
         Chain 2 -- -872.838696 -- -24.965149
         Chain 3 -- -872.838696 -- -24.965149
         Chain 4 -- -872.838696 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -872.838563 -- -24.965149
         Chain 2 -- -872.838696 -- -24.965149
         Chain 3 -- -872.838696 -- -24.965149
         Chain 4 -- -872.838696 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-872.839] (-872.839) (-872.839) (-872.839) * [-872.839] (-872.839) (-872.839) (-872.839) 
        500 -- (-549.911) [-545.442] (-545.434) (-549.620) * (-543.941) (-549.415) [-543.370] (-544.302) -- 0:00:00
       1000 -- (-543.957) (-540.937) [-546.312] (-542.754) * (-542.417) [-537.196] (-539.097) (-545.090) -- 0:00:00
       1500 -- (-549.176) (-543.944) [-541.491] (-539.010) * (-545.264) [-541.135] (-539.693) (-544.488) -- 0:00:00
       2000 -- [-538.929] (-542.423) (-541.222) (-547.719) * [-541.812] (-540.304) (-537.340) (-539.786) -- 0:00:00
       2500 -- (-539.392) [-545.995] (-546.248) (-543.544) * (-546.285) [-539.758] (-546.959) (-546.095) -- 0:00:00
       3000 -- (-550.893) (-540.975) [-545.327] (-539.801) * [-541.872] (-542.133) (-545.851) (-541.093) -- 0:00:00
       3500 -- (-540.855) (-544.313) (-546.149) [-539.999] * (-548.740) (-544.990) [-543.488] (-546.375) -- 0:00:00
       4000 -- (-539.725) (-546.971) [-541.018] (-541.407) * (-545.672) (-541.248) (-548.996) [-543.962] -- 0:04:09
       4500 -- (-554.372) (-544.719) [-547.455] (-540.369) * (-537.561) (-541.539) [-536.286] (-547.908) -- 0:03:41
       5000 -- (-540.255) [-540.805] (-539.465) (-541.459) * (-545.533) (-542.162) (-542.744) [-539.031] -- 0:03:19

      Average standard deviation of split frequencies: 0.102479

       5500 -- (-546.519) (-550.970) (-546.581) [-538.067] * (-542.972) (-536.421) (-543.429) [-538.620] -- 0:03:00
       6000 -- (-553.699) (-539.762) [-539.762] (-546.536) * [-541.203] (-541.238) (-538.787) (-542.418) -- 0:02:45
       6500 -- (-535.814) (-545.236) (-541.611) [-539.002] * (-548.338) (-543.876) [-539.221] (-550.580) -- 0:02:32
       7000 -- (-533.112) [-540.940] (-540.837) (-539.271) * [-539.892] (-552.534) (-542.220) (-545.865) -- 0:02:21
       7500 -- [-534.687] (-546.088) (-538.392) (-542.963) * (-539.639) (-546.391) (-547.617) [-544.332] -- 0:02:12
       8000 -- [-534.347] (-545.965) (-552.823) (-550.644) * [-538.586] (-541.537) (-544.089) (-541.973) -- 0:02:04
       8500 -- (-533.106) (-543.185) (-540.905) [-546.768] * (-547.216) [-540.075] (-544.903) (-538.741) -- 0:01:56
       9000 -- (-532.139) [-539.459] (-545.006) (-543.788) * (-541.126) [-541.337] (-546.201) (-538.882) -- 0:01:50
       9500 -- (-534.203) [-537.828] (-540.845) (-533.478) * (-539.846) (-550.178) [-536.313] (-550.349) -- 0:01:44
      10000 -- (-535.236) [-540.904] (-548.539) (-531.826) * (-545.827) [-544.703] (-540.241) (-540.143) -- 0:01:39

      Average standard deviation of split frequencies: 0.077340

      10500 -- [-532.243] (-551.764) (-543.863) (-532.035) * (-540.758) (-544.514) (-541.789) [-540.026] -- 0:01:34
      11000 -- (-534.068) [-547.769] (-543.002) (-538.751) * (-543.709) (-544.157) [-542.215] (-538.399) -- 0:01:29
      11500 -- (-535.205) [-538.676] (-548.506) (-537.292) * (-540.114) (-551.681) [-539.912] (-545.763) -- 0:01:25
      12000 -- (-534.453) (-543.684) [-539.736] (-532.587) * (-541.592) [-538.722] (-544.993) (-540.392) -- 0:01:22
      12500 -- (-535.661) (-542.152) [-539.902] (-534.349) * (-554.449) [-542.474] (-548.488) (-538.930) -- 0:01:19
      13000 -- (-537.605) (-540.504) (-549.593) [-534.486] * (-541.156) (-546.123) (-546.845) [-539.734] -- 0:01:15
      13500 -- (-535.525) (-540.293) (-557.463) [-534.544] * (-552.855) (-557.616) (-537.535) [-539.299] -- 0:01:13
      14000 -- (-536.104) (-544.320) [-546.612] (-535.080) * (-547.330) (-532.806) (-543.134) [-541.964] -- 0:01:10
      14500 -- [-534.345] (-548.039) (-545.118) (-533.834) * (-544.737) (-534.337) [-542.977] (-540.181) -- 0:01:07
      15000 -- (-533.783) (-544.846) (-542.288) [-536.607] * (-543.295) (-536.035) (-550.136) [-539.520] -- 0:01:05

      Average standard deviation of split frequencies: 0.058926

      15500 -- (-533.167) (-541.623) (-540.964) [-532.511] * (-544.674) (-540.787) (-544.971) [-546.257] -- 0:01:03
      16000 -- (-533.120) (-542.982) [-554.017] (-532.842) * (-546.191) (-532.695) [-540.807] (-543.438) -- 0:01:01
      16500 -- (-532.510) (-542.410) (-540.465) [-532.452] * [-545.406] (-532.449) (-541.548) (-543.899) -- 0:00:59
      17000 -- [-535.162] (-541.327) (-532.793) (-533.392) * [-539.437] (-532.745) (-545.899) (-548.743) -- 0:00:57
      17500 -- (-532.792) [-545.724] (-533.609) (-532.030) * (-541.821) (-534.348) [-541.347] (-547.571) -- 0:00:56
      18000 -- (-534.484) (-540.798) [-533.721] (-536.020) * (-544.592) (-533.853) (-538.012) [-545.461] -- 0:00:54
      18500 -- (-532.005) [-539.999] (-531.839) (-536.172) * [-547.790] (-540.148) (-546.675) (-549.221) -- 0:00:53
      19000 -- [-533.073] (-539.867) (-534.308) (-534.716) * (-537.343) [-533.282] (-537.609) (-544.185) -- 0:01:43
      19500 -- (-533.835) (-549.123) (-536.579) [-537.391] * (-536.438) (-533.321) [-541.093] (-537.216) -- 0:01:40
      20000 -- (-534.305) (-545.041) [-534.454] (-533.309) * (-535.996) (-535.367) (-550.300) [-547.516] -- 0:01:38

      Average standard deviation of split frequencies: 0.060446

      20500 -- (-535.099) (-538.629) (-536.515) [-533.076] * (-535.526) (-534.299) [-538.823] (-540.249) -- 0:01:35
      21000 -- (-533.730) (-547.011) [-534.244] (-532.138) * (-536.949) [-534.058] (-543.193) (-544.273) -- 0:01:33
      21500 -- [-532.452] (-548.629) (-532.933) (-536.492) * (-539.213) (-532.485) (-543.016) [-539.206] -- 0:01:31
      22000 -- [-532.031] (-548.762) (-532.649) (-534.010) * [-535.042] (-534.873) (-548.026) (-543.106) -- 0:01:28
      22500 -- (-531.936) (-546.113) (-532.538) [-534.870] * [-534.646] (-532.866) (-539.394) (-541.316) -- 0:01:26
      23000 -- (-535.454) (-537.025) (-535.958) [-534.549] * (-534.646) (-533.533) [-546.161] (-542.079) -- 0:01:24
      23500 -- (-537.533) [-544.607] (-535.983) (-533.291) * (-534.212) (-533.217) [-541.348] (-542.325) -- 0:01:23
      24000 -- (-534.001) (-546.472) [-536.053] (-537.034) * (-534.382) (-534.005) (-538.473) [-540.638] -- 0:01:21
      24500 -- (-535.534) [-537.351] (-534.467) (-534.433) * (-532.014) (-534.848) [-537.784] (-535.845) -- 0:01:19
      25000 -- (-534.480) (-538.419) (-533.455) [-538.566] * (-531.940) [-533.008] (-542.500) (-538.634) -- 0:01:18

      Average standard deviation of split frequencies: 0.058710

      25500 -- (-535.451) [-546.046] (-535.118) (-534.501) * (-532.221) [-532.866] (-538.987) (-546.370) -- 0:01:16
      26000 -- (-535.893) (-542.916) (-533.668) [-533.446] * (-534.204) (-533.730) (-547.720) [-538.170] -- 0:01:14
      26500 -- (-533.639) [-546.887] (-532.632) (-532.569) * (-533.922) (-532.448) [-542.007] (-544.459) -- 0:01:13
      27000 -- (-533.993) (-539.733) [-532.236] (-533.372) * (-533.949) (-531.860) [-540.720] (-552.878) -- 0:01:12
      27500 -- (-534.927) [-541.989] (-537.001) (-536.049) * (-532.349) [-538.125] (-542.009) (-544.490) -- 0:01:10
      28000 -- [-533.667] (-542.605) (-535.134) (-533.756) * (-534.983) [-532.685] (-557.654) (-545.867) -- 0:01:09
      28500 -- (-532.609) (-542.470) (-532.504) [-533.370] * (-535.590) (-539.366) (-544.085) [-545.907] -- 0:01:08
      29000 -- (-532.944) [-541.094] (-534.588) (-533.870) * (-534.356) [-536.583] (-544.069) (-540.388) -- 0:01:06
      29500 -- [-532.791] (-541.708) (-532.428) (-535.857) * (-533.803) [-531.780] (-538.639) (-548.231) -- 0:01:05
      30000 -- (-537.428) (-550.906) (-532.707) [-534.902] * [-532.625] (-534.327) (-546.450) (-543.733) -- 0:01:04

      Average standard deviation of split frequencies: 0.050308

      30500 -- (-535.941) (-553.456) [-533.599] (-534.430) * (-532.543) (-537.745) (-543.949) [-537.503] -- 0:01:03
      31000 -- (-537.018) (-546.789) [-532.382] (-534.910) * (-537.037) (-534.099) [-539.814] (-544.345) -- 0:01:02
      31500 -- (-532.574) (-544.576) (-533.718) [-532.602] * (-537.242) (-536.381) [-544.765] (-543.135) -- 0:01:01
      32000 -- [-531.857] (-543.744) (-533.397) (-532.320) * (-533.500) (-534.441) [-548.990] (-551.413) -- 0:01:00
      32500 -- [-534.065] (-559.510) (-539.937) (-533.155) * (-533.860) (-532.389) (-544.769) [-539.407] -- 0:00:59
      33000 -- (-533.761) (-542.923) [-533.224] (-538.213) * (-532.771) [-533.968] (-546.426) (-539.664) -- 0:00:58
      33500 -- (-534.295) (-532.372) [-533.527] (-538.236) * (-533.234) (-534.428) [-544.642] (-540.205) -- 0:00:57
      34000 -- (-533.005) [-531.591] (-544.024) (-534.648) * (-535.347) (-535.440) (-540.753) [-539.394] -- 0:00:56
      34500 -- (-535.023) [-532.216] (-533.462) (-535.922) * [-532.933] (-535.748) (-543.122) (-540.945) -- 0:00:55
      35000 -- [-532.823] (-534.304) (-533.559) (-538.425) * (-533.811) (-532.993) [-551.923] (-547.689) -- 0:00:55

      Average standard deviation of split frequencies: 0.053833

      35500 -- (-532.431) (-533.139) [-532.282] (-534.408) * [-535.562] (-531.878) (-543.073) (-536.525) -- 0:00:54
      36000 -- (-535.740) (-535.014) [-533.776] (-533.501) * (-533.480) (-533.695) [-541.976] (-542.715) -- 0:01:20
      36500 -- (-536.058) (-532.947) (-535.746) [-533.419] * (-536.339) (-532.321) (-545.899) [-539.105] -- 0:01:19
      37000 -- [-535.517] (-531.934) (-536.612) (-534.954) * (-534.094) [-533.722] (-544.631) (-541.560) -- 0:01:18
      37500 -- (-533.620) (-533.721) [-533.552] (-536.930) * (-533.841) (-533.988) (-540.019) [-542.056] -- 0:01:17
      38000 -- [-533.241] (-535.583) (-534.699) (-534.933) * (-532.914) (-534.440) (-546.173) [-540.625] -- 0:01:15
      38500 -- (-534.018) (-534.985) (-532.831) [-531.916] * (-534.347) (-535.248) [-541.656] (-542.038) -- 0:01:14
      39000 -- (-536.564) [-535.262] (-532.559) (-533.953) * [-532.344] (-535.043) (-540.353) (-541.484) -- 0:01:13
      39500 -- (-532.485) (-532.049) (-533.795) [-533.708] * (-532.345) [-533.132] (-545.006) (-542.411) -- 0:01:12
      40000 -- (-532.809) [-531.964] (-532.067) (-534.488) * (-533.256) (-532.504) (-547.812) [-541.107] -- 0:01:12

      Average standard deviation of split frequencies: 0.056739

      40500 -- (-537.550) (-533.462) [-534.515] (-537.448) * [-533.060] (-532.692) (-541.692) (-539.459) -- 0:01:11
      41000 -- (-532.577) (-534.403) (-532.910) [-531.695] * (-533.228) (-534.223) (-545.478) [-537.200] -- 0:01:10
      41500 -- (-532.464) [-533.443] (-534.997) (-532.482) * (-535.283) [-535.132] (-547.611) (-543.030) -- 0:01:09
      42000 -- (-534.768) (-532.752) (-532.369) [-533.071] * (-532.043) (-536.295) (-540.112) [-538.021] -- 0:01:08
      42500 -- [-532.994] (-531.943) (-533.366) (-533.507) * (-533.043) [-533.938] (-537.804) (-547.328) -- 0:01:07
      43000 -- (-536.833) (-532.225) [-532.516] (-534.387) * [-533.348] (-533.767) (-548.877) (-542.316) -- 0:01:06
      43500 -- (-534.445) [-532.138] (-532.169) (-536.099) * (-532.607) (-533.415) [-540.830] (-540.165) -- 0:01:05
      44000 -- (-539.805) (-533.865) (-532.140) [-536.428] * [-536.319] (-532.657) (-541.301) (-544.099) -- 0:01:05
      44500 -- (-533.325) (-533.449) [-532.837] (-532.517) * (-533.337) [-532.474] (-547.980) (-546.983) -- 0:01:04
      45000 -- (-532.408) (-535.540) [-532.376] (-531.452) * (-534.067) (-535.173) [-544.883] (-545.715) -- 0:01:03

      Average standard deviation of split frequencies: 0.051240

      45500 -- (-531.802) (-533.333) (-532.168) [-531.931] * (-532.887) (-537.619) (-545.417) [-538.341] -- 0:01:02
      46000 -- [-532.024] (-535.748) (-532.804) (-535.695) * [-534.409] (-533.985) (-545.032) (-545.065) -- 0:01:02
      46500 -- (-532.779) [-532.955] (-534.991) (-532.835) * (-536.819) (-533.977) (-546.935) [-540.364] -- 0:01:01
      47000 -- [-533.597] (-535.218) (-532.481) (-534.472) * [-539.149] (-532.153) (-546.345) (-546.630) -- 0:01:00
      47500 -- (-531.682) [-533.542] (-532.906) (-536.457) * (-534.878) (-532.335) (-540.921) [-550.398] -- 0:01:00
      48000 -- (-532.320) (-534.025) (-533.383) [-535.361] * (-532.118) (-533.050) (-543.155) [-543.930] -- 0:00:59
      48500 -- (-534.930) [-532.299] (-535.719) (-534.065) * [-532.185] (-533.760) (-543.851) (-539.117) -- 0:00:58
      49000 -- [-534.083] (-532.730) (-535.381) (-540.101) * [-532.170] (-532.713) (-540.985) (-555.328) -- 0:00:58
      49500 -- [-533.645] (-533.120) (-534.129) (-533.567) * [-533.787] (-534.216) (-553.798) (-542.211) -- 0:00:57
      50000 -- [-533.887] (-533.930) (-533.714) (-533.328) * (-532.055) (-534.616) [-544.082] (-546.825) -- 0:00:57

      Average standard deviation of split frequencies: 0.045251

      50500 -- (-532.976) (-533.934) [-532.796] (-538.734) * (-533.014) (-531.610) (-542.184) [-540.740] -- 0:00:56
      51000 -- [-534.215] (-534.490) (-532.237) (-534.834) * (-534.623) (-534.509) [-544.344] (-547.113) -- 0:00:55
      51500 -- (-533.731) (-532.277) (-534.875) [-533.212] * (-533.122) (-534.694) [-537.970] (-542.956) -- 0:00:55
      52000 -- [-533.989] (-532.099) (-533.285) (-535.722) * (-534.600) (-533.202) [-541.801] (-547.392) -- 0:00:54
      52500 -- [-534.051] (-533.760) (-533.421) (-533.762) * [-534.426] (-532.023) (-544.306) (-543.870) -- 0:01:12
      53000 -- (-533.198) (-532.953) [-540.881] (-533.409) * (-534.300) [-533.651] (-547.669) (-548.200) -- 0:01:11
      53500 -- [-532.278] (-533.860) (-533.985) (-534.972) * [-536.778] (-534.802) (-544.839) (-540.768) -- 0:01:10
      54000 -- (-532.678) (-533.925) (-536.228) [-532.635] * (-537.856) (-533.305) [-540.131] (-543.692) -- 0:01:10
      54500 -- (-533.704) [-532.866] (-533.944) (-534.340) * (-537.745) (-533.980) (-547.426) [-536.265] -- 0:01:09
      55000 -- (-536.017) [-532.637] (-532.137) (-533.517) * (-536.734) (-532.739) [-541.550] (-552.023) -- 0:01:08

      Average standard deviation of split frequencies: 0.040486

      55500 -- (-533.848) [-533.271] (-536.406) (-534.206) * (-538.277) (-533.295) [-537.916] (-547.802) -- 0:01:08
      56000 -- (-535.982) [-533.085] (-537.238) (-534.680) * (-535.463) (-535.356) (-545.610) [-541.153] -- 0:01:07
      56500 -- (-534.653) [-535.238] (-534.820) (-535.273) * (-533.976) [-538.149] (-538.881) (-541.129) -- 0:01:06
      57000 -- (-531.947) (-532.822) (-532.450) [-533.059] * (-533.455) (-535.815) [-544.208] (-542.074) -- 0:01:06
      57500 -- (-537.137) [-532.934] (-536.874) (-533.492) * (-531.837) (-535.236) (-545.788) [-540.854] -- 0:01:05
      58000 -- (-534.250) (-532.361) [-536.945] (-535.182) * (-533.079) [-531.944] (-546.525) (-539.753) -- 0:01:04
      58500 -- (-535.260) [-532.029] (-535.918) (-533.178) * (-531.575) (-535.584) (-542.570) [-541.446] -- 0:01:04
      59000 -- [-535.179] (-533.445) (-538.414) (-533.081) * (-534.017) [-532.296] (-540.874) (-554.188) -- 0:01:03
      59500 -- (-533.254) (-532.827) (-534.165) [-532.583] * (-534.798) (-539.829) (-546.093) [-541.113] -- 0:01:03
      60000 -- [-533.934] (-533.407) (-535.795) (-532.533) * [-536.271] (-536.023) (-541.388) (-543.990) -- 0:01:02

      Average standard deviation of split frequencies: 0.033672

      60500 -- (-534.053) [-535.406] (-533.461) (-533.475) * (-533.274) [-531.497] (-552.425) (-548.062) -- 0:01:02
      61000 -- (-532.178) (-531.686) [-533.564] (-536.560) * [-534.677] (-533.894) (-539.842) (-549.897) -- 0:01:01
      61500 -- (-533.085) (-533.368) [-532.497] (-536.480) * (-533.381) [-532.947] (-540.161) (-542.738) -- 0:01:01
      62000 -- (-532.452) (-532.396) [-531.828] (-532.169) * (-533.928) (-533.754) (-542.754) [-543.093] -- 0:01:00
      62500 -- (-533.617) (-532.165) [-535.385] (-533.622) * (-537.343) (-536.135) [-539.439] (-541.407) -- 0:01:00
      63000 -- [-531.981] (-532.600) (-532.914) (-535.052) * (-533.295) (-534.490) (-546.324) [-542.910] -- 0:00:59
      63500 -- (-532.914) (-533.310) (-534.988) [-533.518] * (-534.043) (-535.180) (-545.427) [-542.250] -- 0:00:58
      64000 -- [-535.366] (-534.031) (-536.834) (-534.403) * [-533.043] (-532.041) (-547.092) (-538.435) -- 0:00:58
      64500 -- [-533.873] (-536.960) (-533.641) (-533.064) * [-532.948] (-535.137) (-544.125) (-544.979) -- 0:00:58
      65000 -- (-533.585) (-534.305) (-534.476) [-534.847] * (-534.419) [-532.064] (-551.690) (-542.377) -- 0:00:57

      Average standard deviation of split frequencies: 0.033672

      65500 -- (-537.269) (-535.565) (-534.371) [-534.169] * [-534.891] (-531.851) (-553.485) (-542.641) -- 0:00:57
      66000 -- (-532.870) [-532.054] (-535.450) (-533.352) * (-532.692) [-531.763] (-541.794) (-543.182) -- 0:00:56
      66500 -- [-533.112] (-533.564) (-537.446) (-531.526) * (-534.738) [-533.041] (-546.814) (-545.072) -- 0:00:56
      67000 -- (-534.294) (-531.857) [-533.051] (-533.285) * [-535.703] (-533.020) (-544.873) (-548.214) -- 0:00:55
      67500 -- (-534.840) (-533.434) [-532.462] (-540.145) * (-535.595) [-534.270] (-545.187) (-557.194) -- 0:00:55
      68000 -- (-533.421) (-533.113) (-540.132) [-533.675] * (-533.592) [-533.664] (-544.741) (-539.818) -- 0:00:54
      68500 -- (-534.453) (-535.702) (-537.704) [-533.650] * (-535.284) (-532.024) [-533.652] (-534.736) -- 0:00:54
      69000 -- (-537.174) (-532.385) (-533.012) [-534.794] * (-535.984) (-533.003) (-532.989) [-534.879] -- 0:01:07
      69500 -- (-536.237) [-533.185] (-534.211) (-532.443) * (-533.999) [-533.789] (-534.508) (-532.164) -- 0:01:06
      70000 -- (-532.578) (-533.222) [-533.234] (-531.875) * (-533.707) (-532.680) [-534.118] (-532.292) -- 0:01:06

      Average standard deviation of split frequencies: 0.032141

      70500 -- (-535.505) [-534.157] (-531.787) (-532.408) * (-534.285) (-532.073) [-536.554] (-534.049) -- 0:01:05
      71000 -- (-532.604) [-532.430] (-536.059) (-532.822) * (-538.326) [-534.037] (-535.412) (-534.156) -- 0:01:05
      71500 -- (-531.842) (-531.686) [-534.672] (-534.612) * (-535.743) (-533.261) [-533.769] (-534.281) -- 0:01:04
      72000 -- [-535.162] (-534.453) (-533.698) (-536.032) * (-531.674) (-532.566) [-532.602] (-533.479) -- 0:01:04
      72500 -- (-534.020) (-535.141) (-533.454) [-533.553] * (-531.880) (-534.051) [-532.572] (-534.562) -- 0:01:03
      73000 -- (-536.218) [-532.571] (-535.603) (-539.324) * [-533.511] (-535.469) (-537.710) (-535.008) -- 0:01:03
      73500 -- (-534.182) (-534.044) (-533.737) [-532.241] * (-533.105) (-535.765) (-534.905) [-533.143] -- 0:01:03
      74000 -- (-533.809) (-534.609) (-533.697) [-534.151] * (-531.912) [-534.045] (-535.085) (-534.647) -- 0:01:02
      74500 -- (-535.962) (-535.947) (-534.188) [-535.261] * (-532.920) (-533.427) (-532.333) [-533.444] -- 0:01:02
      75000 -- [-532.708] (-534.739) (-535.136) (-532.087) * (-531.907) (-532.681) (-535.764) [-533.530] -- 0:01:01

      Average standard deviation of split frequencies: 0.028843

      75500 -- (-533.953) (-533.974) [-532.203] (-532.616) * [-532.283] (-535.241) (-536.477) (-535.370) -- 0:01:01
      76000 -- (-533.533) [-536.047] (-534.688) (-532.521) * [-535.091] (-538.118) (-536.111) (-536.165) -- 0:01:00
      76500 -- [-533.521] (-540.322) (-534.055) (-532.734) * (-533.027) (-533.373) [-533.987] (-533.720) -- 0:01:00
      77000 -- (-532.705) (-538.051) (-534.727) [-532.287] * [-533.468] (-532.906) (-534.529) (-536.703) -- 0:00:59
      77500 -- [-532.892] (-540.622) (-533.049) (-533.635) * (-532.688) [-533.428] (-532.845) (-533.155) -- 0:00:59
      78000 -- [-534.290] (-533.161) (-532.393) (-535.359) * (-532.761) (-534.370) (-535.171) [-534.580] -- 0:00:59
      78500 -- [-535.055] (-532.986) (-535.846) (-532.880) * (-533.485) (-535.127) [-537.007] (-532.932) -- 0:00:58
      79000 -- (-533.667) (-533.848) [-532.694] (-532.770) * (-532.122) [-533.279] (-534.988) (-533.952) -- 0:00:58
      79500 -- (-534.514) (-535.629) [-532.006] (-537.891) * (-536.035) (-535.787) (-533.751) [-535.082] -- 0:00:57
      80000 -- (-532.186) [-534.541] (-535.660) (-536.291) * [-534.787] (-533.721) (-534.590) (-533.862) -- 0:00:57

      Average standard deviation of split frequencies: 0.028106

      80500 -- [-531.626] (-532.305) (-532.364) (-535.515) * (-532.010) [-533.796] (-533.135) (-533.850) -- 0:00:57
      81000 -- (-533.991) (-532.308) [-533.663] (-534.961) * (-535.623) (-535.652) [-533.305] (-537.919) -- 0:00:56
      81500 -- (-532.417) (-534.437) [-533.702] (-533.619) * (-536.153) (-536.607) [-533.954] (-532.669) -- 0:00:56
      82000 -- (-533.403) [-531.999] (-534.439) (-535.795) * (-534.429) (-535.222) (-534.234) [-534.200] -- 0:00:55
      82500 -- (-533.987) (-534.019) [-533.978] (-535.778) * (-535.923) (-535.468) (-533.560) [-534.331] -- 0:00:55
      83000 -- [-534.134] (-540.469) (-534.244) (-532.224) * (-534.595) [-534.220] (-537.212) (-533.212) -- 0:00:55
      83500 -- [-533.361] (-544.723) (-534.998) (-532.215) * (-535.042) [-532.458] (-534.648) (-532.114) -- 0:00:54
      84000 -- (-534.319) [-535.940] (-537.989) (-534.584) * [-535.045] (-533.508) (-533.830) (-531.997) -- 0:00:54
      84500 -- [-532.604] (-533.429) (-536.051) (-534.862) * [-535.301] (-532.476) (-534.314) (-532.626) -- 0:01:05
      85000 -- (-532.762) (-532.464) [-532.490] (-533.931) * (-536.273) [-532.204] (-533.825) (-532.525) -- 0:01:04

      Average standard deviation of split frequencies: 0.031062

      85500 -- [-536.283] (-531.811) (-532.963) (-533.246) * [-532.901] (-536.916) (-534.999) (-534.622) -- 0:01:04
      86000 -- (-532.726) [-532.825] (-535.667) (-534.272) * (-532.865) (-535.065) [-532.490] (-536.088) -- 0:01:03
      86500 -- (-533.579) (-532.412) (-537.583) [-534.955] * (-537.315) (-533.964) (-532.991) [-534.189] -- 0:01:03
      87000 -- (-534.568) (-533.308) (-537.901) [-536.936] * (-537.383) [-534.339] (-533.408) (-531.980) -- 0:01:02
      87500 -- (-538.295) [-533.930] (-535.549) (-536.096) * (-535.296) [-533.489] (-532.333) (-532.460) -- 0:01:02
      88000 -- (-532.562) (-531.805) [-532.739] (-540.212) * [-534.554] (-535.212) (-534.070) (-532.544) -- 0:01:02
      88500 -- [-533.473] (-532.249) (-532.627) (-535.466) * (-531.644) (-533.755) (-532.663) [-533.086] -- 0:01:01
      89000 -- (-533.368) [-533.750] (-532.706) (-534.201) * [-532.448] (-536.458) (-533.761) (-534.637) -- 0:01:01
      89500 -- [-537.924] (-536.888) (-534.416) (-534.943) * (-532.140) (-533.995) [-532.118] (-532.221) -- 0:01:01
      90000 -- (-539.111) (-533.695) [-535.028] (-533.858) * (-533.059) (-533.749) (-532.323) [-533.388] -- 0:01:00

      Average standard deviation of split frequencies: 0.029896

      90500 -- [-532.262] (-533.573) (-534.657) (-535.352) * (-534.597) (-535.519) [-532.427] (-536.109) -- 0:01:00
      91000 -- [-533.138] (-534.934) (-534.489) (-540.886) * (-534.323) (-534.373) (-531.800) [-533.189] -- 0:00:59
      91500 -- [-535.434] (-535.248) (-539.047) (-535.056) * (-533.286) (-533.558) (-533.578) [-533.568] -- 0:00:59
      92000 -- (-532.488) [-537.718] (-532.776) (-535.885) * (-533.384) (-534.231) [-535.115] (-534.030) -- 0:00:59
      92500 -- (-533.453) [-533.712] (-533.112) (-536.021) * [-534.100] (-533.210) (-533.176) (-534.439) -- 0:00:58
      93000 -- [-532.900] (-533.600) (-538.569) (-533.660) * (-536.059) (-533.807) (-534.960) [-533.138] -- 0:00:58
      93500 -- [-534.507] (-534.625) (-536.628) (-537.011) * (-535.038) (-532.313) (-533.314) [-534.900] -- 0:00:58
      94000 -- (-537.033) (-533.593) [-533.959] (-534.386) * (-531.678) [-531.654] (-533.180) (-534.415) -- 0:00:57
      94500 -- [-533.281] (-532.610) (-533.973) (-535.253) * (-531.880) (-531.970) [-532.932] (-535.522) -- 0:00:57
      95000 -- (-533.443) (-532.519) [-534.135] (-536.163) * (-533.120) (-539.138) (-533.831) [-535.077] -- 0:00:57

      Average standard deviation of split frequencies: 0.028429

      95500 -- (-532.771) [-532.038] (-537.794) (-537.889) * (-533.212) (-538.328) (-533.378) [-533.252] -- 0:00:56
      96000 -- (-532.608) (-533.813) (-535.156) [-537.062] * [-535.914] (-534.901) (-532.758) (-533.737) -- 0:00:56
      96500 -- (-535.873) [-531.897] (-533.766) (-535.424) * (-534.622) [-535.918] (-535.761) (-535.389) -- 0:00:56
      97000 -- (-534.816) [-534.150] (-535.617) (-533.754) * [-531.943] (-534.895) (-534.151) (-533.464) -- 0:00:55
      97500 -- [-533.733] (-537.622) (-534.967) (-535.335) * (-536.278) (-533.323) (-539.982) [-532.980] -- 0:00:55
      98000 -- (-535.639) (-534.271) [-534.255] (-536.371) * (-533.694) (-532.802) [-538.177] (-538.673) -- 0:00:55
      98500 -- [-533.028] (-533.663) (-533.765) (-533.768) * (-535.829) (-533.805) (-531.665) [-534.541] -- 0:00:54
      99000 -- (-534.283) (-533.959) (-536.788) [-536.780] * (-532.609) (-534.310) (-532.034) [-533.247] -- 0:00:54
      99500 -- (-535.814) [-535.441] (-533.276) (-534.025) * (-535.370) [-532.593] (-532.971) (-532.751) -- 0:01:03
      100000 -- (-537.369) [-534.514] (-534.468) (-535.267) * (-535.838) (-532.112) [-533.874] (-535.627) -- 0:01:02

      Average standard deviation of split frequencies: 0.026796

      100500 -- (-535.091) (-532.245) [-534.362] (-535.130) * (-532.471) (-533.683) (-534.119) [-531.974] -- 0:01:02
      101000 -- [-533.925] (-533.449) (-536.374) (-534.964) * (-532.344) (-532.892) (-533.196) [-533.865] -- 0:01:02
      101500 -- (-533.641) [-532.653] (-532.798) (-535.180) * [-532.529] (-534.700) (-534.905) (-532.645) -- 0:01:01
      102000 -- [-533.216] (-532.433) (-532.961) (-535.668) * (-536.417) [-531.542] (-533.022) (-535.407) -- 0:01:01
      102500 -- [-534.455] (-532.973) (-532.372) (-533.367) * (-535.538) (-531.524) (-532.800) [-535.590] -- 0:01:01
      103000 -- (-534.896) (-533.621) [-532.679] (-533.640) * (-534.677) [-531.700] (-533.086) (-532.626) -- 0:01:00
      103500 -- (-534.583) (-536.094) [-532.304] (-534.255) * (-532.779) (-533.309) [-533.011] (-532.039) -- 0:01:00
      104000 -- (-533.046) [-533.375] (-532.202) (-539.761) * (-532.499) [-532.712] (-533.761) (-532.664) -- 0:01:00
      104500 -- (-533.816) (-533.986) [-536.158] (-537.670) * (-534.275) (-533.159) (-533.017) [-535.235] -- 0:00:59
      105000 -- (-534.999) [-533.083] (-540.679) (-532.641) * (-533.237) [-532.466] (-538.000) (-534.841) -- 0:00:59

      Average standard deviation of split frequencies: 0.023640

      105500 -- [-536.603] (-533.417) (-533.126) (-535.663) * [-533.529] (-532.499) (-535.547) (-533.873) -- 0:00:59
      106000 -- (-533.797) (-538.329) [-533.600] (-535.180) * (-534.161) (-534.892) [-533.635] (-533.448) -- 0:00:59
      106500 -- [-532.551] (-532.955) (-534.025) (-534.312) * (-532.734) (-534.093) [-537.292] (-535.609) -- 0:00:58
      107000 -- [-536.994] (-532.516) (-533.154) (-535.002) * (-533.959) [-534.930] (-533.266) (-535.400) -- 0:00:58
      107500 -- [-537.230] (-532.544) (-532.549) (-534.381) * [-533.327] (-533.896) (-532.876) (-537.464) -- 0:00:58
      108000 -- (-534.259) (-536.643) (-532.432) [-532.266] * (-533.707) [-532.597] (-534.702) (-537.625) -- 0:00:57
      108500 -- (-534.134) (-535.886) [-532.567] (-534.104) * (-533.806) (-533.880) [-532.762] (-536.381) -- 0:00:57
      109000 -- (-534.152) (-533.107) [-532.708] (-532.678) * (-533.593) (-533.826) [-533.571] (-535.380) -- 0:00:57
      109500 -- [-532.711] (-533.284) (-533.437) (-535.899) * (-534.296) [-535.182] (-534.809) (-532.230) -- 0:00:56
      110000 -- (-532.722) (-533.200) (-534.099) [-533.516] * (-532.486) [-535.887] (-533.163) (-535.043) -- 0:00:56

      Average standard deviation of split frequencies: 0.022195

      110500 -- [-534.117] (-533.342) (-537.096) (-534.904) * [-532.857] (-532.114) (-536.296) (-532.296) -- 0:00:56
      111000 -- (-537.458) [-533.261] (-533.170) (-532.158) * (-533.796) [-532.954] (-534.032) (-533.055) -- 0:00:56
      111500 -- (-534.644) [-531.946] (-532.551) (-533.950) * (-535.492) (-532.555) (-535.416) [-533.605] -- 0:00:55
      112000 -- (-536.374) [-533.545] (-533.844) (-532.755) * (-539.222) (-533.471) [-533.904] (-532.948) -- 0:00:55
      112500 -- (-532.338) [-534.211] (-534.167) (-534.745) * (-533.102) (-533.942) (-533.787) [-533.905] -- 0:00:55
      113000 -- [-531.787] (-538.785) (-533.733) (-535.316) * (-533.893) (-531.610) (-533.452) [-531.783] -- 0:00:54
      113500 -- [-532.525] (-532.812) (-532.545) (-536.353) * (-535.587) (-535.732) (-534.104) [-531.554] -- 0:00:54
      114000 -- [-531.833] (-533.159) (-532.572) (-534.041) * (-533.951) (-536.248) (-533.518) [-533.118] -- 0:00:54
      114500 -- (-539.267) (-532.749) (-535.202) [-534.528] * (-534.545) (-532.296) (-532.063) [-534.038] -- 0:00:54
      115000 -- [-532.417] (-536.683) (-532.434) (-533.418) * [-533.425] (-534.742) (-534.779) (-533.381) -- 0:01:01

      Average standard deviation of split frequencies: 0.024835

      115500 -- [-534.793] (-536.341) (-532.932) (-536.222) * (-531.853) (-531.976) [-535.169] (-537.310) -- 0:01:01
      116000 -- (-532.861) [-532.521] (-534.120) (-533.036) * (-531.698) (-534.245) (-536.052) [-532.419] -- 0:01:00
      116500 -- (-539.852) (-532.992) (-534.487) [-532.301] * [-533.315] (-536.570) (-535.092) (-531.473) -- 0:01:00
      117000 -- (-533.011) (-533.267) (-537.230) [-532.281] * (-532.653) (-538.168) (-532.864) [-535.556] -- 0:01:00
      117500 -- (-532.917) (-532.330) [-536.238] (-533.198) * (-534.967) [-532.742] (-533.824) (-532.508) -- 0:01:00
      118000 -- (-534.583) (-531.810) [-534.052] (-535.932) * (-532.032) (-536.341) [-534.908] (-532.384) -- 0:00:59
      118500 -- [-532.007] (-532.345) (-534.711) (-534.135) * (-532.530) [-535.321] (-537.067) (-532.865) -- 0:00:59
      119000 -- (-533.174) (-533.178) (-534.692) [-533.823] * (-535.552) [-534.056] (-534.976) (-535.176) -- 0:00:59
      119500 -- (-535.925) (-533.117) (-532.476) [-533.529] * (-533.414) (-534.733) (-532.621) [-535.625] -- 0:00:58
      120000 -- (-534.707) [-534.461] (-533.615) (-537.329) * (-533.920) (-533.201) [-534.972] (-532.517) -- 0:00:58

      Average standard deviation of split frequencies: 0.026044

      120500 -- (-533.579) (-534.710) [-531.969] (-534.632) * (-535.481) (-533.175) (-532.582) [-532.311] -- 0:00:58
      121000 -- (-533.056) (-533.232) [-533.453] (-533.602) * (-532.368) (-531.852) (-535.068) [-532.259] -- 0:00:58
      121500 -- (-533.673) [-532.218] (-535.484) (-533.308) * (-532.221) [-533.118] (-535.663) (-533.199) -- 0:00:57
      122000 -- [-534.625] (-532.438) (-532.905) (-537.754) * (-533.826) [-531.868] (-536.644) (-534.853) -- 0:00:57
      122500 -- (-534.434) [-535.125] (-534.966) (-535.946) * [-531.787] (-534.584) (-533.839) (-537.345) -- 0:00:57
      123000 -- [-534.925] (-533.503) (-534.677) (-533.266) * [-532.034] (-534.250) (-534.188) (-532.524) -- 0:00:57
      123500 -- (-532.215) (-532.739) (-533.191) [-532.970] * (-533.487) (-531.949) (-533.035) [-533.344] -- 0:00:56
      124000 -- [-535.831] (-534.845) (-535.808) (-531.705) * (-532.397) (-532.453) (-531.564) [-534.546] -- 0:00:56
      124500 -- (-533.380) [-533.459] (-534.740) (-532.047) * (-532.229) (-534.913) (-532.462) [-533.369] -- 0:00:56
      125000 -- (-532.425) [-532.354] (-534.820) (-531.594) * (-534.908) (-536.806) [-532.607] (-532.938) -- 0:00:56

      Average standard deviation of split frequencies: 0.024506

      125500 -- (-532.632) (-534.638) (-532.923) [-541.242] * (-533.099) [-536.506] (-532.929) (-533.322) -- 0:00:55
      126000 -- (-534.276) [-534.946] (-533.531) (-533.624) * [-532.259] (-534.919) (-534.784) (-533.200) -- 0:00:55
      126500 -- (-534.333) (-533.196) [-532.434] (-533.985) * (-533.041) (-535.303) (-531.956) [-535.301] -- 0:00:55
      127000 -- [-533.046] (-534.119) (-532.596) (-533.423) * (-537.024) [-537.495] (-533.697) (-532.213) -- 0:00:54
      127500 -- (-532.257) [-532.898] (-532.764) (-536.664) * (-541.613) [-533.346] (-532.001) (-532.766) -- 0:00:54
      128000 -- (-532.290) (-537.447) (-535.021) [-535.621] * [-532.076] (-534.354) (-533.673) (-535.099) -- 0:00:54
      128500 -- (-533.911) (-534.117) (-536.923) [-534.595] * (-533.444) (-532.340) [-534.836] (-533.870) -- 0:00:54
      129000 -- (-535.862) [-532.107] (-539.030) (-534.869) * [-533.219] (-533.823) (-534.395) (-542.177) -- 0:00:54
      129500 -- [-534.161] (-533.017) (-536.259) (-535.620) * (-536.089) (-533.607) (-533.682) [-535.503] -- 0:00:53
      130000 -- (-535.171) (-534.986) (-539.746) [-536.327] * (-531.976) (-534.064) (-533.020) [-532.195] -- 0:00:53

      Average standard deviation of split frequencies: 0.025073

      130500 -- [-532.486] (-535.797) (-533.483) (-534.270) * (-533.625) (-535.376) [-533.513] (-534.854) -- 0:00:59
      131000 -- (-532.042) [-532.102] (-537.494) (-533.116) * (-537.413) [-531.692] (-532.571) (-537.374) -- 0:00:59
      131500 -- (-533.123) (-540.042) [-532.916] (-531.947) * (-536.452) [-534.812] (-534.466) (-535.807) -- 0:00:59
      132000 -- (-534.450) [-533.476] (-535.769) (-535.994) * [-533.395] (-537.193) (-535.470) (-533.791) -- 0:00:59
      132500 -- (-533.269) [-533.881] (-539.963) (-535.965) * (-535.271) [-534.102] (-532.290) (-532.512) -- 0:00:58
      133000 -- (-533.496) (-533.606) [-533.205] (-534.005) * [-539.986] (-534.707) (-532.301) (-532.805) -- 0:00:58
      133500 -- [-533.515] (-533.281) (-535.316) (-537.993) * (-538.479) (-534.500) (-536.590) [-533.290] -- 0:00:58
      134000 -- (-533.054) [-532.077] (-536.594) (-536.873) * (-538.379) (-542.811) (-537.604) [-532.776] -- 0:00:58
      134500 -- (-533.680) (-536.400) [-532.430] (-535.343) * (-532.905) (-538.591) (-536.815) [-537.367] -- 0:00:57
      135000 -- (-533.618) (-534.318) (-535.595) [-535.542] * [-533.579] (-532.334) (-534.850) (-532.298) -- 0:00:57

      Average standard deviation of split frequencies: 0.022622

      135500 -- [-532.185] (-534.541) (-532.429) (-534.861) * [-537.680] (-532.732) (-533.719) (-535.911) -- 0:00:57
      136000 -- (-533.209) (-534.914) (-531.718) [-534.387] * (-534.117) (-533.552) (-533.958) [-533.973] -- 0:00:57
      136500 -- (-534.065) (-534.677) [-532.924] (-532.664) * [-532.179] (-536.464) (-534.206) (-534.193) -- 0:00:56
      137000 -- (-533.454) [-533.009] (-532.695) (-535.081) * [-535.122] (-536.408) (-535.250) (-533.601) -- 0:00:56
      137500 -- (-533.014) (-538.080) (-534.094) [-534.122] * (-534.662) [-534.609] (-534.404) (-534.084) -- 0:00:56
      138000 -- (-533.001) (-534.194) (-534.328) [-533.361] * (-534.465) (-533.766) (-536.024) [-535.243] -- 0:00:56
      138500 -- (-535.242) [-533.869] (-534.074) (-533.854) * [-532.373] (-536.762) (-538.095) (-532.859) -- 0:00:55
      139000 -- (-533.843) [-541.004] (-532.394) (-532.134) * [-535.889] (-534.197) (-534.106) (-532.711) -- 0:00:55
      139500 -- (-532.176) [-536.396] (-537.225) (-532.806) * (-534.418) (-537.059) [-533.622] (-533.031) -- 0:00:55
      140000 -- (-533.340) (-535.818) [-537.260] (-534.211) * (-537.737) (-540.244) [-533.223] (-536.458) -- 0:00:55

      Average standard deviation of split frequencies: 0.021518

      140500 -- (-534.169) (-538.369) [-533.040] (-535.482) * (-539.263) [-534.637] (-532.337) (-533.361) -- 0:00:55
      141000 -- (-533.028) (-540.496) [-533.932] (-535.535) * (-532.833) (-535.395) [-533.338] (-534.786) -- 0:00:54
      141500 -- [-532.668] (-535.235) (-533.621) (-534.801) * (-531.965) [-532.218] (-534.907) (-533.156) -- 0:00:54
      142000 -- (-536.137) (-538.534) [-533.730] (-536.902) * (-531.521) (-532.201) [-533.047] (-534.228) -- 0:00:54
      142500 -- (-532.319) [-532.361] (-534.859) (-535.475) * [-532.789] (-531.933) (-536.089) (-535.972) -- 0:00:54
      143000 -- (-532.390) [-534.779] (-534.586) (-532.901) * [-533.012] (-535.777) (-532.170) (-535.056) -- 0:00:53
      143500 -- [-533.527] (-533.025) (-532.133) (-533.239) * (-532.942) (-533.788) [-533.896] (-537.493) -- 0:00:53
      144000 -- (-533.419) (-533.057) (-533.498) [-531.887] * [-538.964] (-533.196) (-533.778) (-539.135) -- 0:00:53
      144500 -- [-532.750] (-535.510) (-535.238) (-532.705) * [-534.914] (-533.308) (-532.945) (-532.824) -- 0:00:53
      145000 -- (-532.461) [-538.522] (-533.815) (-532.130) * (-533.949) [-534.685] (-534.279) (-533.456) -- 0:00:53

      Average standard deviation of split frequencies: 0.020142

      145500 -- (-535.240) [-533.135] (-536.112) (-533.684) * (-533.346) (-536.164) [-532.054] (-532.261) -- 0:00:52
      146000 -- (-534.826) (-536.081) [-534.102] (-533.216) * (-536.020) (-535.496) (-534.381) [-535.562] -- 0:00:52
      146500 -- (-535.836) [-532.435] (-535.387) (-533.143) * [-536.469] (-532.609) (-532.735) (-534.306) -- 0:00:58
      147000 -- (-533.859) [-537.528] (-532.992) (-534.580) * [-536.834] (-534.483) (-534.261) (-531.683) -- 0:00:58
      147500 -- (-534.649) (-532.886) (-534.312) [-533.573] * (-537.337) (-533.199) (-533.429) [-532.286] -- 0:00:57
      148000 -- [-534.505] (-536.263) (-533.383) (-533.188) * (-537.551) (-534.464) (-533.755) [-532.328] -- 0:00:57
      148500 -- [-534.514] (-536.249) (-534.501) (-532.359) * (-536.140) [-533.369] (-536.595) (-535.619) -- 0:00:57
      149000 -- (-533.804) [-533.317] (-542.571) (-531.905) * [-533.323] (-536.233) (-534.058) (-536.501) -- 0:00:57
      149500 -- (-534.040) (-533.642) (-535.582) [-532.950] * [-535.899] (-536.720) (-531.985) (-535.209) -- 0:00:56
      150000 -- [-532.547] (-534.690) (-533.799) (-531.605) * (-537.183) (-538.425) [-532.422] (-533.649) -- 0:00:56

      Average standard deviation of split frequencies: 0.021572

      150500 -- (-540.813) [-533.280] (-532.643) (-532.543) * [-534.695] (-535.095) (-531.891) (-534.339) -- 0:00:56
      151000 -- (-538.190) (-532.197) (-533.080) [-533.978] * (-533.278) [-534.024] (-533.213) (-533.000) -- 0:00:56
      151500 -- (-536.897) (-535.906) [-532.448] (-533.916) * (-533.740) (-535.381) (-533.445) [-532.326] -- 0:00:56
      152000 -- [-534.417] (-533.488) (-535.181) (-534.798) * (-532.588) [-534.404] (-533.435) (-533.082) -- 0:00:55
      152500 -- [-533.299] (-533.510) (-535.460) (-536.065) * [-533.220] (-533.341) (-534.679) (-532.909) -- 0:00:55
      153000 -- (-534.906) (-532.594) (-535.984) [-533.583] * (-534.222) (-533.774) [-533.451] (-534.446) -- 0:00:55
      153500 -- (-532.344) (-534.425) [-533.732] (-540.416) * [-531.964] (-534.167) (-532.929) (-535.931) -- 0:00:55
      154000 -- (-534.041) [-533.731] (-533.772) (-533.943) * (-535.242) [-532.984] (-532.882) (-535.525) -- 0:00:54
      154500 -- (-532.125) (-532.658) [-532.482] (-533.745) * (-538.427) (-532.320) (-532.934) [-535.428] -- 0:00:54
      155000 -- (-531.805) (-531.722) [-532.104] (-535.460) * (-545.104) [-532.110] (-534.770) (-532.572) -- 0:00:54

      Average standard deviation of split frequencies: 0.022042

      155500 -- (-532.815) [-533.043] (-534.130) (-535.400) * (-534.406) (-534.644) [-536.469] (-532.819) -- 0:00:54
      156000 -- [-533.513] (-534.772) (-533.450) (-533.921) * (-536.365) (-535.225) (-535.563) [-534.718] -- 0:00:54
      156500 -- (-533.306) (-533.248) [-534.571] (-534.420) * (-533.409) [-537.262] (-539.245) (-533.993) -- 0:00:53
      157000 -- [-533.293] (-532.781) (-534.360) (-533.499) * (-534.144) [-536.089] (-534.372) (-532.531) -- 0:00:53
      157500 -- (-540.883) (-532.688) (-535.055) [-531.768] * [-533.722] (-532.994) (-534.462) (-533.969) -- 0:00:53
      158000 -- [-533.647] (-533.073) (-533.882) (-545.733) * (-534.242) (-533.889) (-531.987) [-535.177] -- 0:00:53
      158500 -- (-534.514) (-532.418) (-534.924) [-532.885] * (-534.597) (-534.846) [-534.447] (-531.967) -- 0:00:53
      159000 -- (-535.865) (-534.670) (-534.475) [-533.757] * [-532.775] (-534.853) (-532.169) (-534.104) -- 0:00:52
      159500 -- (-532.692) (-532.492) (-534.641) [-531.594] * [-533.143] (-537.201) (-533.426) (-536.453) -- 0:00:52
      160000 -- (-535.809) (-535.045) (-533.279) [-531.594] * (-533.891) [-532.811] (-536.704) (-535.701) -- 0:00:52

      Average standard deviation of split frequencies: 0.022168

      160500 -- (-532.139) (-533.543) [-534.093] (-536.336) * [-536.012] (-532.882) (-534.732) (-533.005) -- 0:00:52
      161000 -- [-531.897] (-538.587) (-534.037) (-533.007) * (-536.607) [-531.899] (-533.934) (-534.273) -- 0:00:52
      161500 -- (-535.234) (-532.872) [-534.449] (-533.693) * [-533.083] (-532.304) (-533.419) (-532.873) -- 0:00:51
      162000 -- (-537.589) (-533.394) [-533.698] (-532.643) * (-532.646) (-533.916) (-540.831) [-534.661] -- 0:00:56
      162500 -- (-536.193) (-537.091) (-531.633) [-536.877] * (-537.445) (-532.917) (-533.214) [-534.957] -- 0:00:56
      163000 -- (-535.177) [-537.999] (-538.821) (-531.756) * (-534.534) (-532.829) [-537.612] (-534.086) -- 0:00:56
      163500 -- [-535.535] (-537.455) (-533.468) (-533.137) * (-536.509) [-534.603] (-535.197) (-532.495) -- 0:00:56
      164000 -- (-532.864) (-534.808) [-532.089] (-535.237) * (-533.016) (-533.929) [-532.625] (-537.390) -- 0:00:56
      164500 -- [-532.538] (-536.530) (-535.775) (-534.403) * [-532.782] (-531.850) (-535.489) (-535.648) -- 0:00:55
      165000 -- [-533.986] (-535.617) (-535.771) (-533.168) * (-533.734) (-533.437) (-536.292) [-533.306] -- 0:00:55

      Average standard deviation of split frequencies: 0.020775

      165500 -- (-534.002) (-535.799) (-532.880) [-533.711] * [-533.946] (-532.796) (-535.092) (-531.591) -- 0:00:55
      166000 -- [-532.152] (-534.291) (-533.315) (-533.171) * [-532.813] (-534.994) (-532.786) (-532.557) -- 0:00:55
      166500 -- (-533.329) (-534.166) [-535.093] (-538.313) * [-533.066] (-533.863) (-535.707) (-532.927) -- 0:00:55
      167000 -- (-531.941) [-533.346] (-535.138) (-533.893) * (-532.618) (-532.127) (-532.317) [-532.851] -- 0:00:54
      167500 -- [-531.974] (-533.873) (-535.452) (-532.127) * (-534.088) (-532.398) [-532.156] (-532.538) -- 0:00:54
      168000 -- [-531.866] (-535.496) (-534.923) (-537.212) * (-535.103) (-535.654) (-536.351) [-537.343] -- 0:00:54
      168500 -- [-532.849] (-536.762) (-534.273) (-535.739) * (-534.368) [-534.948] (-533.312) (-532.174) -- 0:00:54
      169000 -- (-536.295) (-532.755) [-534.064] (-534.338) * [-535.041] (-532.827) (-534.720) (-532.895) -- 0:00:54
      169500 -- (-532.336) (-534.331) (-535.413) [-534.010] * [-535.212] (-535.393) (-537.715) (-534.116) -- 0:00:53
      170000 -- (-533.065) (-533.438) (-534.395) [-531.950] * [-533.379] (-533.216) (-533.888) (-534.024) -- 0:00:53

      Average standard deviation of split frequencies: 0.018875

      170500 -- (-536.185) (-532.017) (-533.060) [-531.885] * (-533.539) [-533.073] (-533.686) (-532.861) -- 0:00:53
      171000 -- (-532.139) (-536.913) [-533.187] (-533.167) * [-534.827] (-534.347) (-533.610) (-535.235) -- 0:00:53
      171500 -- [-533.930] (-535.604) (-537.799) (-533.001) * (-533.854) [-533.522] (-535.209) (-533.705) -- 0:00:53
      172000 -- (-533.754) [-532.378] (-534.881) (-534.481) * (-533.167) (-532.177) (-533.749) [-534.878] -- 0:00:52
      172500 -- (-533.109) (-534.771) (-532.622) [-531.577] * (-533.053) (-533.933) [-532.107] (-535.390) -- 0:00:52
      173000 -- [-535.777] (-536.651) (-535.240) (-533.314) * (-536.764) [-532.555] (-533.103) (-534.206) -- 0:00:52
      173500 -- (-532.268) [-534.358] (-532.911) (-534.065) * [-534.079] (-537.090) (-532.756) (-533.292) -- 0:00:52
      174000 -- (-533.688) [-534.839] (-532.799) (-533.887) * (-533.636) (-533.333) [-532.234] (-538.207) -- 0:00:52
      174500 -- (-536.708) (-532.156) (-536.034) [-532.148] * (-534.843) (-533.982) (-537.743) [-535.064] -- 0:00:52
      175000 -- (-533.836) [-534.592] (-535.565) (-533.834) * (-537.428) [-533.262] (-538.561) (-533.332) -- 0:00:51

      Average standard deviation of split frequencies: 0.018451

      175500 -- (-536.897) (-532.465) [-535.827] (-534.906) * (-532.630) (-532.277) (-532.710) [-532.875] -- 0:00:51
      176000 -- (-540.567) (-534.684) [-535.713] (-533.356) * (-535.055) [-532.583] (-532.552) (-535.795) -- 0:00:51
      176500 -- (-532.871) (-535.022) [-535.991] (-533.927) * (-536.575) [-531.968] (-537.644) (-531.526) -- 0:00:51
      177000 -- (-534.539) (-534.683) (-532.448) [-537.198] * (-534.257) (-537.134) (-533.271) [-532.597] -- 0:00:51
      177500 -- (-534.981) [-533.285] (-533.142) (-533.099) * (-537.488) (-537.770) [-535.043] (-532.579) -- 0:00:50
      178000 -- (-535.050) (-535.582) (-535.194) [-532.116] * (-533.024) [-534.623] (-534.279) (-532.833) -- 0:00:50
      178500 -- (-535.010) (-534.154) (-534.308) [-533.241] * (-534.107) (-533.948) (-539.120) [-531.724] -- 0:00:50
      179000 -- [-535.488] (-532.672) (-534.841) (-532.832) * (-532.917) (-532.665) [-531.927] (-532.090) -- 0:00:55
      179500 -- (-535.524) [-535.051] (-534.050) (-535.191) * (-532.917) (-533.356) (-536.055) [-533.668] -- 0:00:54
      180000 -- (-537.607) (-535.871) [-533.720] (-535.705) * [-533.023] (-532.163) (-535.102) (-535.927) -- 0:00:54

      Average standard deviation of split frequencies: 0.017804

      180500 -- (-532.422) [-532.050] (-532.439) (-533.516) * (-535.020) [-532.450] (-540.923) (-533.921) -- 0:00:54
      181000 -- (-534.161) (-532.545) (-533.288) [-532.086] * (-533.426) [-533.157] (-550.945) (-532.101) -- 0:00:54
      181500 -- [-534.842] (-533.794) (-537.533) (-532.529) * (-533.897) [-533.088] (-537.094) (-534.856) -- 0:00:54
      182000 -- (-532.376) (-536.260) [-535.389] (-532.988) * [-532.968] (-532.928) (-535.306) (-534.994) -- 0:00:53
      182500 -- [-535.693] (-533.267) (-535.931) (-534.389) * (-533.593) [-534.436] (-534.918) (-533.547) -- 0:00:53
      183000 -- (-534.324) [-535.136] (-535.379) (-535.319) * (-534.384) (-535.061) (-534.516) [-535.480] -- 0:00:53
      183500 -- (-533.078) (-532.404) [-534.790] (-538.833) * (-533.850) (-532.425) (-535.575) [-532.933] -- 0:00:53
      184000 -- [-532.858] (-532.393) (-537.667) (-534.502) * (-533.464) (-531.714) (-534.252) [-531.877] -- 0:00:53
      184500 -- (-531.775) [-534.171] (-537.598) (-534.416) * (-533.899) [-534.400] (-531.520) (-536.521) -- 0:00:53
      185000 -- (-535.402) (-538.518) [-534.660] (-532.404) * (-533.230) [-531.876] (-531.652) (-535.827) -- 0:00:52

      Average standard deviation of split frequencies: 0.019994

      185500 -- [-537.843] (-532.697) (-532.760) (-533.267) * (-535.165) [-531.757] (-535.114) (-536.220) -- 0:00:52
      186000 -- (-535.751) [-534.420] (-533.814) (-537.484) * [-535.115] (-531.843) (-533.459) (-532.004) -- 0:00:52
      186500 -- (-536.191) (-535.655) [-533.065] (-533.959) * (-532.544) (-532.351) [-532.948] (-531.625) -- 0:00:52
      187000 -- (-533.225) [-536.751] (-532.033) (-533.284) * (-535.658) (-535.889) (-534.198) [-533.385] -- 0:00:52
      187500 -- (-535.619) (-534.852) (-533.644) [-534.159] * (-534.722) (-531.699) [-534.673] (-537.271) -- 0:00:52
      188000 -- [-533.168] (-535.057) (-534.255) (-533.154) * (-534.658) (-534.687) [-535.267] (-533.555) -- 0:00:51
      188500 -- (-534.381) (-533.114) [-533.415] (-535.778) * [-536.751] (-539.682) (-535.724) (-533.172) -- 0:00:51
      189000 -- (-533.687) (-533.142) [-531.720] (-533.184) * [-533.736] (-533.894) (-535.313) (-535.427) -- 0:00:51
      189500 -- (-533.033) (-534.126) [-532.681] (-534.154) * [-534.705] (-539.993) (-533.577) (-534.229) -- 0:00:51
      190000 -- [-534.914] (-533.483) (-533.063) (-536.137) * (-531.960) (-536.904) (-534.520) [-534.101] -- 0:00:51

      Average standard deviation of split frequencies: 0.019367

      190500 -- [-536.648] (-534.950) (-535.284) (-534.446) * [-534.897] (-533.973) (-533.010) (-535.980) -- 0:00:50
      191000 -- [-536.567] (-534.381) (-533.475) (-534.383) * (-536.775) (-536.722) [-533.093] (-534.640) -- 0:00:50
      191500 -- (-535.967) (-532.480) (-532.453) [-532.742] * (-535.226) (-536.538) [-535.552] (-536.095) -- 0:00:50
      192000 -- (-533.818) (-535.555) [-534.916] (-534.676) * (-533.497) (-533.044) [-536.035] (-535.675) -- 0:00:50
      192500 -- [-534.321] (-533.460) (-533.242) (-534.548) * (-534.525) (-532.428) [-533.383] (-536.815) -- 0:00:50
      193000 -- (-532.382) [-532.924] (-538.642) (-534.407) * (-533.522) (-533.032) (-532.611) [-533.893] -- 0:00:50
      193500 -- (-532.576) (-532.725) [-537.029] (-535.361) * (-534.099) (-537.618) (-533.847) [-532.096] -- 0:00:50
      194000 -- (-541.370) (-532.688) (-535.123) [-531.669] * [-531.578] (-537.499) (-532.879) (-532.724) -- 0:00:49
      194500 -- (-537.749) (-532.634) [-534.937] (-532.399) * (-534.101) [-533.828] (-537.072) (-534.469) -- 0:00:49
      195000 -- (-533.817) (-534.245) [-532.367] (-532.965) * (-533.595) (-532.269) (-533.333) [-532.316] -- 0:00:49

      Average standard deviation of split frequencies: 0.019241

      195500 -- (-533.585) [-533.660] (-533.757) (-532.265) * [-532.488] (-534.657) (-533.088) (-532.723) -- 0:00:53
      196000 -- [-535.064] (-533.105) (-532.582) (-532.769) * [-533.565] (-533.604) (-532.260) (-534.479) -- 0:00:53
      196500 -- [-533.523] (-535.663) (-532.427) (-535.167) * (-534.716) [-533.228] (-533.270) (-534.999) -- 0:00:53
      197000 -- (-533.266) (-533.758) [-532.494] (-533.915) * (-533.305) (-537.097) (-534.291) [-534.137] -- 0:00:52
      197500 -- [-532.047] (-532.629) (-533.843) (-535.254) * (-536.006) (-538.882) [-534.618] (-532.291) -- 0:00:52
      198000 -- (-532.648) (-533.482) (-534.434) [-535.992] * [-534.467] (-535.770) (-535.925) (-534.134) -- 0:00:52
      198500 -- (-532.744) (-532.795) (-531.628) [-533.366] * (-533.615) (-532.788) [-534.827] (-534.012) -- 0:00:52
      199000 -- [-532.440] (-537.085) (-535.498) (-532.040) * (-535.760) (-532.125) (-535.874) [-531.796] -- 0:00:52
      199500 -- (-533.612) (-534.024) [-532.825] (-535.446) * (-533.915) (-532.404) (-534.716) [-531.650] -- 0:00:52
      200000 -- [-533.066] (-541.298) (-537.747) (-534.810) * (-533.284) (-532.321) (-534.491) [-532.996] -- 0:00:51

      Average standard deviation of split frequencies: 0.017273

      200500 -- (-534.026) [-533.295] (-534.786) (-535.009) * (-532.342) [-532.567] (-536.652) (-532.938) -- 0:00:51
      201000 -- (-532.018) [-535.189] (-531.741) (-533.752) * [-536.375] (-534.225) (-533.473) (-533.413) -- 0:00:51
      201500 -- (-534.837) (-534.276) [-531.846] (-534.150) * (-534.906) (-532.268) [-533.094] (-535.462) -- 0:00:51
      202000 -- (-533.698) (-534.565) [-536.296] (-537.235) * (-534.987) [-532.136] (-536.089) (-532.741) -- 0:00:51
      202500 -- [-534.371] (-532.503) (-535.301) (-532.443) * (-537.854) (-531.611) [-533.376] (-534.307) -- 0:00:51
      203000 -- (-535.947) (-533.872) [-534.639] (-532.955) * (-535.746) (-531.675) [-533.134] (-533.708) -- 0:00:51
      203500 -- (-532.646) [-534.340] (-534.212) (-536.881) * (-533.993) [-531.792] (-533.512) (-536.277) -- 0:00:50
      204000 -- (-534.480) (-536.029) [-533.745] (-533.114) * [-534.321] (-533.238) (-536.407) (-532.810) -- 0:00:50
      204500 -- [-532.562] (-536.821) (-535.448) (-531.888) * (-533.772) (-535.974) [-534.023] (-536.514) -- 0:00:50
      205000 -- (-532.623) (-533.517) (-535.040) [-532.511] * (-532.311) (-535.868) [-532.605] (-534.288) -- 0:00:50

      Average standard deviation of split frequencies: 0.017365

      205500 -- (-535.614) (-537.372) (-534.734) [-533.395] * [-533.647] (-533.345) (-532.727) (-532.102) -- 0:00:50
      206000 -- (-531.751) (-534.426) [-532.197] (-533.708) * [-532.806] (-537.298) (-534.971) (-533.091) -- 0:00:50
      206500 -- [-533.071] (-532.879) (-534.826) (-533.938) * [-537.131] (-536.099) (-533.559) (-537.257) -- 0:00:49
      207000 -- [-532.908] (-537.810) (-533.661) (-535.374) * (-537.084) (-532.911) (-532.419) [-538.313] -- 0:00:49
      207500 -- (-533.126) [-533.544] (-532.880) (-537.067) * (-537.048) [-533.411] (-534.388) (-537.591) -- 0:00:49
      208000 -- (-533.166) (-532.612) [-534.086] (-535.928) * (-534.314) [-533.153] (-535.711) (-532.767) -- 0:00:49
      208500 -- (-535.053) (-532.094) (-537.190) [-534.117] * (-535.816) (-533.019) [-535.455] (-534.236) -- 0:00:49
      209000 -- (-537.658) [-533.401] (-533.070) (-531.995) * (-535.369) (-533.857) [-531.801] (-534.098) -- 0:00:49
      209500 -- (-532.701) [-538.692] (-531.719) (-533.243) * (-533.162) (-533.454) (-533.159) [-532.799] -- 0:00:49
      210000 -- (-535.236) (-535.697) (-531.877) [-532.639] * (-536.062) (-533.998) [-533.522] (-532.788) -- 0:00:48

      Average standard deviation of split frequencies: 0.018560

      210500 -- (-533.794) (-533.476) (-532.185) [-535.207] * (-534.653) [-535.360] (-536.234) (-533.166) -- 0:00:48
      211000 -- (-533.535) (-536.856) (-532.527) [-534.938] * [-547.983] (-533.561) (-535.568) (-535.369) -- 0:00:48
      211500 -- [-533.548] (-534.737) (-533.697) (-534.793) * [-531.905] (-533.814) (-533.616) (-534.565) -- 0:00:48
      212000 -- (-539.346) (-534.782) [-532.924] (-534.461) * (-531.984) (-534.822) [-538.269] (-536.509) -- 0:00:52
      212500 -- (-531.981) (-536.725) (-535.372) [-533.874] * (-534.078) (-536.508) [-533.474] (-537.611) -- 0:00:51
      213000 -- [-531.649] (-537.309) (-533.190) (-532.587) * (-533.607) [-535.242] (-535.592) (-534.905) -- 0:00:51
      213500 -- [-533.843] (-533.328) (-536.044) (-534.665) * [-534.650] (-533.420) (-534.166) (-536.406) -- 0:00:51
      214000 -- (-532.521) (-535.230) [-532.243] (-532.861) * (-533.665) (-535.702) [-533.943] (-534.687) -- 0:00:51
      214500 -- (-538.226) (-535.817) (-532.907) [-532.558] * (-538.133) (-532.889) (-533.010) [-531.834] -- 0:00:51
      215000 -- (-536.686) (-532.618) [-533.081] (-538.006) * (-536.628) [-534.395] (-535.145) (-533.786) -- 0:00:51

      Average standard deviation of split frequencies: 0.019096

      215500 -- (-538.246) [-533.760] (-533.392) (-539.391) * (-536.373) (-532.180) (-535.385) [-533.528] -- 0:00:50
      216000 -- [-534.877] (-536.827) (-537.040) (-535.736) * (-534.332) [-534.165] (-532.702) (-534.497) -- 0:00:50
      216500 -- (-534.617) (-535.822) (-535.091) [-533.738] * (-535.015) (-532.270) [-534.458] (-535.702) -- 0:00:50
      217000 -- (-542.159) [-532.285] (-533.079) (-532.444) * [-532.421] (-533.759) (-533.491) (-533.660) -- 0:00:50
      217500 -- (-535.127) (-533.398) (-534.381) [-536.263] * (-533.722) [-533.717] (-536.057) (-534.941) -- 0:00:50
      218000 -- (-534.350) (-533.733) [-533.187] (-532.576) * (-531.879) [-533.655] (-533.909) (-535.003) -- 0:00:50
      218500 -- (-537.899) (-532.368) [-537.473] (-532.823) * [-534.904] (-532.267) (-532.232) (-533.090) -- 0:00:50
      219000 -- (-533.035) (-532.876) [-536.089] (-532.585) * (-538.432) (-534.393) (-532.776) [-532.578] -- 0:00:49
      219500 -- (-533.818) [-534.771] (-535.065) (-533.901) * (-537.871) (-533.697) (-535.398) [-531.789] -- 0:00:49
      220000 -- [-536.191] (-535.269) (-534.767) (-534.034) * (-537.880) [-535.068] (-534.881) (-531.673) -- 0:00:49

      Average standard deviation of split frequencies: 0.016823

      220500 -- (-536.613) [-533.197] (-532.387) (-534.732) * (-533.167) [-532.774] (-536.387) (-534.946) -- 0:00:49
      221000 -- (-534.667) (-536.335) [-532.373] (-534.241) * (-533.219) (-532.986) (-541.780) [-537.500] -- 0:00:49
      221500 -- [-534.614] (-536.578) (-533.369) (-537.527) * (-532.659) [-532.464] (-534.476) (-532.918) -- 0:00:49
      222000 -- (-537.862) (-535.713) [-532.266] (-537.768) * [-533.746] (-533.736) (-537.243) (-532.413) -- 0:00:49
      222500 -- (-536.039) (-535.624) [-532.242] (-532.617) * (-535.232) [-534.328] (-533.959) (-533.303) -- 0:00:48
      223000 -- (-534.506) (-533.377) (-533.793) [-533.206] * (-535.586) (-532.109) [-534.211] (-535.745) -- 0:00:48
      223500 -- (-534.719) (-533.325) [-534.685] (-537.449) * (-533.497) [-531.727] (-533.675) (-535.001) -- 0:00:48
      224000 -- (-532.802) (-534.506) [-532.627] (-538.070) * (-535.253) (-531.566) [-533.205] (-540.916) -- 0:00:48
      224500 -- (-532.985) (-536.129) (-538.886) [-533.921] * [-533.130] (-533.085) (-531.983) (-533.433) -- 0:00:48
      225000 -- (-531.634) [-532.951] (-535.328) (-535.852) * [-532.888] (-535.160) (-531.810) (-535.830) -- 0:00:48

      Average standard deviation of split frequencies: 0.016687

      225500 -- (-532.092) (-535.252) (-533.108) [-533.655] * (-535.611) (-532.761) [-534.854] (-532.891) -- 0:00:48
      226000 -- (-533.297) (-535.100) (-531.741) [-532.904] * (-533.803) (-534.998) (-534.488) [-536.385] -- 0:00:47
      226500 -- (-536.021) (-535.322) [-534.078] (-536.274) * (-532.951) (-534.389) [-536.251] (-537.157) -- 0:00:47
      227000 -- (-533.898) (-534.618) [-532.545] (-533.465) * [-532.214] (-537.033) (-534.106) (-537.218) -- 0:00:47
      227500 -- (-537.804) [-537.533] (-536.878) (-534.191) * (-534.100) (-533.253) [-532.793] (-536.782) -- 0:00:47
      228000 -- (-536.436) (-533.026) (-534.498) [-534.324] * (-533.676) [-533.558] (-538.499) (-535.173) -- 0:00:50
      228500 -- (-536.335) (-533.451) [-534.390] (-534.064) * [-536.743] (-533.859) (-534.958) (-537.048) -- 0:00:50
      229000 -- (-537.521) (-537.402) (-533.726) [-535.323] * [-531.585] (-534.370) (-532.986) (-533.882) -- 0:00:50
      229500 -- [-532.426] (-533.790) (-538.629) (-534.992) * (-532.964) [-532.993] (-534.041) (-536.401) -- 0:00:50
      230000 -- (-534.059) (-532.270) [-536.351] (-532.744) * (-533.529) (-532.458) [-535.434] (-536.553) -- 0:00:50

      Average standard deviation of split frequencies: 0.016894

      230500 -- (-539.685) (-535.839) (-533.040) [-533.385] * (-533.229) [-533.203] (-537.245) (-537.079) -- 0:00:50
      231000 -- (-532.965) [-533.567] (-532.037) (-532.909) * (-534.008) (-533.843) (-535.265) [-533.223] -- 0:00:49
      231500 -- (-533.649) (-532.542) (-538.109) [-532.873] * (-533.688) (-533.888) [-534.127] (-532.879) -- 0:00:49
      232000 -- (-532.803) [-532.360] (-533.874) (-533.365) * (-532.154) [-534.313] (-534.011) (-532.673) -- 0:00:49
      232500 -- (-532.353) [-533.883] (-533.086) (-533.497) * (-535.804) (-536.075) [-533.129] (-534.177) -- 0:00:49
      233000 -- (-533.784) [-533.515] (-533.163) (-534.791) * (-533.159) [-532.867] (-534.424) (-532.807) -- 0:00:49
      233500 -- (-533.254) (-534.647) [-533.199] (-535.858) * (-534.015) (-535.158) [-533.041] (-532.558) -- 0:00:49
      234000 -- [-533.195] (-539.055) (-533.077) (-535.317) * [-536.185] (-534.231) (-533.328) (-533.609) -- 0:00:49
      234500 -- (-538.042) [-541.210] (-533.800) (-532.349) * [-535.646] (-532.338) (-534.933) (-534.612) -- 0:00:48
      235000 -- [-533.517] (-535.362) (-532.627) (-534.441) * (-535.711) (-532.972) [-532.750] (-536.177) -- 0:00:48

      Average standard deviation of split frequencies: 0.016479

      235500 -- [-531.787] (-532.743) (-541.023) (-535.074) * (-533.632) (-533.502) (-535.187) [-532.004] -- 0:00:48
      236000 -- (-531.798) (-532.662) (-536.897) [-535.869] * (-534.633) (-532.775) (-532.253) [-535.278] -- 0:00:48
      236500 -- (-533.869) [-532.014] (-535.237) (-535.344) * (-531.761) (-533.146) (-535.975) [-533.165] -- 0:00:48
      237000 -- (-533.013) [-531.952] (-536.062) (-533.922) * (-532.071) [-533.740] (-533.948) (-539.566) -- 0:00:48
      237500 -- (-532.823) (-535.606) (-536.334) [-532.807] * (-532.531) [-532.279] (-535.840) (-532.968) -- 0:00:48
      238000 -- (-532.684) [-537.190] (-532.914) (-535.088) * (-534.833) [-532.488] (-534.094) (-535.106) -- 0:00:48
      238500 -- (-532.481) (-534.146) [-532.938] (-532.301) * (-536.383) (-532.306) [-532.819] (-534.389) -- 0:00:47
      239000 -- (-532.876) [-533.094] (-535.978) (-532.094) * (-535.518) (-532.197) [-536.752] (-534.525) -- 0:00:47
      239500 -- [-531.545] (-533.105) (-534.639) (-533.085) * (-533.384) (-532.910) (-532.513) [-533.617] -- 0:00:47
      240000 -- (-533.919) [-535.044] (-533.073) (-532.653) * (-535.601) [-534.472] (-533.971) (-535.033) -- 0:00:47

      Average standard deviation of split frequencies: 0.016361

      240500 -- (-533.823) (-535.370) [-533.386] (-531.877) * (-533.793) (-535.229) [-531.902] (-534.071) -- 0:00:47
      241000 -- [-535.078] (-533.100) (-534.031) (-532.849) * (-534.056) (-532.727) (-532.693) [-534.207] -- 0:00:47
      241500 -- [-533.145] (-534.622) (-537.053) (-539.070) * (-533.874) (-534.039) [-534.023] (-532.570) -- 0:00:47
      242000 -- (-535.103) [-532.376] (-533.446) (-540.991) * (-533.845) (-533.044) [-532.781] (-534.058) -- 0:00:46
      242500 -- [-532.316] (-536.908) (-533.834) (-534.287) * (-536.070) (-533.238) [-531.562] (-533.074) -- 0:00:46
      243000 -- (-533.445) [-533.680] (-532.869) (-531.978) * (-533.955) (-534.625) (-531.776) [-533.338] -- 0:00:46
      243500 -- [-531.751] (-535.179) (-536.339) (-533.410) * (-533.304) (-531.884) (-532.073) [-533.210] -- 0:00:46
      244000 -- (-531.748) (-532.859) [-532.122] (-532.073) * (-532.264) (-534.940) (-535.872) [-534.573] -- 0:00:49
      244500 -- (-532.580) [-532.939] (-534.567) (-533.057) * (-531.650) (-542.129) [-534.105] (-537.221) -- 0:00:49
      245000 -- (-533.723) (-533.926) [-532.074] (-532.844) * [-532.453] (-538.638) (-534.572) (-533.519) -- 0:00:49

      Average standard deviation of split frequencies: 0.016683

      245500 -- (-537.091) [-535.929] (-533.983) (-536.935) * [-536.615] (-534.980) (-534.965) (-531.677) -- 0:00:49
      246000 -- (-539.654) (-536.206) (-532.668) [-532.590] * (-533.681) (-532.492) [-536.648] (-536.945) -- 0:00:49
      246500 -- (-534.003) (-536.795) [-533.816] (-531.967) * (-535.082) (-534.705) [-532.243] (-535.935) -- 0:00:48
      247000 -- (-531.935) [-533.942] (-534.478) (-532.853) * (-531.806) (-533.383) (-532.340) [-531.832] -- 0:00:48
      247500 -- (-534.083) (-532.406) (-534.523) [-533.124] * (-531.967) (-534.230) (-533.495) [-532.912] -- 0:00:48
      248000 -- [-531.980] (-533.833) (-533.979) (-533.285) * [-532.190] (-533.424) (-536.648) (-532.431) -- 0:00:48
      248500 -- (-532.823) (-535.307) (-534.883) [-533.790] * [-532.270] (-533.648) (-535.301) (-532.502) -- 0:00:48
      249000 -- (-535.566) [-535.424] (-533.037) (-538.052) * (-531.965) (-541.841) [-535.003] (-532.779) -- 0:00:48
      249500 -- [-534.631] (-534.640) (-532.013) (-534.944) * (-533.252) [-537.339] (-533.414) (-534.331) -- 0:00:48
      250000 -- (-531.928) (-535.994) [-532.584] (-537.759) * [-537.251] (-533.145) (-534.079) (-536.230) -- 0:00:48

      Average standard deviation of split frequencies: 0.016262

      250500 -- (-532.099) (-531.760) (-532.098) [-534.255] * (-534.320) (-533.739) [-532.699] (-533.863) -- 0:00:47
      251000 -- (-532.710) (-532.221) [-534.313] (-532.897) * (-533.051) (-531.740) [-535.437] (-531.721) -- 0:00:47
      251500 -- [-534.232] (-532.308) (-534.152) (-533.124) * (-534.317) [-532.600] (-536.402) (-532.583) -- 0:00:47
      252000 -- (-532.198) [-533.183] (-532.353) (-532.666) * (-532.972) (-533.829) [-533.042] (-534.618) -- 0:00:47
      252500 -- (-535.627) (-532.945) (-532.696) [-532.820] * (-532.750) (-536.744) (-533.032) [-536.062] -- 0:00:47
      253000 -- [-532.855] (-533.143) (-532.849) (-534.210) * (-536.928) (-535.332) (-533.445) [-532.148] -- 0:00:47
      253500 -- (-532.177) (-532.682) (-534.461) [-535.026] * [-531.921] (-535.672) (-536.224) (-534.041) -- 0:00:47
      254000 -- (-534.079) [-533.918] (-537.306) (-533.319) * (-531.842) [-533.555] (-531.837) (-536.770) -- 0:00:46
      254500 -- [-534.258] (-535.105) (-534.039) (-535.042) * (-533.796) (-536.607) [-535.493] (-531.933) -- 0:00:46
      255000 -- (-534.311) (-538.767) (-535.142) [-532.887] * (-534.203) (-535.035) (-535.639) [-536.448] -- 0:00:46

      Average standard deviation of split frequencies: 0.015381

      255500 -- (-534.712) (-534.596) (-532.877) [-533.681] * [-534.513] (-531.579) (-533.248) (-536.087) -- 0:00:46
      256000 -- [-533.647] (-533.845) (-531.668) (-533.785) * (-533.667) (-536.597) [-533.039] (-533.596) -- 0:00:46
      256500 -- (-533.667) [-533.015] (-543.831) (-537.192) * (-535.470) [-535.624] (-534.295) (-533.434) -- 0:00:46
      257000 -- (-535.652) [-533.023] (-534.242) (-534.858) * (-537.351) (-536.093) [-531.869] (-532.144) -- 0:00:49
      257500 -- (-531.946) (-534.165) [-532.391] (-536.670) * (-539.078) [-534.881] (-534.982) (-537.186) -- 0:00:49
      258000 -- (-532.356) [-534.133] (-533.415) (-532.620) * (-534.498) (-535.430) (-532.412) [-534.303] -- 0:00:48
      258500 -- (-533.792) (-535.811) [-533.264] (-532.563) * [-533.121] (-538.159) (-532.383) (-533.391) -- 0:00:48
      259000 -- (-535.055) (-535.260) [-536.403] (-533.408) * (-536.247) (-535.450) (-535.464) [-534.285] -- 0:00:48
      259500 -- (-533.264) [-536.006] (-534.092) (-537.043) * (-533.831) (-533.596) (-533.234) [-536.420] -- 0:00:48
      260000 -- (-532.911) [-533.459] (-532.399) (-533.028) * [-534.771] (-537.177) (-533.604) (-535.023) -- 0:00:48

      Average standard deviation of split frequencies: 0.016382

      260500 -- (-534.597) [-531.731] (-533.143) (-533.659) * (-537.141) [-534.738] (-534.760) (-532.063) -- 0:00:48
      261000 -- (-533.769) [-533.210] (-532.806) (-534.867) * (-537.088) (-534.491) [-535.617] (-532.349) -- 0:00:48
      261500 -- (-533.383) (-533.400) [-533.855] (-534.832) * (-536.556) (-533.283) (-534.725) [-533.384] -- 0:00:48
      262000 -- [-532.963] (-532.831) (-535.112) (-536.463) * (-533.628) (-532.134) [-536.091] (-534.416) -- 0:00:47
      262500 -- (-533.199) [-534.433] (-536.414) (-536.332) * (-532.754) (-534.236) (-532.607) [-536.935] -- 0:00:47
      263000 -- (-535.708) [-534.542] (-537.596) (-533.424) * (-531.663) (-533.432) [-535.059] (-534.960) -- 0:00:47
      263500 -- [-533.291] (-533.996) (-534.908) (-533.797) * (-537.751) [-533.309] (-532.237) (-537.632) -- 0:00:47
      264000 -- (-533.125) [-533.419] (-535.484) (-533.868) * (-535.805) (-534.651) (-531.787) [-534.337] -- 0:00:47
      264500 -- [-534.377] (-536.512) (-533.836) (-532.829) * [-533.248] (-536.515) (-532.429) (-533.762) -- 0:00:47
      265000 -- (-534.467) (-532.087) [-534.127] (-534.343) * (-535.406) (-532.850) [-535.141] (-535.123) -- 0:00:47

      Average standard deviation of split frequencies: 0.016245

      265500 -- (-534.161) [-534.113] (-534.856) (-534.155) * (-532.242) (-533.014) [-532.527] (-533.210) -- 0:00:47
      266000 -- (-532.325) [-534.287] (-532.261) (-535.129) * (-534.369) (-533.449) (-532.889) [-533.496] -- 0:00:46
      266500 -- (-532.472) (-535.609) (-534.256) [-532.206] * (-532.676) (-533.531) [-535.137] (-535.747) -- 0:00:46
      267000 -- [-533.099] (-532.095) (-538.326) (-538.124) * (-532.341) [-532.548] (-535.295) (-535.104) -- 0:00:46
      267500 -- (-533.126) (-532.632) [-532.013] (-534.497) * (-534.091) (-533.134) [-533.734] (-533.618) -- 0:00:46
      268000 -- [-534.402] (-536.039) (-534.374) (-535.444) * (-535.190) (-532.999) (-538.463) [-532.717] -- 0:00:46
      268500 -- (-534.422) (-537.226) (-536.352) [-535.846] * (-536.193) (-534.357) (-534.261) [-532.563] -- 0:00:46
      269000 -- (-534.647) (-534.050) (-537.926) [-535.900] * (-536.123) (-533.637) (-533.598) [-533.628] -- 0:00:46
      269500 -- (-535.422) (-534.693) [-533.295] (-533.036) * [-536.608] (-534.809) (-536.082) (-533.714) -- 0:00:46
      270000 -- (-532.935) (-534.170) [-532.969] (-533.214) * (-532.617) [-536.145] (-535.073) (-534.230) -- 0:00:45

      Average standard deviation of split frequencies: 0.016802

      270500 -- (-532.921) [-532.558] (-534.875) (-533.303) * (-532.037) [-531.965] (-534.162) (-533.521) -- 0:00:45
      271000 -- (-537.702) (-533.857) [-533.244] (-537.380) * (-534.136) [-531.991] (-534.443) (-532.232) -- 0:00:45
      271500 -- (-536.650) (-534.472) [-532.232] (-540.023) * (-535.336) [-532.316] (-533.314) (-533.192) -- 0:00:45
      272000 -- (-532.326) [-535.101] (-533.892) (-537.835) * (-533.960) [-531.839] (-532.797) (-532.706) -- 0:00:45
      272500 -- (-533.579) [-533.764] (-536.978) (-535.531) * (-533.016) (-536.457) (-533.457) [-538.122] -- 0:00:48
      273000 -- [-532.517] (-535.575) (-535.574) (-534.862) * (-534.465) [-532.777] (-534.545) (-536.371) -- 0:00:47
      273500 -- (-532.772) (-535.777) [-533.604] (-534.851) * (-532.779) [-534.514] (-535.297) (-534.702) -- 0:00:47
      274000 -- (-534.024) (-532.101) [-532.962] (-537.221) * (-533.449) (-534.640) [-533.100] (-532.379) -- 0:00:47
      274500 -- [-534.102] (-535.801) (-535.251) (-532.751) * (-535.892) (-534.453) (-533.160) [-532.340] -- 0:00:47
      275000 -- (-536.456) (-533.022) (-531.870) [-534.743] * [-534.750] (-534.962) (-534.398) (-534.314) -- 0:00:47

      Average standard deviation of split frequencies: 0.014613

      275500 -- (-538.775) [-534.929] (-533.725) (-532.640) * [-533.244] (-532.355) (-532.450) (-536.716) -- 0:00:47
      276000 -- (-538.351) (-532.221) [-535.099] (-534.017) * (-532.149) (-536.987) (-533.301) [-533.759] -- 0:00:47
      276500 -- (-532.317) [-534.376] (-532.699) (-534.201) * (-536.526) (-533.540) (-533.010) [-533.016] -- 0:00:47
      277000 -- (-533.356) [-534.105] (-534.281) (-536.221) * (-534.279) (-533.715) [-531.946] (-533.001) -- 0:00:46
      277500 -- (-531.976) [-535.246] (-533.047) (-532.610) * [-533.656] (-533.971) (-533.604) (-537.055) -- 0:00:46
      278000 -- (-532.055) (-533.931) (-536.486) [-532.932] * (-535.447) (-534.773) [-532.418] (-535.852) -- 0:00:46
      278500 -- (-533.229) (-533.201) (-533.922) [-532.299] * [-532.359] (-534.721) (-534.044) (-534.584) -- 0:00:46
      279000 -- (-532.183) [-534.350] (-533.461) (-532.939) * [-533.318] (-533.152) (-532.218) (-532.520) -- 0:00:46
      279500 -- (-536.996) (-533.902) [-533.277] (-532.468) * (-532.437) [-532.967] (-534.502) (-537.749) -- 0:00:46
      280000 -- (-534.596) (-538.189) (-534.232) [-532.671] * [-532.046] (-536.568) (-532.475) (-535.068) -- 0:00:46

      Average standard deviation of split frequencies: 0.014463

      280500 -- (-533.428) [-533.477] (-531.737) (-532.547) * (-532.435) (-535.063) (-533.892) [-534.666] -- 0:00:46
      281000 -- [-537.025] (-534.563) (-533.006) (-531.836) * (-531.629) (-534.096) [-535.120] (-532.516) -- 0:00:46
      281500 -- (-535.231) (-534.988) (-535.759) [-532.173] * [-532.418] (-533.095) (-533.428) (-532.516) -- 0:00:45
      282000 -- (-533.487) (-534.794) [-533.752] (-533.073) * [-534.513] (-534.396) (-536.970) (-533.158) -- 0:00:45
      282500 -- [-533.188] (-534.837) (-533.885) (-533.877) * (-534.082) [-532.914] (-531.839) (-531.976) -- 0:00:45
      283000 -- (-534.476) [-532.270] (-536.102) (-534.595) * (-535.081) (-534.967) [-533.636] (-533.926) -- 0:00:45
      283500 -- (-532.061) (-534.015) [-533.597] (-536.401) * (-537.437) (-534.875) (-532.237) [-534.607] -- 0:00:45
      284000 -- (-532.929) [-533.452] (-532.302) (-534.182) * (-534.227) (-535.976) (-532.127) [-534.240] -- 0:00:45
      284500 -- (-536.795) (-536.030) [-532.653] (-532.234) * [-532.784] (-532.357) (-532.197) (-532.768) -- 0:00:45
      285000 -- (-532.791) (-535.740) [-533.925] (-532.553) * (-532.463) [-533.964] (-534.763) (-533.042) -- 0:00:45

      Average standard deviation of split frequencies: 0.014834

      285500 -- (-534.009) [-533.702] (-536.839) (-533.033) * (-532.088) [-533.412] (-536.660) (-532.851) -- 0:00:45
      286000 -- (-532.393) (-533.731) [-532.450] (-535.731) * (-533.410) [-532.088] (-533.520) (-534.318) -- 0:00:44
      286500 -- [-532.362] (-534.555) (-535.451) (-535.212) * (-533.007) [-535.630] (-532.940) (-535.859) -- 0:00:44
      287000 -- (-532.130) (-532.365) [-534.575] (-533.339) * (-533.377) [-538.165] (-533.713) (-534.710) -- 0:00:47
      287500 -- [-535.487] (-533.154) (-532.532) (-533.091) * (-534.912) (-531.933) [-532.974] (-532.593) -- 0:00:47
      288000 -- (-534.812) (-538.708) (-532.747) [-532.559] * (-533.394) (-531.712) (-535.151) [-531.885] -- 0:00:46
      288500 -- (-537.114) (-532.297) (-533.567) [-535.193] * (-534.362) [-532.516] (-534.996) (-534.561) -- 0:00:46
      289000 -- (-534.242) (-534.682) [-534.682] (-533.817) * (-532.631) [-534.031] (-532.478) (-534.342) -- 0:00:46
      289500 -- (-534.433) (-533.069) (-533.564) [-534.211] * (-532.854) (-533.204) (-533.658) [-533.538] -- 0:00:46
      290000 -- (-535.869) (-532.459) [-534.066] (-535.764) * (-535.659) (-532.786) [-535.666] (-535.448) -- 0:00:46

      Average standard deviation of split frequencies: 0.014056

      290500 -- (-534.004) [-533.602] (-534.533) (-532.164) * (-533.031) (-532.606) (-533.240) [-533.361] -- 0:00:46
      291000 -- (-533.982) (-534.847) [-539.382] (-532.077) * (-533.209) (-534.543) [-535.873] (-533.777) -- 0:00:46
      291500 -- (-534.153) [-532.432] (-536.876) (-532.047) * (-532.431) (-533.240) (-534.171) [-536.057] -- 0:00:46
      292000 -- (-535.101) [-536.666] (-535.154) (-532.105) * (-533.367) (-532.391) [-534.171] (-534.091) -- 0:00:46
      292500 -- (-535.992) (-536.175) (-534.132) [-531.844] * [-534.099] (-531.795) (-534.253) (-533.808) -- 0:00:45
      293000 -- (-536.620) [-533.958] (-536.233) (-533.155) * (-533.771) (-536.511) (-536.981) [-537.521] -- 0:00:45
      293500 -- (-534.249) [-533.824] (-531.975) (-533.907) * (-533.724) (-535.096) [-534.310] (-533.283) -- 0:00:45
      294000 -- [-535.666] (-533.750) (-537.471) (-535.890) * (-533.224) [-535.751] (-534.388) (-532.951) -- 0:00:45
      294500 -- (-532.677) [-531.903] (-533.216) (-532.387) * (-539.195) (-535.709) [-536.247] (-532.718) -- 0:00:45
      295000 -- [-536.882] (-534.428) (-531.937) (-532.651) * (-536.656) (-533.872) [-532.518] (-534.649) -- 0:00:45

      Average standard deviation of split frequencies: 0.013979

      295500 -- (-534.152) (-533.906) [-535.676] (-533.910) * (-533.297) [-532.039] (-532.498) (-535.572) -- 0:00:45
      296000 -- (-532.464) (-533.511) (-536.332) [-536.702] * (-532.901) (-532.046) (-534.256) [-534.181] -- 0:00:45
      296500 -- [-531.502] (-538.450) (-534.627) (-535.123) * [-533.636] (-532.646) (-533.499) (-535.941) -- 0:00:45
      297000 -- (-533.930) (-540.613) [-535.245] (-533.096) * (-534.117) (-533.709) (-539.879) [-532.754] -- 0:00:44
      297500 -- [-532.951] (-535.166) (-537.247) (-533.780) * (-531.733) (-533.621) [-534.040] (-533.373) -- 0:00:44
      298000 -- (-536.977) (-537.084) [-533.573] (-533.689) * [-532.408] (-534.249) (-534.045) (-533.444) -- 0:00:44
      298500 -- (-533.496) (-540.796) [-533.324] (-534.854) * (-533.582) (-533.901) [-536.551] (-532.038) -- 0:00:44
      299000 -- (-533.326) (-535.810) (-533.260) [-533.100] * (-534.880) (-534.944) (-536.065) [-532.396] -- 0:00:44
      299500 -- (-532.558) (-533.049) [-534.478] (-533.431) * (-534.166) (-532.973) (-531.742) [-535.690] -- 0:00:44
      300000 -- [-532.869] (-532.606) (-536.970) (-533.677) * (-532.104) (-532.965) [-534.458] (-534.114) -- 0:00:44

      Average standard deviation of split frequencies: 0.014849

      300500 -- (-532.801) [-533.661] (-536.498) (-533.759) * (-533.032) [-538.305] (-535.079) (-535.000) -- 0:00:44
      301000 -- [-532.367] (-534.550) (-536.028) (-531.854) * (-531.911) [-533.006] (-536.815) (-533.036) -- 0:00:44
      301500 -- (-533.699) [-535.612] (-535.730) (-533.621) * (-533.397) (-535.042) (-533.876) [-533.343] -- 0:00:44
      302000 -- (-533.692) [-534.837] (-533.216) (-535.387) * (-531.749) (-534.353) (-535.127) [-533.387] -- 0:00:43
      302500 -- (-533.376) [-533.383] (-533.168) (-533.611) * (-535.212) [-535.507] (-532.762) (-534.825) -- 0:00:43
      303000 -- [-531.859] (-536.442) (-534.643) (-532.553) * (-533.469) (-533.188) [-532.435] (-533.532) -- 0:00:46
      303500 -- (-531.911) (-533.571) (-534.818) [-532.524] * (-538.055) (-532.551) [-531.716] (-535.046) -- 0:00:45
      304000 -- (-536.912) (-538.370) [-534.218] (-532.166) * (-533.988) (-536.458) [-532.996] (-536.420) -- 0:00:45
      304500 -- (-541.726) (-532.427) (-538.097) [-533.678] * (-535.202) [-533.093] (-533.713) (-539.023) -- 0:00:45
      305000 -- (-532.481) (-534.990) (-533.319) [-534.206] * (-532.411) (-533.371) [-533.058] (-535.498) -- 0:00:45

      Average standard deviation of split frequencies: 0.013266

      305500 -- (-532.821) (-539.124) (-533.981) [-538.368] * (-532.211) (-534.387) (-538.704) [-533.977] -- 0:00:45
      306000 -- [-533.934] (-538.334) (-534.544) (-534.693) * (-532.807) (-532.512) [-531.973] (-532.589) -- 0:00:45
      306500 -- (-535.390) (-541.140) [-537.110] (-534.473) * (-535.167) [-536.192] (-533.305) (-534.094) -- 0:00:45
      307000 -- (-535.167) (-536.774) (-543.154) [-533.107] * (-533.366) (-533.814) [-533.239] (-534.732) -- 0:00:45
      307500 -- (-536.006) [-533.262] (-535.030) (-537.761) * [-531.875] (-533.089) (-533.845) (-532.903) -- 0:00:45
      308000 -- (-536.338) (-536.317) [-534.427] (-532.117) * (-532.569) (-534.465) [-534.517] (-536.228) -- 0:00:44
      308500 -- (-535.191) (-534.895) (-534.831) [-534.963] * (-533.477) (-538.509) [-535.867] (-536.054) -- 0:00:44
      309000 -- (-533.124) [-540.018] (-533.125) (-533.977) * [-532.904] (-535.748) (-532.506) (-532.351) -- 0:00:44
      309500 -- [-532.439] (-535.177) (-531.935) (-535.214) * (-533.243) (-534.037) [-531.748] (-531.752) -- 0:00:44
      310000 -- (-534.762) [-537.307] (-533.615) (-535.471) * [-537.101] (-534.897) (-532.366) (-531.667) -- 0:00:44

      Average standard deviation of split frequencies: 0.011949

      310500 -- (-532.944) (-539.133) [-532.662] (-534.097) * [-535.165] (-536.600) (-534.809) (-536.541) -- 0:00:44
      311000 -- (-534.818) (-534.936) (-534.839) [-533.680] * (-538.120) (-533.010) [-534.788] (-534.379) -- 0:00:44
      311500 -- (-533.074) (-534.978) [-533.384] (-534.242) * (-534.771) [-534.603] (-533.852) (-532.755) -- 0:00:44
      312000 -- (-536.206) (-532.965) (-534.972) [-534.662] * (-537.110) (-535.125) [-533.813] (-534.211) -- 0:00:44
      312500 -- (-536.012) (-533.766) [-533.968] (-533.785) * [-532.257] (-534.011) (-533.658) (-532.170) -- 0:00:44
      313000 -- (-534.996) [-534.018] (-533.170) (-534.302) * (-534.266) [-534.570] (-534.279) (-535.119) -- 0:00:43
      313500 -- (-536.540) (-533.104) (-534.575) [-534.172] * [-532.703] (-536.314) (-533.193) (-532.704) -- 0:00:43
      314000 -- (-535.080) [-534.997] (-532.702) (-534.270) * (-535.697) (-535.881) [-533.859] (-537.280) -- 0:00:43
      314500 -- (-533.930) (-533.310) [-536.006] (-534.116) * (-534.532) (-540.936) (-533.159) [-533.661] -- 0:00:43
      315000 -- (-537.108) [-534.346] (-533.977) (-535.119) * [-534.603] (-533.116) (-537.516) (-532.987) -- 0:00:43

      Average standard deviation of split frequencies: 0.011408

      315500 -- (-533.268) (-534.319) (-533.004) [-533.621] * (-532.617) [-531.882] (-532.574) (-534.979) -- 0:00:43
      316000 -- [-532.211] (-534.560) (-535.288) (-533.317) * (-532.304) (-532.738) (-533.320) [-532.263] -- 0:00:43
      316500 -- (-537.286) [-533.421] (-533.130) (-537.445) * (-538.587) [-534.565] (-533.126) (-533.905) -- 0:00:43
      317000 -- (-535.684) [-535.169] (-533.437) (-535.462) * (-538.567) (-537.157) [-534.340] (-532.094) -- 0:00:43
      317500 -- [-534.714] (-532.248) (-533.260) (-535.763) * (-534.453) (-532.954) (-537.678) [-532.452] -- 0:00:42
      318000 -- (-532.593) (-534.741) [-533.470] (-533.749) * (-532.953) (-533.791) [-531.416] (-534.256) -- 0:00:42
      318500 -- (-534.243) (-535.060) (-537.181) [-535.562] * (-532.004) [-532.352] (-536.289) (-533.117) -- 0:00:42
      319000 -- [-533.742] (-535.929) (-536.026) (-533.651) * (-536.165) (-534.162) (-534.609) [-532.511] -- 0:00:44
      319500 -- (-533.046) [-534.190] (-534.499) (-534.618) * (-536.674) [-533.791] (-536.385) (-531.961) -- 0:00:44
      320000 -- [-533.797] (-533.401) (-534.093) (-534.777) * [-535.361] (-533.372) (-532.532) (-535.420) -- 0:00:44

      Average standard deviation of split frequencies: 0.012036

      320500 -- [-532.324] (-533.163) (-532.899) (-536.143) * [-535.394] (-532.441) (-535.954) (-533.103) -- 0:00:44
      321000 -- (-533.849) [-533.993] (-532.978) (-533.584) * (-533.050) (-535.303) (-534.868) [-532.551] -- 0:00:44
      321500 -- (-534.042) (-537.350) (-533.905) [-533.187] * (-534.002) (-534.366) [-534.313] (-533.313) -- 0:00:44
      322000 -- (-532.811) (-537.049) [-534.381] (-536.894) * [-533.357] (-534.059) (-535.766) (-532.267) -- 0:00:44
      322500 -- (-534.881) (-535.079) [-532.727] (-535.938) * (-533.334) (-534.638) (-533.768) [-532.490] -- 0:00:44
      323000 -- [-534.731] (-535.797) (-533.581) (-533.168) * (-533.477) (-533.899) (-533.539) [-532.467] -- 0:00:44
      323500 -- (-535.164) (-535.054) (-532.434) [-540.869] * (-533.316) [-535.361] (-532.153) (-534.302) -- 0:00:43
      324000 -- (-534.162) [-533.809] (-531.887) (-538.169) * (-533.653) (-533.492) (-533.971) [-532.481] -- 0:00:43
      324500 -- (-533.291) (-531.665) [-533.982] (-534.624) * (-536.157) (-537.903) [-532.556] (-532.339) -- 0:00:43
      325000 -- (-532.653) (-534.399) [-532.222] (-533.873) * (-536.015) [-535.429] (-532.379) (-532.057) -- 0:00:43

      Average standard deviation of split frequencies: 0.012382

      325500 -- [-533.274] (-535.191) (-533.126) (-536.825) * (-534.432) (-537.341) (-533.464) [-532.159] -- 0:00:43
      326000 -- (-534.576) (-533.389) [-532.570] (-541.025) * (-535.107) (-536.791) (-532.550) [-533.878] -- 0:00:43
      326500 -- (-532.955) (-536.307) (-534.231) [-539.748] * (-536.789) (-540.075) (-533.983) [-534.889] -- 0:00:43
      327000 -- [-534.364] (-532.967) (-534.401) (-535.164) * (-532.275) (-537.734) (-533.214) [-533.420] -- 0:00:43
      327500 -- (-534.201) (-535.251) (-533.198) [-532.404] * (-531.721) (-532.926) [-532.520] (-533.619) -- 0:00:43
      328000 -- (-535.738) (-534.770) [-533.280] (-532.025) * (-532.155) (-534.277) [-534.210] (-538.054) -- 0:00:43
      328500 -- (-542.461) (-535.567) (-533.943) [-534.263] * (-532.996) [-537.894] (-532.165) (-536.139) -- 0:00:42
      329000 -- (-534.997) [-535.336] (-533.636) (-534.380) * (-534.263) [-532.821] (-535.806) (-532.551) -- 0:00:42
      329500 -- [-532.944] (-534.791) (-533.855) (-533.414) * (-533.914) (-537.888) (-534.032) [-532.522] -- 0:00:42
      330000 -- (-538.241) (-533.087) (-535.113) [-532.508] * (-538.019) (-535.288) (-544.031) [-534.755] -- 0:00:42

      Average standard deviation of split frequencies: 0.012296

      330500 -- (-533.157) (-534.932) (-534.781) [-532.742] * (-532.884) [-534.222] (-536.888) (-533.445) -- 0:00:42
      331000 -- [-536.896] (-535.655) (-539.621) (-535.229) * (-534.057) (-533.795) [-533.201] (-539.583) -- 0:00:42
      331500 -- [-532.494] (-534.181) (-533.191) (-533.221) * (-534.588) (-535.278) (-535.456) [-534.160] -- 0:00:42
      332000 -- (-532.062) (-531.850) (-533.655) [-532.390] * [-533.964] (-533.859) (-533.809) (-536.481) -- 0:00:42
      332500 -- (-531.955) (-535.671) [-532.874] (-536.454) * (-536.030) [-535.389] (-538.946) (-533.707) -- 0:00:42
      333000 -- [-533.421] (-535.629) (-534.274) (-533.145) * [-532.260] (-534.478) (-533.208) (-537.654) -- 0:00:42
      333500 -- [-534.220] (-533.898) (-533.906) (-535.477) * (-533.609) (-531.863) [-533.972] (-537.546) -- 0:00:41
      334000 -- (-531.868) [-532.723] (-535.147) (-531.991) * [-532.840] (-532.435) (-533.515) (-533.893) -- 0:00:41
      334500 -- (-535.630) [-533.856] (-533.457) (-533.196) * (-535.186) [-532.645] (-532.104) (-535.566) -- 0:00:41
      335000 -- (-533.578) (-534.014) (-532.761) [-534.182] * (-532.569) (-533.851) [-533.623] (-532.512) -- 0:00:41

      Average standard deviation of split frequencies: 0.011049

      335500 -- (-534.082) (-535.419) (-540.321) [-531.941] * (-531.923) (-532.613) [-533.207] (-534.699) -- 0:00:41
      336000 -- (-534.706) [-533.402] (-540.516) (-534.193) * (-532.409) (-532.192) (-538.024) [-534.035] -- 0:00:43
      336500 -- (-537.248) [-532.376] (-538.401) (-533.867) * (-533.869) [-534.415] (-533.989) (-531.858) -- 0:00:43
      337000 -- (-535.479) [-533.971] (-533.441) (-534.996) * (-532.602) [-534.700] (-532.792) (-533.002) -- 0:00:43
      337500 -- (-536.921) (-536.035) [-533.273] (-537.837) * (-533.469) (-534.586) [-532.629] (-533.522) -- 0:00:43
      338000 -- (-538.237) [-534.910] (-532.356) (-533.510) * (-532.554) (-534.047) (-532.879) [-534.354] -- 0:00:43
      338500 -- [-534.369] (-536.409) (-533.761) (-534.251) * [-534.524] (-532.012) (-532.894) (-535.277) -- 0:00:42
      339000 -- (-535.462) (-533.190) (-532.509) [-532.411] * (-533.688) [-534.043] (-532.567) (-537.331) -- 0:00:42
      339500 -- (-533.632) (-535.386) (-533.662) [-533.333] * (-535.957) (-534.122) [-533.272] (-533.130) -- 0:00:42
      340000 -- (-533.632) (-533.553) (-534.935) [-532.687] * [-535.715] (-534.269) (-536.724) (-534.987) -- 0:00:42

      Average standard deviation of split frequencies: 0.012367

      340500 -- (-534.080) (-534.560) [-535.345] (-534.023) * [-532.605] (-534.095) (-532.237) (-534.084) -- 0:00:42
      341000 -- (-533.363) (-534.649) [-536.088] (-534.460) * (-532.573) [-533.580] (-532.839) (-542.055) -- 0:00:42
      341500 -- [-532.862] (-533.343) (-534.635) (-535.674) * [-534.131] (-535.288) (-535.139) (-533.745) -- 0:00:42
      342000 -- (-534.330) [-532.757] (-534.237) (-545.560) * [-535.609] (-532.977) (-533.609) (-533.253) -- 0:00:42
      342500 -- (-534.142) (-533.111) [-532.942] (-534.828) * (-535.488) (-532.942) (-536.273) [-533.917] -- 0:00:42
      343000 -- (-532.410) (-531.430) [-536.408] (-532.375) * (-536.085) (-534.728) [-534.358] (-535.537) -- 0:00:42
      343500 -- [-532.366] (-532.992) (-534.216) (-531.966) * (-533.379) (-531.924) (-535.148) [-535.569] -- 0:00:42
      344000 -- [-533.498] (-534.006) (-533.248) (-532.105) * [-533.772] (-536.100) (-533.085) (-535.103) -- 0:00:41
      344500 -- [-535.276] (-533.941) (-533.314) (-536.191) * (-534.882) (-537.724) [-533.751] (-534.429) -- 0:00:41
      345000 -- (-533.449) (-535.367) (-534.277) [-532.490] * (-532.633) [-535.839] (-532.255) (-532.202) -- 0:00:41

      Average standard deviation of split frequencies: 0.011325

      345500 -- (-532.498) (-534.902) (-532.954) [-532.467] * (-533.208) (-538.499) [-534.032] (-533.165) -- 0:00:41
      346000 -- (-532.090) [-535.140] (-534.964) (-531.970) * [-534.107] (-535.077) (-536.504) (-534.952) -- 0:00:41
      346500 -- (-532.694) (-532.964) [-532.946] (-533.510) * (-533.833) (-535.574) [-532.218] (-533.453) -- 0:00:41
      347000 -- (-538.039) [-533.114] (-533.433) (-533.595) * [-532.784] (-533.787) (-532.518) (-536.037) -- 0:00:41
      347500 -- (-532.219) (-535.246) [-534.550] (-531.588) * [-533.593] (-532.180) (-531.389) (-534.101) -- 0:00:41
      348000 -- (-532.343) (-535.273) (-532.443) [-533.479] * (-532.209) (-534.462) (-531.883) [-534.060] -- 0:00:41
      348500 -- [-534.131] (-537.605) (-532.345) (-534.812) * (-534.755) [-532.235] (-532.782) (-536.111) -- 0:00:41
      349000 -- [-537.353] (-532.828) (-534.463) (-534.039) * (-532.391) [-533.604] (-535.010) (-539.218) -- 0:00:41
      349500 -- (-536.416) (-532.920) [-534.080] (-533.421) * (-533.320) [-535.923] (-532.719) (-533.436) -- 0:00:40
      350000 -- (-536.122) (-534.085) [-533.017] (-533.865) * (-538.369) [-537.925] (-533.712) (-535.773) -- 0:00:40

      Average standard deviation of split frequencies: 0.009806

      350500 -- (-532.007) (-535.086) [-535.984] (-533.907) * (-533.225) (-537.646) [-535.474] (-532.469) -- 0:00:40
      351000 -- [-534.070] (-534.631) (-534.251) (-537.061) * (-533.105) (-535.711) [-532.313] (-537.180) -- 0:00:40
      351500 -- (-532.703) (-536.954) [-532.740] (-536.713) * (-535.617) (-539.206) [-532.312] (-534.022) -- 0:00:40
      352000 -- (-533.292) (-532.111) [-537.001] (-533.649) * (-536.883) [-535.646] (-533.822) (-533.464) -- 0:00:42
      352500 -- [-534.431] (-532.365) (-536.884) (-535.169) * [-535.786] (-537.048) (-534.815) (-532.506) -- 0:00:42
      353000 -- (-534.588) (-534.408) (-532.667) [-533.069] * (-534.167) (-535.636) [-533.271] (-532.061) -- 0:00:42
      353500 -- (-535.112) [-535.396] (-531.850) (-535.328) * (-537.311) (-538.031) (-535.057) [-533.094] -- 0:00:42
      354000 -- (-534.865) (-537.595) (-532.860) [-534.905] * (-532.821) (-534.534) [-534.270] (-534.069) -- 0:00:41
      354500 -- (-534.383) (-539.475) [-531.680] (-533.357) * (-533.078) (-535.616) [-532.743] (-534.210) -- 0:00:41
      355000 -- (-533.240) (-533.674) (-534.781) [-535.504] * (-533.583) [-534.755] (-534.730) (-535.856) -- 0:00:41

      Average standard deviation of split frequencies: 0.009581

      355500 -- (-532.899) (-534.571) (-533.497) [-532.328] * (-532.883) (-534.438) [-533.756] (-532.290) -- 0:00:41
      356000 -- [-534.716] (-536.229) (-533.240) (-533.680) * [-533.000] (-534.469) (-534.007) (-532.890) -- 0:00:41
      356500 -- [-537.970] (-534.205) (-532.334) (-540.010) * (-533.696) (-533.131) (-535.301) [-532.489] -- 0:00:41
      357000 -- (-538.608) (-536.698) (-533.645) [-532.676] * [-535.371] (-533.854) (-532.577) (-533.945) -- 0:00:41
      357500 -- (-537.759) [-531.814] (-540.320) (-532.182) * (-536.477) [-532.055] (-535.749) (-535.157) -- 0:00:41
      358000 -- (-539.415) [-535.374] (-534.187) (-533.341) * (-533.364) (-534.221) (-532.529) [-533.033] -- 0:00:41
      358500 -- [-533.877] (-532.132) (-538.131) (-533.648) * [-533.024] (-531.720) (-534.307) (-534.159) -- 0:00:41
      359000 -- (-533.531) [-533.583] (-535.749) (-532.812) * (-538.161) [-532.716] (-533.147) (-535.235) -- 0:00:41
      359500 -- (-534.786) [-533.186] (-533.063) (-537.470) * (-532.636) (-534.152) (-532.833) [-535.201] -- 0:00:40
      360000 -- (-534.072) (-532.976) [-533.102] (-536.100) * [-535.541] (-535.581) (-531.878) (-533.256) -- 0:00:40

      Average standard deviation of split frequencies: 0.009149

      360500 -- [-534.423] (-534.957) (-533.684) (-532.710) * (-538.311) (-532.354) [-532.881] (-532.785) -- 0:00:40
      361000 -- [-535.649] (-531.949) (-533.196) (-532.787) * (-535.782) [-532.905] (-533.779) (-533.276) -- 0:00:40
      361500 -- (-534.704) [-535.199] (-534.441) (-533.569) * [-533.445] (-532.187) (-536.020) (-537.580) -- 0:00:40
      362000 -- [-535.773] (-536.385) (-533.070) (-535.518) * (-534.280) (-537.564) [-532.670] (-534.010) -- 0:00:40
      362500 -- (-533.264) [-533.291] (-532.533) (-532.062) * [-535.477] (-534.506) (-534.502) (-534.735) -- 0:00:40
      363000 -- (-533.214) [-532.524] (-533.833) (-534.865) * (-538.825) (-531.965) [-535.860] (-535.774) -- 0:00:40
      363500 -- [-533.825] (-532.783) (-534.307) (-537.258) * (-537.522) (-535.015) [-533.851] (-535.056) -- 0:00:40
      364000 -- (-534.950) (-537.379) [-533.329] (-536.771) * (-534.626) (-534.045) (-534.482) [-533.715] -- 0:00:40
      364500 -- [-534.897] (-534.171) (-533.116) (-535.555) * (-536.936) [-534.653] (-532.153) (-532.078) -- 0:00:40
      365000 -- (-534.650) (-535.972) (-532.321) [-535.312] * (-541.790) [-537.134] (-532.285) (-532.146) -- 0:00:40

      Average standard deviation of split frequencies: 0.009092

      365500 -- (-532.846) [-534.768] (-535.486) (-534.725) * (-534.369) (-533.537) [-533.104] (-533.894) -- 0:00:39
      366000 -- (-537.276) (-535.116) (-533.165) [-538.013] * (-533.605) (-534.286) (-536.021) [-534.835] -- 0:00:39
      366500 -- (-539.392) (-544.422) [-534.785] (-532.870) * (-534.948) (-532.156) (-532.249) [-534.611] -- 0:00:39
      367000 -- (-534.332) (-533.188) (-537.746) [-533.668] * (-531.509) (-535.226) [-532.392] (-533.304) -- 0:00:39
      367500 -- (-531.834) (-533.516) [-533.067] (-533.582) * (-534.748) [-531.769] (-532.735) (-532.459) -- 0:00:39
      368000 -- [-532.522] (-534.112) (-536.425) (-533.872) * (-533.879) [-534.472] (-532.194) (-533.080) -- 0:00:39
      368500 -- (-532.709) (-536.195) [-532.647] (-533.888) * (-533.033) [-536.323] (-534.022) (-532.167) -- 0:00:41
      369000 -- (-532.340) (-533.133) (-533.127) [-532.884] * (-534.202) (-533.466) (-532.950) [-532.206] -- 0:00:41
      369500 -- (-533.161) (-533.793) [-532.385] (-532.404) * (-533.014) [-533.272] (-537.654) (-532.192) -- 0:00:40
      370000 -- (-533.801) [-534.328] (-535.990) (-532.716) * (-533.051) [-536.219] (-539.357) (-533.003) -- 0:00:40

      Average standard deviation of split frequencies: 0.008902

      370500 -- [-534.713] (-533.963) (-532.021) (-533.007) * (-534.775) (-533.651) (-536.803) [-532.872] -- 0:00:40
      371000 -- (-535.631) [-533.159] (-535.188) (-534.180) * (-534.571) (-534.526) (-538.890) [-532.348] -- 0:00:40
      371500 -- (-533.115) [-532.084] (-532.755) (-535.596) * (-533.359) (-533.634) [-533.339] (-531.731) -- 0:00:40
      372000 -- (-534.547) [-532.775] (-537.645) (-533.413) * (-533.693) [-534.248] (-533.828) (-533.215) -- 0:00:40
      372500 -- (-533.173) (-534.455) (-540.487) [-532.506] * (-533.549) (-536.344) [-535.000] (-536.873) -- 0:00:40
      373000 -- (-534.446) (-533.505) (-535.450) [-532.321] * (-532.780) (-533.604) [-534.892] (-535.916) -- 0:00:40
      373500 -- (-535.778) [-536.425] (-533.351) (-533.248) * (-536.008) (-533.405) (-533.249) [-533.397] -- 0:00:40
      374000 -- (-534.082) (-531.868) (-533.501) [-534.519] * (-533.031) (-534.172) [-531.656] (-532.277) -- 0:00:40
      374500 -- (-532.612) (-538.082) (-532.076) [-533.048] * (-532.774) (-533.184) [-532.960] (-533.515) -- 0:00:40
      375000 -- [-535.070] (-533.535) (-535.104) (-533.920) * (-539.460) [-533.506] (-533.649) (-534.069) -- 0:00:40

      Average standard deviation of split frequencies: 0.008985

      375500 -- (-535.259) (-533.716) [-533.370] (-532.726) * (-531.942) [-534.451] (-534.549) (-533.367) -- 0:00:39
      376000 -- (-536.452) (-532.525) [-532.943] (-531.931) * [-533.341] (-533.302) (-535.189) (-537.143) -- 0:00:39
      376500 -- [-531.988] (-534.717) (-534.661) (-536.849) * (-533.481) (-533.827) (-534.065) [-540.316] -- 0:00:39
      377000 -- [-533.493] (-533.266) (-534.610) (-544.895) * [-532.476] (-534.895) (-531.914) (-535.611) -- 0:00:39
      377500 -- (-536.931) (-531.754) (-532.797) [-533.490] * (-534.985) (-537.244) (-536.494) [-534.524] -- 0:00:39
      378000 -- (-534.754) (-532.803) (-536.092) [-533.515] * (-533.026) (-533.211) [-536.615] (-533.514) -- 0:00:39
      378500 -- (-533.820) (-534.726) [-533.420] (-532.327) * (-533.443) [-533.326] (-532.559) (-537.388) -- 0:00:39
      379000 -- [-531.480] (-535.513) (-532.831) (-534.732) * (-532.829) (-532.313) [-532.350] (-537.089) -- 0:00:39
      379500 -- (-536.706) (-534.228) [-533.080] (-533.005) * (-533.945) [-532.573] (-533.514) (-533.970) -- 0:00:39
      380000 -- (-535.048) (-537.740) [-534.361] (-534.515) * (-532.897) [-534.700] (-532.059) (-534.088) -- 0:00:39

      Average standard deviation of split frequencies: 0.008231

      380500 -- [-532.983] (-535.970) (-534.437) (-533.618) * (-533.217) [-533.035] (-533.695) (-534.730) -- 0:00:39
      381000 -- (-533.384) (-535.074) [-533.916] (-535.670) * (-544.176) (-533.757) (-535.586) [-532.979] -- 0:00:38
      381500 -- (-533.285) [-532.377] (-535.341) (-534.513) * (-538.863) (-534.071) [-532.879] (-532.125) -- 0:00:38
      382000 -- (-533.291) (-534.540) [-532.782] (-534.181) * (-540.643) (-534.698) [-534.925] (-534.981) -- 0:00:38
      382500 -- [-533.145] (-532.734) (-533.514) (-532.118) * (-532.986) (-532.621) (-532.830) [-532.289] -- 0:00:38
      383000 -- (-533.796) (-533.556) [-531.731] (-535.535) * [-534.854] (-532.181) (-534.058) (-532.913) -- 0:00:38
      383500 -- (-532.656) (-533.801) [-532.796] (-532.853) * (-536.737) [-532.946] (-533.557) (-533.302) -- 0:00:38
      384000 -- (-533.017) (-534.165) [-534.398] (-534.044) * (-534.975) (-535.834) [-533.291] (-533.764) -- 0:00:38
      384500 -- (-532.819) [-534.218] (-534.955) (-532.158) * (-532.933) (-533.772) [-531.753] (-535.175) -- 0:00:38
      385000 -- [-534.752] (-532.593) (-532.577) (-535.810) * (-533.030) (-535.434) [-533.120] (-538.118) -- 0:00:38

      Average standard deviation of split frequencies: 0.007759

      385500 -- (-535.555) (-534.621) (-531.959) [-532.598] * (-533.980) (-536.898) (-532.662) [-533.199] -- 0:00:39
      386000 -- (-532.547) (-534.743) [-532.275] (-535.596) * [-534.989] (-536.298) (-534.068) (-532.088) -- 0:00:39
      386500 -- [-533.694] (-533.210) (-536.078) (-534.003) * (-535.847) (-534.292) [-534.990] (-532.014) -- 0:00:39
      387000 -- (-534.647) [-536.139] (-536.897) (-533.523) * [-533.922] (-538.019) (-532.676) (-533.846) -- 0:00:39
      387500 -- (-533.187) (-534.295) (-534.491) [-531.776] * (-532.356) (-532.152) [-540.636] (-535.852) -- 0:00:39
      388000 -- (-531.903) [-533.925] (-534.989) (-531.600) * (-532.390) (-532.523) [-533.895] (-536.671) -- 0:00:39
      388500 -- [-534.909] (-532.584) (-533.284) (-534.029) * (-533.933) (-532.897) [-533.844] (-533.415) -- 0:00:39
      389000 -- (-532.506) (-533.591) (-535.996) [-533.353] * [-531.641] (-531.570) (-533.602) (-533.605) -- 0:00:39
      389500 -- (-535.626) [-535.157] (-534.385) (-534.489) * (-533.750) (-532.042) (-536.709) [-532.507] -- 0:00:39
      390000 -- (-534.965) [-534.243] (-533.068) (-539.709) * (-534.421) (-532.895) [-533.189] (-533.083) -- 0:00:39

      Average standard deviation of split frequencies: 0.008447

      390500 -- (-534.448) [-534.044] (-534.174) (-534.561) * (-533.552) (-535.747) (-534.570) [-533.662] -- 0:00:39
      391000 -- (-533.305) (-535.731) [-533.188] (-534.387) * (-533.478) (-534.677) [-535.406] (-532.974) -- 0:00:38
      391500 -- (-533.540) (-535.004) (-538.164) [-532.071] * (-533.626) (-532.741) [-533.038] (-532.144) -- 0:00:38
      392000 -- (-537.057) (-531.913) (-533.974) [-533.669] * [-532.685] (-533.916) (-532.951) (-531.463) -- 0:00:38
      392500 -- [-532.062] (-533.140) (-534.468) (-533.594) * (-534.936) [-533.084] (-539.035) (-534.791) -- 0:00:38
      393000 -- (-532.446) [-534.303] (-534.403) (-542.568) * (-534.394) [-531.677] (-543.918) (-532.033) -- 0:00:38
      393500 -- (-532.903) [-537.557] (-532.629) (-533.700) * [-532.595] (-532.664) (-534.292) (-534.347) -- 0:00:38
      394000 -- (-532.607) [-532.086] (-533.387) (-533.143) * (-532.333) [-533.163] (-531.874) (-536.301) -- 0:00:38
      394500 -- (-532.192) [-532.402] (-534.901) (-534.397) * [-533.083] (-533.479) (-536.406) (-533.041) -- 0:00:38
      395000 -- [-535.558] (-532.546) (-534.918) (-533.485) * (-534.342) (-539.014) [-537.335] (-531.930) -- 0:00:38

      Average standard deviation of split frequencies: 0.008893

      395500 -- (-535.500) (-531.745) [-533.312] (-534.113) * (-534.953) (-537.844) (-533.555) [-532.618] -- 0:00:38
      396000 -- (-532.080) (-531.671) (-536.377) [-532.258] * [-533.932] (-535.344) (-531.544) (-532.967) -- 0:00:38
      396500 -- (-535.184) (-532.936) (-532.897) [-535.722] * (-533.513) [-533.796] (-533.372) (-533.668) -- 0:00:38
      397000 -- (-534.493) (-532.459) (-531.757) [-535.358] * [-533.603] (-533.440) (-539.397) (-532.790) -- 0:00:37
      397500 -- (-537.876) [-533.399] (-532.183) (-535.936) * (-535.414) (-534.077) [-532.526] (-533.578) -- 0:00:37
      398000 -- (-539.786) (-532.522) [-534.291] (-532.807) * [-533.216] (-533.134) (-532.932) (-531.858) -- 0:00:37
      398500 -- (-535.658) (-532.946) [-533.063] (-532.782) * (-535.683) (-532.228) (-534.954) [-533.268] -- 0:00:37
      399000 -- [-534.949] (-532.379) (-533.002) (-534.098) * (-535.086) [-534.546] (-534.385) (-535.765) -- 0:00:37
      399500 -- (-535.337) (-531.705) [-531.773] (-532.577) * (-532.258) (-532.543) (-532.195) [-532.900] -- 0:00:37
      400000 -- (-532.983) [-531.703] (-532.259) (-532.653) * [-532.071] (-533.400) (-534.105) (-532.932) -- 0:00:37

      Average standard deviation of split frequencies: 0.008604

      400500 -- (-534.706) (-533.018) (-534.382) [-533.480] * [-533.450] (-533.511) (-533.368) (-534.589) -- 0:00:37
      401000 -- [-533.356] (-531.612) (-532.639) (-533.255) * (-534.183) [-534.864] (-535.596) (-533.850) -- 0:00:37
      401500 -- (-532.588) (-532.414) [-532.548] (-534.583) * [-533.714] (-536.909) (-535.631) (-534.776) -- 0:00:37
      402000 -- (-536.587) (-535.097) (-533.655) [-533.822] * (-532.432) [-533.698] (-537.393) (-537.409) -- 0:00:38
      402500 -- [-533.999] (-532.506) (-533.848) (-534.499) * (-532.344) (-536.172) [-534.369] (-534.064) -- 0:00:38
      403000 -- (-533.121) [-533.534] (-535.122) (-541.514) * (-534.777) [-532.339] (-532.518) (-532.706) -- 0:00:38
      403500 -- [-534.790] (-532.860) (-533.552) (-533.050) * (-537.807) (-531.501) [-534.884] (-532.553) -- 0:00:38
      404000 -- (-533.258) [-533.072] (-532.374) (-532.464) * (-540.759) (-536.151) (-536.877) [-533.630] -- 0:00:38
      404500 -- (-532.029) (-533.155) (-537.305) [-532.227] * (-532.640) (-538.019) [-534.318] (-534.696) -- 0:00:38
      405000 -- (-536.207) [-535.380] (-534.713) (-535.786) * (-536.466) (-542.553) (-536.168) [-532.381] -- 0:00:38

      Average standard deviation of split frequencies: 0.008966

      405500 -- (-537.473) (-536.544) (-533.248) [-538.741] * (-534.170) (-533.268) (-533.881) [-532.325] -- 0:00:38
      406000 -- (-533.042) [-534.966] (-533.364) (-536.561) * (-532.350) (-532.856) [-533.538] (-532.132) -- 0:00:38
      406500 -- [-537.044] (-536.473) (-533.896) (-534.739) * [-531.717] (-534.301) (-532.183) (-534.711) -- 0:00:37
      407000 -- (-532.853) (-535.255) (-536.052) [-536.051] * (-531.917) (-533.401) [-535.439] (-532.307) -- 0:00:37
      407500 -- (-536.615) (-535.829) (-533.168) [-533.048] * (-535.581) (-532.153) (-535.728) [-535.491] -- 0:00:37
      408000 -- (-533.898) (-536.660) [-535.672] (-535.494) * [-535.339] (-537.444) (-532.972) (-535.829) -- 0:00:37
      408500 -- (-534.574) [-533.821] (-535.947) (-533.199) * [-533.520] (-532.999) (-533.681) (-533.898) -- 0:00:37
      409000 -- (-532.958) (-533.650) [-534.472] (-532.882) * [-532.924] (-532.984) (-533.125) (-534.986) -- 0:00:37
      409500 -- (-533.851) (-532.624) [-534.862] (-535.975) * (-533.568) (-534.112) [-535.522] (-535.817) -- 0:00:37
      410000 -- (-533.640) (-533.405) [-532.157] (-532.199) * (-533.581) (-531.725) (-535.062) [-540.249] -- 0:00:37

      Average standard deviation of split frequencies: 0.008992

      410500 -- [-533.294] (-534.496) (-531.723) (-531.990) * (-536.079) (-532.886) (-532.536) [-535.808] -- 0:00:37
      411000 -- [-533.247] (-533.301) (-534.365) (-534.097) * (-534.078) (-532.677) (-534.226) [-533.290] -- 0:00:37
      411500 -- (-535.631) (-534.962) [-531.762] (-535.585) * (-533.427) (-532.356) (-534.008) [-534.510] -- 0:00:37
      412000 -- [-534.577] (-533.098) (-531.933) (-540.527) * (-533.635) (-534.310) [-533.851] (-536.655) -- 0:00:37
      412500 -- (-534.032) (-532.466) [-532.994] (-534.274) * (-534.451) (-532.459) [-537.456] (-538.099) -- 0:00:37
      413000 -- (-532.322) (-533.448) (-535.414) [-533.398] * [-536.596] (-534.419) (-532.481) (-536.277) -- 0:00:36
      413500 -- (-533.982) [-537.276] (-538.037) (-533.806) * (-535.018) (-533.396) [-534.087] (-533.519) -- 0:00:36
      414000 -- (-533.870) (-533.149) (-537.453) [-533.047] * [-533.682] (-534.806) (-533.080) (-536.086) -- 0:00:36
      414500 -- (-533.384) (-532.830) [-534.842] (-533.939) * (-531.529) (-531.880) [-535.347] (-532.990) -- 0:00:36
      415000 -- [-533.560] (-532.338) (-534.453) (-534.318) * (-539.306) [-535.297] (-533.793) (-534.801) -- 0:00:36

      Average standard deviation of split frequencies: 0.009191

      415500 -- (-535.566) (-536.463) (-532.935) [-532.861] * (-536.822) (-535.626) [-536.573] (-535.039) -- 0:00:36
      416000 -- (-537.969) (-532.492) (-533.592) [-532.760] * (-534.569) [-533.169] (-533.168) (-537.954) -- 0:00:36
      416500 -- (-534.595) [-534.304] (-534.548) (-534.182) * (-535.184) [-532.173] (-532.767) (-532.609) -- 0:00:36
      417000 -- [-533.537] (-533.487) (-533.432) (-535.474) * (-532.723) [-532.988] (-535.025) (-532.757) -- 0:00:37
      417500 -- [-533.694] (-532.010) (-532.100) (-535.921) * (-536.360) (-533.583) (-534.100) [-532.713] -- 0:00:37
      418000 -- [-532.655] (-536.114) (-532.223) (-531.967) * (-534.955) (-533.712) (-533.352) [-535.189] -- 0:00:37
      418500 -- (-533.142) (-535.872) (-536.061) [-533.264] * [-531.810] (-537.229) (-533.524) (-534.601) -- 0:00:37
      419000 -- (-533.352) [-533.788] (-535.450) (-532.845) * (-533.173) (-532.590) (-537.612) [-532.601] -- 0:00:37
      419500 -- (-531.847) (-536.548) [-532.607] (-532.465) * (-532.522) (-532.213) (-535.733) [-534.516] -- 0:00:37
      420000 -- [-533.177] (-534.892) (-533.014) (-532.570) * (-534.826) (-535.858) [-538.852] (-531.959) -- 0:00:37

      Average standard deviation of split frequencies: 0.010151

      420500 -- (-532.084) [-537.441] (-536.761) (-535.355) * (-537.154) (-534.246) (-534.047) [-533.665] -- 0:00:37
      421000 -- (-533.216) (-537.137) [-533.087] (-532.857) * [-533.225] (-539.074) (-533.545) (-533.165) -- 0:00:37
      421500 -- (-535.796) [-536.711] (-532.573) (-533.847) * (-533.230) (-535.902) [-534.074] (-536.136) -- 0:00:37
      422000 -- (-532.496) [-533.857] (-532.880) (-532.220) * (-533.925) (-534.170) (-534.869) [-541.205] -- 0:00:36
      422500 -- (-532.479) [-533.149] (-532.276) (-535.474) * (-535.292) [-532.995] (-533.135) (-534.409) -- 0:00:36
      423000 -- [-536.295] (-535.526) (-532.287) (-537.511) * (-537.076) (-533.674) (-538.054) [-534.531] -- 0:00:36
      423500 -- (-536.109) [-533.308] (-532.107) (-534.091) * (-540.257) (-532.913) (-539.497) [-533.368] -- 0:00:36
      424000 -- [-532.460] (-532.469) (-532.594) (-537.780) * (-533.923) (-533.701) (-534.881) [-533.996] -- 0:00:36
      424500 -- (-534.491) (-534.391) [-536.948] (-533.996) * [-536.128] (-534.298) (-532.864) (-534.200) -- 0:00:36
      425000 -- (-535.070) (-537.470) [-535.386] (-534.686) * [-534.023] (-537.005) (-532.368) (-533.266) -- 0:00:36

      Average standard deviation of split frequencies: 0.009475

      425500 -- (-534.092) (-532.381) (-540.305) [-533.220] * (-539.626) (-536.671) [-535.216] (-533.390) -- 0:00:36
      426000 -- (-536.840) [-533.045] (-537.789) (-538.306) * (-533.505) (-534.798) [-534.256] (-533.521) -- 0:00:36
      426500 -- (-534.054) (-535.074) (-534.905) [-532.661] * [-532.134] (-532.064) (-532.633) (-537.041) -- 0:00:36
      427000 -- [-533.968] (-533.400) (-534.936) (-535.826) * (-536.315) [-533.306] (-532.415) (-532.481) -- 0:00:36
      427500 -- (-532.039) (-535.576) [-535.436] (-531.731) * (-533.398) (-531.840) (-535.369) [-534.827] -- 0:00:36
      428000 -- [-532.764] (-535.105) (-533.913) (-533.157) * (-533.531) [-532.562] (-533.205) (-535.014) -- 0:00:36
      428500 -- (-532.626) (-533.271) (-535.760) [-532.459] * (-533.984) (-531.945) (-533.515) [-533.026] -- 0:00:36
      429000 -- [-534.655] (-534.626) (-532.654) (-539.352) * (-537.703) (-532.266) (-534.434) [-532.194] -- 0:00:35
      429500 -- (-538.062) (-534.475) [-536.710] (-535.059) * (-534.236) (-536.142) [-533.759] (-533.676) -- 0:00:35
      430000 -- (-539.737) (-537.490) (-533.774) [-535.584] * (-533.920) (-531.701) [-533.555] (-535.473) -- 0:00:35

      Average standard deviation of split frequencies: 0.009401

      430500 -- (-533.612) (-535.072) (-532.008) [-534.518] * (-532.530) (-532.047) (-532.933) [-532.305] -- 0:00:35
      431000 -- (-532.867) (-533.323) [-532.785] (-534.614) * [-533.370] (-533.861) (-535.303) (-532.235) -- 0:00:35
      431500 -- (-534.696) [-534.214] (-532.957) (-531.753) * [-531.490] (-534.315) (-534.586) (-534.050) -- 0:00:35
      432000 -- (-533.945) (-533.442) (-533.020) [-533.417] * [-535.284] (-534.617) (-533.263) (-533.538) -- 0:00:36
      432500 -- [-533.361] (-533.414) (-539.948) (-532.989) * [-536.116] (-532.746) (-534.762) (-532.785) -- 0:00:36
      433000 -- (-536.288) [-532.173] (-532.779) (-532.188) * (-535.781) (-535.659) (-531.563) [-532.732] -- 0:00:36
      433500 -- (-537.582) (-532.905) (-533.438) [-533.647] * (-533.298) (-536.006) [-534.243] (-534.741) -- 0:00:36
      434000 -- (-532.535) (-531.862) (-533.560) [-533.216] * (-531.908) (-535.581) [-533.297] (-533.466) -- 0:00:36
      434500 -- [-532.485] (-532.535) (-535.162) (-533.480) * (-533.383) (-535.755) [-534.788] (-532.261) -- 0:00:36
      435000 -- [-535.286] (-534.259) (-533.052) (-533.493) * [-535.570] (-534.926) (-533.097) (-533.073) -- 0:00:36

      Average standard deviation of split frequencies: 0.009922

      435500 -- [-533.228] (-534.770) (-534.451) (-533.842) * (-533.702) [-534.826] (-534.072) (-536.688) -- 0:00:36
      436000 -- [-534.350] (-535.828) (-533.093) (-534.305) * (-534.128) [-534.240] (-537.486) (-534.971) -- 0:00:36
      436500 -- (-534.410) (-532.161) (-533.091) [-532.073] * (-538.597) [-533.107] (-532.920) (-535.471) -- 0:00:36
      437000 -- (-533.063) (-532.600) (-534.897) [-532.042] * (-535.522) [-532.466] (-537.803) (-531.806) -- 0:00:36
      437500 -- (-533.148) (-533.147) [-535.556] (-533.819) * (-535.386) (-535.084) (-534.417) [-533.068] -- 0:00:36
      438000 -- (-534.645) [-532.727] (-533.261) (-536.476) * (-535.520) [-532.015] (-534.541) (-533.646) -- 0:00:35
      438500 -- (-533.851) (-535.987) (-534.298) [-532.049] * (-535.368) (-531.924) [-533.580] (-532.692) -- 0:00:35
      439000 -- [-533.881] (-534.006) (-532.678) (-531.708) * (-538.441) (-532.669) (-533.809) [-533.986] -- 0:00:35
      439500 -- [-533.321] (-536.217) (-534.342) (-533.456) * [-535.190] (-536.285) (-535.137) (-532.843) -- 0:00:35
      440000 -- [-531.864] (-534.109) (-533.344) (-534.595) * (-531.752) (-535.040) (-532.511) [-533.982] -- 0:00:35

      Average standard deviation of split frequencies: 0.010965

      440500 -- [-533.863] (-532.849) (-533.666) (-532.729) * (-532.918) (-532.694) (-534.042) [-534.063] -- 0:00:35
      441000 -- (-533.632) (-537.898) [-534.039] (-534.068) * [-533.666] (-533.112) (-540.003) (-532.499) -- 0:00:35
      441500 -- [-534.205] (-539.484) (-534.272) (-532.502) * [-534.030] (-533.602) (-532.990) (-534.463) -- 0:00:35
      442000 -- (-535.050) (-536.975) (-533.172) [-533.079] * (-538.370) [-535.089] (-534.557) (-539.407) -- 0:00:35
      442500 -- (-537.673) [-535.757] (-531.902) (-533.065) * (-535.622) [-534.734] (-536.899) (-539.030) -- 0:00:35
      443000 -- (-532.254) [-533.735] (-532.537) (-532.574) * (-537.257) (-534.687) (-535.465) [-532.213] -- 0:00:35
      443500 -- (-533.052) [-532.938] (-533.956) (-533.831) * (-533.754) (-533.428) (-534.366) [-535.756] -- 0:00:35
      444000 -- (-538.553) (-533.203) [-532.738] (-534.062) * (-534.457) (-532.554) [-531.984] (-537.272) -- 0:00:35
      444500 -- [-533.093] (-532.885) (-533.112) (-533.289) * (-533.057) (-533.788) [-533.518] (-536.853) -- 0:00:34
      445000 -- (-532.419) (-532.080) (-533.794) [-534.125] * [-533.646] (-534.569) (-535.472) (-534.627) -- 0:00:34

      Average standard deviation of split frequencies: 0.010371

      445500 -- (-535.628) (-533.876) [-532.293] (-533.808) * (-536.185) (-539.515) [-532.349] (-538.386) -- 0:00:34
      446000 -- (-532.699) [-534.708] (-532.053) (-535.133) * [-537.581] (-536.845) (-532.583) (-533.468) -- 0:00:34
      446500 -- (-534.268) [-535.091] (-532.437) (-533.995) * (-533.395) [-535.296] (-531.850) (-531.695) -- 0:00:34
      447000 -- (-534.329) (-533.839) (-532.625) [-531.896] * (-534.066) (-534.465) (-535.076) [-531.908] -- 0:00:34
      447500 -- (-537.729) [-538.895] (-532.812) (-535.825) * (-532.147) (-533.274) (-534.543) [-532.431] -- 0:00:34
      448000 -- (-539.681) (-536.420) (-532.952) [-534.192] * [-531.858] (-532.705) (-535.029) (-537.439) -- 0:00:34
      448500 -- (-535.018) [-532.696] (-532.752) (-533.276) * (-532.775) (-535.687) [-535.764] (-532.831) -- 0:00:35
      449000 -- [-535.819] (-535.991) (-532.897) (-533.567) * (-532.421) (-533.508) [-531.786] (-533.585) -- 0:00:35
      449500 -- (-533.278) (-538.818) (-534.052) [-536.437] * (-532.040) (-532.062) (-532.103) [-534.325] -- 0:00:35
      450000 -- (-533.107) (-535.371) [-531.708] (-533.069) * [-532.946] (-533.324) (-533.300) (-532.387) -- 0:00:35

      Average standard deviation of split frequencies: 0.010852

      450500 -- (-532.384) (-534.825) [-531.991] (-532.796) * [-533.344] (-533.610) (-534.880) (-534.669) -- 0:00:35
      451000 -- (-532.115) (-532.422) [-531.806] (-533.158) * (-532.031) [-532.414] (-536.786) (-535.698) -- 0:00:35
      451500 -- [-532.206] (-532.105) (-533.876) (-534.839) * [-537.206] (-533.848) (-542.300) (-536.840) -- 0:00:35
      452000 -- [-533.101] (-534.425) (-532.876) (-533.795) * (-535.490) (-536.231) [-534.006] (-534.403) -- 0:00:35
      452500 -- (-533.281) (-534.938) [-535.265] (-532.562) * (-537.742) [-533.738] (-535.904) (-535.511) -- 0:00:35
      453000 -- [-535.589] (-537.312) (-536.047) (-534.724) * [-532.307] (-532.304) (-533.472) (-531.674) -- 0:00:35
      453500 -- (-535.032) (-534.080) (-534.575) [-534.360] * (-532.376) (-532.901) [-533.052] (-533.382) -- 0:00:34
      454000 -- (-534.011) (-536.471) [-532.936] (-535.088) * [-532.203] (-534.724) (-534.564) (-534.782) -- 0:00:34
      454500 -- (-535.566) (-533.545) [-535.463] (-534.010) * [-534.117] (-538.234) (-531.959) (-532.937) -- 0:00:34
      455000 -- (-534.850) [-533.277] (-533.675) (-533.406) * [-540.672] (-531.782) (-540.100) (-532.627) -- 0:00:34

      Average standard deviation of split frequencies: 0.010079

      455500 -- (-538.488) (-535.845) [-531.867] (-532.781) * (-532.710) (-533.915) (-533.963) [-534.707] -- 0:00:34
      456000 -- [-533.568] (-532.967) (-533.499) (-533.520) * (-533.825) (-534.604) [-535.239] (-535.520) -- 0:00:34
      456500 -- [-535.089] (-533.107) (-533.667) (-535.127) * [-533.774] (-537.066) (-533.800) (-532.344) -- 0:00:34
      457000 -- (-532.946) (-533.825) [-534.745] (-532.706) * (-533.900) (-538.068) (-532.019) [-532.710] -- 0:00:34
      457500 -- (-532.792) (-534.810) (-534.546) [-531.737] * (-532.624) (-532.431) [-532.635] (-531.920) -- 0:00:34
      458000 -- (-536.261) (-538.859) (-532.588) [-532.504] * [-532.899] (-532.457) (-534.897) (-535.279) -- 0:00:34
      458500 -- [-533.448] (-533.888) (-534.068) (-532.733) * (-533.816) (-533.942) (-533.020) [-535.270] -- 0:00:34
      459000 -- [-533.862] (-534.598) (-536.085) (-531.892) * [-532.923] (-532.466) (-534.445) (-536.957) -- 0:00:34
      459500 -- (-531.492) (-533.051) [-534.251] (-532.359) * (-532.153) (-534.462) [-534.579] (-537.087) -- 0:00:34
      460000 -- (-533.490) (-538.322) (-533.302) [-536.990] * (-537.283) [-533.569] (-534.254) (-535.487) -- 0:00:34

      Average standard deviation of split frequencies: 0.010169

      460500 -- [-534.154] (-533.768) (-534.701) (-536.612) * (-535.282) [-534.608] (-538.029) (-534.642) -- 0:00:33
      461000 -- (-533.842) (-536.916) [-536.759] (-537.542) * (-535.182) [-535.721] (-536.586) (-533.572) -- 0:00:33
      461500 -- (-533.980) [-537.617] (-534.578) (-532.750) * (-535.595) [-536.524] (-531.875) (-535.768) -- 0:00:33
      462000 -- (-533.815) (-534.453) (-535.264) [-532.144] * (-539.679) (-533.328) (-534.246) [-534.407] -- 0:00:33
      462500 -- (-533.245) (-535.533) (-533.010) [-532.430] * [-533.812] (-534.153) (-533.204) (-540.097) -- 0:00:33
      463000 -- (-533.505) (-534.704) [-539.000] (-532.081) * [-532.186] (-539.348) (-535.575) (-533.959) -- 0:00:33
      463500 -- [-535.603] (-536.493) (-531.969) (-532.777) * (-531.974) (-538.120) [-534.480] (-534.996) -- 0:00:33
      464000 -- (-535.771) (-532.308) [-533.589] (-532.094) * (-531.937) (-535.498) [-534.149] (-537.522) -- 0:00:33
      464500 -- (-533.098) [-533.594] (-533.846) (-533.562) * (-532.075) (-532.473) (-536.572) [-533.648] -- 0:00:33
      465000 -- (-532.955) [-534.120] (-534.246) (-535.821) * (-532.706) [-532.410] (-535.068) (-533.961) -- 0:00:33

      Average standard deviation of split frequencies: 0.010116

      465500 -- (-534.358) (-533.103) (-532.737) [-534.014] * (-532.510) (-532.732) (-532.554) [-532.917] -- 0:00:34
      466000 -- (-533.275) [-532.635] (-535.335) (-533.868) * (-533.318) (-534.074) [-532.979] (-535.801) -- 0:00:34
      466500 -- (-535.248) [-531.729] (-537.796) (-533.577) * (-533.416) (-542.890) [-532.437] (-532.357) -- 0:00:34
      467000 -- (-535.655) (-534.386) (-536.917) [-534.160] * (-533.592) (-532.622) [-532.825] (-534.320) -- 0:00:34
      467500 -- [-533.322] (-535.329) (-537.111) (-533.097) * (-535.932) (-532.137) (-533.444) [-533.617] -- 0:00:34
      468000 -- [-533.705] (-534.715) (-539.088) (-535.282) * (-532.936) (-535.362) (-532.687) [-532.699] -- 0:00:34
      468500 -- [-532.856] (-533.484) (-536.745) (-533.094) * (-533.101) (-536.932) [-532.896] (-532.373) -- 0:00:34
      469000 -- (-533.702) (-534.138) (-534.779) [-536.264] * (-543.605) (-537.336) (-533.782) [-532.667] -- 0:00:33
      469500 -- (-533.960) (-535.953) [-533.262] (-533.848) * (-533.079) [-536.872] (-534.620) (-533.957) -- 0:00:33
      470000 -- (-533.838) (-533.899) [-535.929] (-532.870) * (-535.400) [-535.752] (-532.448) (-532.596) -- 0:00:33

      Average standard deviation of split frequencies: 0.009953

      470500 -- (-534.171) [-533.528] (-534.195) (-534.395) * (-534.755) (-539.630) (-536.137) [-536.012] -- 0:00:33
      471000 -- (-533.278) [-533.442] (-536.546) (-534.098) * (-532.519) (-535.111) (-531.640) [-533.035] -- 0:00:33
      471500 -- (-544.061) (-534.011) [-537.144] (-532.158) * [-532.902] (-534.463) (-531.805) (-532.599) -- 0:00:33
      472000 -- (-532.120) (-535.590) (-532.675) [-533.905] * [-532.413] (-533.156) (-533.749) (-532.792) -- 0:00:33
      472500 -- (-537.545) (-536.573) [-534.527] (-535.213) * (-532.049) [-532.876] (-533.555) (-533.330) -- 0:00:33
      473000 -- (-534.590) (-532.377) [-533.304] (-533.237) * (-533.179) (-537.444) [-532.799] (-534.719) -- 0:00:33
      473500 -- (-532.883) (-533.895) (-535.621) [-532.025] * [-532.538] (-534.550) (-534.789) (-532.706) -- 0:00:33
      474000 -- [-533.180] (-532.180) (-532.386) (-533.798) * [-532.618] (-533.356) (-534.026) (-532.266) -- 0:00:33
      474500 -- (-534.833) (-534.069) (-534.073) [-533.087] * (-533.340) [-534.794] (-535.796) (-533.092) -- 0:00:33
      475000 -- (-532.844) (-532.505) (-533.311) [-534.315] * (-533.463) (-533.218) [-533.663] (-538.162) -- 0:00:33

      Average standard deviation of split frequencies: 0.010708

      475500 -- (-533.096) [-533.742] (-538.120) (-537.547) * [-531.842] (-532.979) (-534.460) (-533.596) -- 0:00:33
      476000 -- (-533.241) (-535.306) [-534.395] (-534.322) * [-532.364] (-534.723) (-535.794) (-533.264) -- 0:00:33
      476500 -- (-533.466) (-535.251) (-535.358) [-533.679] * (-535.526) (-533.830) (-533.323) [-533.583] -- 0:00:32
      477000 -- [-532.770] (-533.499) (-536.007) (-533.747) * [-533.251] (-532.524) (-532.651) (-534.655) -- 0:00:32
      477500 -- [-533.971] (-535.331) (-533.838) (-533.415) * (-533.454) (-533.137) [-533.682] (-532.776) -- 0:00:32
      478000 -- (-534.869) (-534.201) [-533.239] (-533.989) * [-533.712] (-540.086) (-535.794) (-533.650) -- 0:00:32
      478500 -- [-534.856] (-536.449) (-533.581) (-533.600) * (-537.224) [-536.524] (-533.545) (-533.038) -- 0:00:32
      479000 -- (-536.073) [-535.045] (-534.595) (-534.945) * (-535.290) [-533.585] (-535.752) (-533.971) -- 0:00:32
      479500 -- (-535.021) (-535.024) (-535.879) [-532.642] * (-536.893) (-532.518) [-533.348] (-531.594) -- 0:00:32
      480000 -- (-537.598) [-532.517] (-535.039) (-535.083) * (-534.646) [-532.296] (-533.155) (-534.401) -- 0:00:32

      Average standard deviation of split frequencies: 0.010298

      480500 -- (-534.383) (-532.021) [-533.569] (-534.452) * (-536.518) (-532.192) [-532.785] (-536.825) -- 0:00:32
      481000 -- [-533.269] (-532.522) (-532.969) (-533.178) * [-533.392] (-532.260) (-534.125) (-531.815) -- 0:00:32
      481500 -- (-533.764) (-534.379) (-532.342) [-531.730] * [-534.102] (-532.521) (-534.064) (-537.073) -- 0:00:33
      482000 -- (-531.836) (-532.399) [-534.022] (-532.845) * [-534.011] (-532.063) (-533.363) (-535.920) -- 0:00:33
      482500 -- [-532.868] (-531.503) (-533.811) (-532.752) * (-533.874) (-532.981) (-535.623) [-533.415] -- 0:00:33
      483000 -- (-533.464) (-538.350) [-533.685] (-533.218) * (-532.995) [-532.675] (-533.294) (-536.055) -- 0:00:33
      483500 -- (-532.678) [-533.883] (-533.994) (-535.405) * (-534.919) [-533.398] (-534.422) (-533.196) -- 0:00:33
      484000 -- [-532.141] (-532.609) (-532.686) (-533.940) * (-535.411) (-533.089) (-535.520) [-537.373] -- 0:00:33
      484500 -- [-531.776] (-535.462) (-533.534) (-532.494) * (-536.216) [-532.983] (-534.356) (-534.484) -- 0:00:32
      485000 -- (-533.131) (-537.016) (-533.963) [-532.052] * (-533.932) (-535.495) [-536.099] (-533.556) -- 0:00:32

      Average standard deviation of split frequencies: 0.010609

      485500 -- (-534.500) (-536.913) [-533.160] (-534.395) * (-533.047) (-535.708) (-532.366) [-532.977] -- 0:00:32
      486000 -- [-538.166] (-532.305) (-533.526) (-533.371) * (-531.962) (-535.693) [-532.681] (-533.794) -- 0:00:32
      486500 -- [-535.266] (-533.260) (-535.949) (-532.165) * (-531.798) [-533.636] (-532.748) (-533.408) -- 0:00:32
      487000 -- (-539.260) [-533.296] (-534.672) (-535.197) * [-534.062] (-533.672) (-533.011) (-532.601) -- 0:00:32
      487500 -- (-534.474) [-534.254] (-532.531) (-533.217) * (-534.028) (-533.351) (-534.407) [-532.644] -- 0:00:32
      488000 -- (-542.810) (-534.277) [-532.216] (-536.888) * (-533.425) (-533.596) [-532.738] (-535.069) -- 0:00:32
      488500 -- (-536.509) (-533.410) [-534.815] (-534.889) * (-536.280) [-532.877] (-535.702) (-534.164) -- 0:00:32
      489000 -- (-533.222) [-532.072] (-534.113) (-535.020) * (-541.439) (-534.339) [-533.863] (-532.185) -- 0:00:32
      489500 -- (-531.836) [-533.648] (-532.945) (-536.016) * [-534.024] (-534.266) (-532.176) (-533.552) -- 0:00:32
      490000 -- (-532.123) (-531.967) [-531.710] (-532.206) * (-536.442) (-533.512) [-535.178] (-535.230) -- 0:00:32

      Average standard deviation of split frequencies: 0.010628

      490500 -- (-533.226) [-534.444] (-533.316) (-532.278) * (-537.097) (-534.008) [-534.471] (-533.534) -- 0:00:32
      491000 -- (-533.914) [-533.589] (-534.900) (-532.238) * (-535.517) (-536.381) [-534.709] (-535.760) -- 0:00:32
      491500 -- (-531.926) [-535.108] (-536.297) (-534.581) * (-534.088) [-533.933] (-534.598) (-535.432) -- 0:00:32
      492000 -- [-532.260] (-541.840) (-534.591) (-532.968) * [-534.013] (-532.643) (-537.181) (-539.051) -- 0:00:32
      492500 -- [-538.474] (-536.670) (-534.526) (-532.878) * (-534.154) (-539.492) [-539.353] (-535.408) -- 0:00:31
      493000 -- [-533.049] (-532.432) (-533.233) (-533.130) * (-534.837) (-537.419) [-533.310] (-533.942) -- 0:00:31
      493500 -- [-532.009] (-534.719) (-535.005) (-534.452) * (-534.182) [-532.956] (-536.855) (-532.621) -- 0:00:31
      494000 -- [-532.320] (-534.507) (-532.362) (-532.759) * (-537.735) (-536.081) [-534.560] (-534.282) -- 0:00:31
      494500 -- (-538.029) (-533.294) (-533.127) [-535.384] * (-536.251) (-531.972) (-532.933) [-533.624] -- 0:00:31
      495000 -- (-536.318) [-534.026] (-533.779) (-536.593) * (-536.637) (-540.213) (-532.489) [-531.973] -- 0:00:31

      Average standard deviation of split frequencies: 0.011167

      495500 -- (-538.780) [-533.731] (-534.137) (-532.654) * (-533.743) (-536.405) [-533.408] (-535.912) -- 0:00:31
      496000 -- (-532.454) (-535.299) [-532.068] (-534.035) * (-536.122) [-534.062] (-532.444) (-533.374) -- 0:00:31
      496500 -- (-532.086) (-536.609) [-534.359] (-532.621) * (-534.773) (-535.351) (-534.366) [-535.448] -- 0:00:31
      497000 -- [-533.493] (-533.788) (-533.307) (-534.171) * (-534.481) (-533.931) (-532.372) [-532.409] -- 0:00:31
      497500 -- (-534.410) (-532.030) (-535.028) [-533.092] * (-533.497) (-537.346) (-535.471) [-534.145] -- 0:00:31
      498000 -- (-533.404) (-532.091) (-532.565) [-533.534] * (-536.044) [-534.521] (-533.759) (-533.984) -- 0:00:31
      498500 -- (-532.919) (-535.793) [-531.723] (-537.628) * (-535.457) [-532.073] (-535.371) (-533.863) -- 0:00:32
      499000 -- (-532.280) [-532.249] (-536.792) (-533.769) * (-536.842) [-533.829] (-533.464) (-534.005) -- 0:00:32
      499500 -- [-535.197] (-536.443) (-534.017) (-533.092) * (-536.175) (-533.851) (-534.010) [-537.040] -- 0:00:32
      500000 -- (-534.394) (-536.745) [-532.535] (-532.210) * (-533.068) (-539.539) [-534.413] (-533.421) -- 0:00:32

      Average standard deviation of split frequencies: 0.011243

      500500 -- (-535.951) (-536.605) [-534.874] (-532.341) * (-536.573) (-534.587) (-538.432) [-533.297] -- 0:00:31
      501000 -- (-533.305) (-532.679) (-533.793) [-533.488] * (-538.061) [-537.048] (-532.891) (-534.730) -- 0:00:31
      501500 -- (-533.751) (-534.526) (-537.356) [-532.847] * (-532.003) [-533.212] (-537.592) (-534.459) -- 0:00:31
      502000 -- (-532.951) (-534.592) (-537.408) [-532.316] * (-537.345) (-532.405) (-536.202) [-532.633] -- 0:00:31
      502500 -- (-533.923) (-533.227) (-534.398) [-537.175] * (-536.180) (-533.240) (-534.997) [-537.283] -- 0:00:31
      503000 -- (-534.944) [-532.431] (-536.710) (-536.932) * (-537.573) (-533.719) (-532.152) [-532.942] -- 0:00:31
      503500 -- (-532.879) (-533.478) (-537.309) [-532.473] * (-532.647) [-532.230] (-532.922) (-532.038) -- 0:00:31
      504000 -- (-534.475) [-533.065] (-532.917) (-532.806) * (-536.829) (-535.137) [-532.896] (-534.480) -- 0:00:31
      504500 -- (-531.997) (-534.187) [-533.193] (-535.191) * (-533.480) (-532.950) [-534.578] (-537.394) -- 0:00:31
      505000 -- [-533.124] (-533.594) (-535.096) (-537.755) * (-534.412) (-532.134) [-533.475] (-532.950) -- 0:00:31

      Average standard deviation of split frequencies: 0.010632

      505500 -- (-535.074) [-532.685] (-533.679) (-535.946) * (-533.144) (-534.349) (-537.929) [-532.404] -- 0:00:31
      506000 -- (-534.224) [-533.840] (-533.777) (-535.917) * [-532.033] (-533.556) (-539.852) (-534.355) -- 0:00:31
      506500 -- (-532.461) (-531.894) [-533.500] (-537.890) * [-531.742] (-533.251) (-533.822) (-533.345) -- 0:00:31
      507000 -- (-531.863) (-537.351) (-534.442) [-534.365] * [-531.892] (-533.152) (-532.134) (-536.710) -- 0:00:31
      507500 -- (-533.773) (-534.410) [-537.480] (-537.545) * (-532.507) [-532.711] (-532.132) (-540.113) -- 0:00:31
      508000 -- (-534.076) (-533.108) [-533.194] (-534.059) * [-535.050] (-532.846) (-531.985) (-540.038) -- 0:00:30
      508500 -- [-534.170] (-534.827) (-541.204) (-532.725) * (-538.099) (-533.163) (-533.750) [-533.495] -- 0:00:30
      509000 -- [-532.329] (-534.855) (-536.113) (-536.717) * (-538.941) [-532.151] (-534.995) (-534.271) -- 0:00:30
      509500 -- (-534.466) [-538.256] (-537.427) (-539.754) * (-533.023) [-534.324] (-532.397) (-533.313) -- 0:00:30
      510000 -- [-536.153] (-534.732) (-534.669) (-533.535) * [-531.711] (-533.879) (-532.301) (-531.759) -- 0:00:30

      Average standard deviation of split frequencies: 0.010860

      510500 -- (-533.801) [-533.657] (-533.042) (-533.560) * (-532.664) (-533.838) [-534.094] (-536.107) -- 0:00:30
      511000 -- (-533.749) (-532.439) (-532.257) [-533.212] * (-532.678) [-535.653] (-534.303) (-533.046) -- 0:00:30
      511500 -- (-531.750) (-531.618) [-531.798] (-539.691) * (-533.767) [-534.756] (-535.508) (-535.015) -- 0:00:30
      512000 -- (-536.108) [-532.272] (-532.193) (-536.166) * [-531.898] (-534.309) (-534.232) (-537.757) -- 0:00:30
      512500 -- (-537.560) (-531.985) (-533.214) [-534.184] * (-534.590) (-535.305) (-534.161) [-532.603] -- 0:00:30
      513000 -- (-533.997) (-536.528) (-532.123) [-533.885] * (-533.817) (-534.430) (-534.673) [-532.183] -- 0:00:30
      513500 -- [-533.058] (-534.507) (-532.983) (-534.846) * (-534.905) (-535.227) (-535.392) [-532.447] -- 0:00:30
      514000 -- (-535.933) [-535.646] (-533.781) (-533.524) * (-534.553) (-539.040) [-535.694] (-536.626) -- 0:00:30
      514500 -- (-534.832) (-532.981) (-535.642) [-532.268] * [-535.436] (-537.044) (-535.487) (-535.833) -- 0:00:30
      515000 -- (-533.988) (-534.191) (-536.690) [-535.416] * [-534.463] (-535.129) (-533.460) (-536.915) -- 0:00:30

      Average standard deviation of split frequencies: 0.011318

      515500 -- (-535.210) [-532.033] (-540.953) (-536.200) * (-533.416) (-533.921) [-533.274] (-532.126) -- 0:00:31
      516000 -- (-538.394) (-533.192) [-534.311] (-534.214) * (-535.259) (-533.332) (-532.325) [-533.749] -- 0:00:30
      516500 -- (-535.324) [-535.070] (-533.079) (-534.731) * [-535.275] (-534.814) (-536.357) (-533.204) -- 0:00:30
      517000 -- [-533.715] (-532.168) (-533.234) (-532.653) * (-537.365) [-536.468] (-535.223) (-538.901) -- 0:00:30
      517500 -- [-533.491] (-535.044) (-531.661) (-536.677) * (-534.516) (-534.082) [-532.469] (-532.982) -- 0:00:30
      518000 -- (-535.634) [-531.641] (-533.210) (-534.509) * (-539.084) (-537.110) (-531.650) [-532.362] -- 0:00:30
      518500 -- (-534.657) (-535.806) (-534.583) [-536.309] * (-534.503) (-533.366) [-534.751] (-532.468) -- 0:00:30
      519000 -- (-533.063) (-533.252) (-531.925) [-532.055] * [-532.525] (-534.901) (-531.919) (-535.414) -- 0:00:30
      519500 -- (-536.503) (-536.612) (-531.787) [-534.757] * (-534.944) (-536.112) [-534.936] (-538.811) -- 0:00:30
      520000 -- (-533.043) (-534.709) (-531.849) [-535.326] * (-534.916) (-534.728) (-536.846) [-534.964] -- 0:00:30

      Average standard deviation of split frequencies: 0.011519

      520500 -- (-537.583) [-533.156] (-531.846) (-532.604) * (-534.373) (-532.287) (-536.469) [-533.293] -- 0:00:30
      521000 -- [-531.856] (-535.606) (-531.721) (-534.045) * (-533.501) (-538.844) [-536.570] (-533.380) -- 0:00:30
      521500 -- (-532.306) (-532.560) [-533.027] (-537.679) * (-533.930) (-535.654) (-537.692) [-534.586] -- 0:00:30
      522000 -- (-534.912) (-534.515) (-532.762) [-533.736] * (-538.751) [-532.529] (-534.581) (-532.095) -- 0:00:30
      522500 -- (-533.109) (-533.804) [-534.589] (-535.419) * (-535.231) (-536.136) [-533.356] (-532.548) -- 0:00:30
      523000 -- (-536.327) [-532.454] (-533.696) (-533.719) * (-532.517) (-534.819) (-532.782) [-531.978] -- 0:00:30
      523500 -- [-533.172] (-532.333) (-531.861) (-537.166) * (-532.556) (-532.623) [-534.114] (-533.879) -- 0:00:30
      524000 -- (-539.668) (-534.017) (-537.353) [-531.643] * [-533.312] (-532.348) (-536.885) (-539.786) -- 0:00:29
      524500 -- [-537.029] (-535.756) (-536.084) (-531.717) * (-537.490) [-532.887] (-537.917) (-535.200) -- 0:00:29
      525000 -- (-538.659) (-537.067) [-533.660] (-534.460) * (-533.463) (-536.908) (-536.759) [-536.392] -- 0:00:29

      Average standard deviation of split frequencies: 0.011900

      525500 -- (-538.850) [-535.173] (-533.788) (-533.445) * (-536.910) (-534.245) (-532.698) [-535.371] -- 0:00:29
      526000 -- [-533.324] (-540.389) (-534.891) (-533.428) * (-536.350) [-533.224] (-533.370) (-531.809) -- 0:00:29
      526500 -- (-532.159) (-534.178) [-539.116] (-534.786) * (-533.021) (-539.082) (-534.481) [-531.823] -- 0:00:29
      527000 -- (-534.761) [-534.775] (-537.281) (-536.157) * (-532.514) (-532.188) [-533.589] (-532.580) -- 0:00:29
      527500 -- (-532.129) (-540.879) (-534.014) [-532.257] * (-533.216) [-538.183] (-533.366) (-533.210) -- 0:00:29
      528000 -- (-533.884) (-532.508) [-534.662] (-534.130) * (-534.719) (-537.349) (-534.411) [-532.017] -- 0:00:29
      528500 -- [-533.641] (-532.800) (-532.618) (-534.543) * (-534.866) (-535.784) (-531.602) [-534.938] -- 0:00:29
      529000 -- (-532.237) [-532.852] (-532.803) (-532.917) * [-534.248] (-534.129) (-532.796) (-533.318) -- 0:00:29
      529500 -- (-534.605) (-534.235) (-532.636) [-532.599] * (-531.965) (-533.835) [-533.593] (-533.200) -- 0:00:29
      530000 -- [-531.963] (-538.959) (-531.824) (-533.301) * [-535.063] (-534.463) (-534.891) (-534.432) -- 0:00:29

      Average standard deviation of split frequencies: 0.012332

      530500 -- [-533.895] (-537.047) (-534.498) (-534.529) * [-537.813] (-535.860) (-534.788) (-534.500) -- 0:00:29
      531000 -- (-535.103) (-532.737) [-532.895] (-534.521) * (-536.356) [-534.382] (-535.660) (-535.509) -- 0:00:29
      531500 -- [-533.036] (-534.660) (-534.503) (-534.387) * (-537.176) (-535.677) [-534.802] (-534.026) -- 0:00:29
      532000 -- (-533.544) [-535.904] (-537.114) (-532.124) * (-533.777) [-533.256] (-533.668) (-532.513) -- 0:00:29
      532500 -- (-533.032) [-531.967] (-533.720) (-531.956) * (-533.973) (-532.641) (-532.136) [-531.949] -- 0:00:29
      533000 -- (-531.886) (-536.742) (-537.025) [-533.030] * [-534.798] (-533.282) (-532.393) (-534.291) -- 0:00:29
      533500 -- [-533.441] (-533.079) (-536.667) (-532.094) * (-535.293) (-534.083) [-534.549] (-534.069) -- 0:00:29
      534000 -- (-536.350) (-535.326) (-535.182) [-532.606] * (-532.473) [-533.530] (-533.343) (-532.477) -- 0:00:29
      534500 -- [-535.701] (-534.005) (-534.992) (-533.961) * (-534.081) (-533.132) (-533.450) [-532.943] -- 0:00:29
      535000 -- (-535.891) [-533.836] (-533.417) (-534.908) * (-534.109) (-532.420) [-534.139] (-535.017) -- 0:00:29

      Average standard deviation of split frequencies: 0.012158

      535500 -- (-537.084) [-536.749] (-533.141) (-537.588) * (-534.519) (-534.794) (-534.874) [-533.121] -- 0:00:29
      536000 -- [-537.529] (-534.223) (-533.419) (-537.402) * (-532.108) (-534.189) [-533.321] (-532.649) -- 0:00:29
      536500 -- (-534.512) [-534.600] (-533.432) (-536.452) * (-534.247) [-534.025] (-536.278) (-534.370) -- 0:00:29
      537000 -- [-535.779] (-536.578) (-534.105) (-536.159) * [-532.411] (-537.001) (-537.926) (-535.493) -- 0:00:29
      537500 -- (-533.229) [-535.124] (-533.214) (-535.670) * (-531.976) (-535.605) (-536.631) [-534.043] -- 0:00:29
      538000 -- (-538.151) (-535.920) [-533.068] (-532.876) * (-533.135) [-535.966] (-533.471) (-533.258) -- 0:00:29
      538500 -- (-534.709) (-534.625) (-534.689) [-533.527] * (-533.604) [-534.249] (-532.411) (-532.769) -- 0:00:29
      539000 -- (-533.121) [-535.801] (-535.570) (-533.869) * (-533.822) (-532.643) (-532.843) [-533.943] -- 0:00:29
      539500 -- (-533.249) [-532.590] (-536.619) (-537.163) * [-533.788] (-535.178) (-532.968) (-533.200) -- 0:00:29
      540000 -- (-532.320) (-533.187) (-532.511) [-534.733] * (-532.979) (-533.548) [-532.617] (-533.740) -- 0:00:28

      Average standard deviation of split frequencies: 0.012104

      540500 -- (-532.810) (-532.827) (-534.411) [-533.411] * [-533.706] (-537.533) (-534.612) (-537.871) -- 0:00:28
      541000 -- (-535.163) [-534.474] (-532.728) (-535.207) * (-534.935) [-535.953] (-532.284) (-534.452) -- 0:00:28
      541500 -- (-535.163) [-532.218] (-534.750) (-533.450) * (-536.961) (-537.062) [-532.626] (-532.380) -- 0:00:28
      542000 -- [-533.185] (-536.155) (-534.743) (-539.646) * (-532.913) (-533.777) (-535.010) [-531.903] -- 0:00:28
      542500 -- (-532.883) [-533.059] (-532.050) (-533.722) * (-533.375) (-539.059) (-533.302) [-534.525] -- 0:00:28
      543000 -- (-534.131) (-536.197) [-532.757] (-537.323) * (-533.054) (-539.935) [-532.158] (-538.940) -- 0:00:28
      543500 -- [-532.113] (-532.823) (-534.199) (-533.717) * [-534.227] (-534.458) (-534.002) (-541.381) -- 0:00:28
      544000 -- [-534.356] (-533.877) (-534.838) (-535.014) * (-535.112) (-533.847) (-534.721) [-532.715] -- 0:00:28
      544500 -- (-533.209) [-533.573] (-536.167) (-535.083) * (-535.018) (-531.928) [-534.141] (-534.192) -- 0:00:28
      545000 -- (-536.816) (-533.130) [-536.057] (-534.595) * (-537.028) (-533.471) (-533.795) [-533.738] -- 0:00:28

      Average standard deviation of split frequencies: 0.011986

      545500 -- (-534.518) (-535.973) [-534.594] (-534.103) * [-531.496] (-535.040) (-536.503) (-532.108) -- 0:00:28
      546000 -- [-533.835] (-532.324) (-534.808) (-535.644) * (-532.098) (-531.722) [-533.093] (-532.273) -- 0:00:28
      546500 -- (-538.583) (-534.233) [-532.194] (-534.992) * (-535.007) (-533.056) [-531.877] (-532.112) -- 0:00:28
      547000 -- (-532.812) [-532.866] (-532.423) (-535.874) * (-533.152) (-533.006) (-537.677) [-533.000] -- 0:00:28
      547500 -- (-533.150) [-532.461] (-533.610) (-535.156) * (-531.964) [-535.664] (-536.992) (-533.836) -- 0:00:28
      548000 -- (-531.644) (-532.889) (-534.477) [-531.850] * [-534.166] (-534.291) (-536.416) (-540.918) -- 0:00:28
      548500 -- (-532.026) (-533.414) [-533.510] (-535.689) * [-533.267] (-533.138) (-533.568) (-540.734) -- 0:00:27
      549000 -- [-532.440] (-534.311) (-533.667) (-531.917) * (-532.747) (-532.893) (-535.528) [-532.047] -- 0:00:28
      549500 -- (-534.808) [-533.840] (-533.233) (-534.776) * [-532.833] (-532.782) (-532.578) (-535.348) -- 0:00:28
      550000 -- (-540.528) [-540.380] (-534.058) (-533.899) * (-533.308) (-535.151) (-532.943) [-531.562] -- 0:00:28

      Average standard deviation of split frequencies: 0.011632

      550500 -- (-534.508) (-534.857) (-540.559) [-537.292] * (-533.289) (-537.029) [-532.981] (-534.185) -- 0:00:28
      551000 -- (-535.311) (-532.429) (-537.953) [-531.823] * [-533.820] (-534.545) (-532.786) (-540.694) -- 0:00:28
      551500 -- (-531.662) (-535.554) [-534.770] (-534.375) * (-533.872) (-534.761) [-533.289] (-535.564) -- 0:00:28
      552000 -- (-533.107) (-533.932) [-532.097] (-534.286) * (-531.463) (-533.834) (-534.061) [-534.719] -- 0:00:28
      552500 -- [-532.552] (-534.066) (-532.556) (-533.910) * (-531.961) (-533.500) [-533.967] (-532.557) -- 0:00:28
      553000 -- (-534.374) (-537.729) (-533.406) [-532.192] * (-535.596) [-532.026] (-534.115) (-535.293) -- 0:00:28
      553500 -- (-535.027) (-532.252) [-532.672] (-533.919) * [-533.061] (-535.350) (-532.641) (-534.713) -- 0:00:28
      554000 -- (-533.439) [-533.414] (-532.452) (-534.903) * (-531.600) (-533.262) [-532.412] (-533.092) -- 0:00:28
      554500 -- (-532.034) (-534.245) [-532.410] (-533.353) * (-532.716) [-535.772] (-532.384) (-532.413) -- 0:00:28
      555000 -- (-533.285) [-533.940] (-531.775) (-537.055) * (-533.571) [-538.914] (-535.154) (-531.972) -- 0:00:28

      Average standard deviation of split frequencies: 0.011393

      555500 -- (-533.176) (-532.852) [-534.858] (-535.586) * (-536.626) [-533.294] (-538.029) (-532.329) -- 0:00:28
      556000 -- (-533.170) [-533.884] (-532.412) (-533.993) * (-537.398) (-537.464) (-535.225) [-533.173] -- 0:00:27
      556500 -- (-533.138) (-535.175) (-534.818) [-533.982] * (-533.142) (-537.800) (-532.112) [-535.917] -- 0:00:27
      557000 -- (-532.982) [-533.902] (-534.594) (-532.303) * (-536.494) (-538.045) [-533.818] (-534.376) -- 0:00:27
      557500 -- (-535.047) (-532.735) (-533.784) [-532.240] * (-534.747) (-535.461) [-533.556] (-533.513) -- 0:00:27
      558000 -- (-534.331) [-532.283] (-532.725) (-532.380) * [-534.700] (-536.468) (-533.364) (-532.517) -- 0:00:27
      558500 -- (-536.711) (-532.083) [-533.720] (-533.157) * (-534.685) (-535.075) (-536.501) [-534.026] -- 0:00:27
      559000 -- [-533.399] (-537.337) (-534.866) (-536.018) * (-536.892) (-533.282) (-534.399) [-532.118] -- 0:00:27
      559500 -- (-531.639) (-532.688) [-534.340] (-537.191) * [-535.642] (-534.706) (-533.921) (-534.648) -- 0:00:27
      560000 -- (-533.073) (-535.358) (-532.566) [-533.976] * (-532.385) [-533.562] (-533.503) (-537.538) -- 0:00:27

      Average standard deviation of split frequencies: 0.011246

      560500 -- [-534.258] (-535.787) (-535.501) (-535.206) * [-532.139] (-533.561) (-533.461) (-539.598) -- 0:00:27
      561000 -- (-536.185) (-532.897) [-532.359] (-532.216) * [-534.704] (-534.175) (-533.850) (-535.715) -- 0:00:27
      561500 -- (-532.765) (-532.787) (-533.154) [-534.051] * (-533.454) (-532.229) (-532.585) [-533.804] -- 0:00:27
      562000 -- (-535.075) [-532.400] (-534.867) (-533.433) * (-533.366) (-532.453) [-533.207] (-531.662) -- 0:00:27
      562500 -- (-533.907) (-535.125) [-532.268] (-534.018) * (-537.481) (-532.664) (-534.757) [-535.452] -- 0:00:27
      563000 -- (-534.612) [-535.153] (-537.655) (-532.194) * (-534.357) [-536.251] (-536.292) (-537.239) -- 0:00:27
      563500 -- (-533.554) (-534.715) (-532.849) [-533.486] * [-536.399] (-532.590) (-533.758) (-536.084) -- 0:00:27
      564000 -- (-532.211) (-533.760) (-532.448) [-532.645] * (-537.327) (-531.918) [-536.581] (-535.842) -- 0:00:27
      564500 -- [-532.330] (-534.949) (-534.889) (-531.703) * (-537.826) (-531.757) (-534.062) [-536.141] -- 0:00:27
      565000 -- (-532.678) (-532.236) [-533.522] (-531.692) * [-533.974] (-531.777) (-534.201) (-534.661) -- 0:00:27

      Average standard deviation of split frequencies: 0.011400

      565500 -- (-532.683) [-532.872] (-533.073) (-536.975) * (-534.059) (-536.596) [-539.578] (-533.145) -- 0:00:27
      566000 -- (-532.681) (-532.268) [-533.837] (-539.301) * [-531.668] (-535.020) (-535.584) (-533.497) -- 0:00:27
      566500 -- (-534.930) (-533.355) (-535.118) [-533.244] * (-533.838) [-532.777] (-542.995) (-531.820) -- 0:00:27
      567000 -- (-533.359) [-531.432] (-537.413) (-542.013) * (-534.373) (-533.264) (-533.126) [-534.408] -- 0:00:27
      567500 -- (-532.769) [-532.644] (-537.151) (-538.410) * [-533.683] (-534.767) (-532.658) (-534.982) -- 0:00:27
      568000 -- (-534.122) (-531.933) (-533.271) [-534.088] * (-532.472) (-533.090) [-533.631] (-538.906) -- 0:00:27
      568500 -- (-533.289) (-534.901) (-534.031) [-532.243] * (-534.862) (-533.582) (-534.569) [-532.367] -- 0:00:27
      569000 -- [-533.048] (-534.734) (-533.936) (-532.997) * (-535.386) (-534.008) (-534.197) [-534.309] -- 0:00:27
      569500 -- [-532.879] (-533.493) (-533.850) (-536.006) * (-534.382) (-535.237) [-534.377] (-532.612) -- 0:00:27
      570000 -- (-532.087) [-535.357] (-535.586) (-533.999) * (-537.014) [-532.157] (-534.483) (-532.797) -- 0:00:27

      Average standard deviation of split frequencies: 0.010636

      570500 -- [-531.642] (-533.238) (-532.730) (-534.239) * (-533.643) (-534.599) [-534.130] (-535.606) -- 0:00:27
      571000 -- (-532.456) [-532.452] (-534.841) (-535.960) * (-535.855) [-535.222] (-532.798) (-534.536) -- 0:00:27
      571500 -- (-536.190) [-533.721] (-536.652) (-533.152) * [-532.983] (-535.433) (-534.366) (-533.715) -- 0:00:26
      572000 -- (-532.344) [-532.084] (-533.679) (-538.435) * (-532.500) (-534.982) (-534.800) [-534.333] -- 0:00:26
      572500 -- (-533.469) (-531.891) [-532.340] (-535.756) * (-536.847) [-531.961] (-531.746) (-534.858) -- 0:00:26
      573000 -- [-534.013] (-537.012) (-535.227) (-531.970) * (-538.048) (-535.427) [-534.221] (-535.218) -- 0:00:26
      573500 -- [-537.427] (-535.996) (-533.774) (-535.088) * (-535.423) (-533.350) [-533.352] (-535.741) -- 0:00:26
      574000 -- [-536.318] (-535.854) (-532.627) (-535.411) * (-532.245) [-533.570] (-533.884) (-534.321) -- 0:00:26
      574500 -- (-535.288) [-534.592] (-536.176) (-534.783) * (-532.388) (-533.683) (-533.569) [-534.233] -- 0:00:26
      575000 -- [-533.274] (-532.984) (-534.274) (-532.410) * (-534.510) (-533.170) (-535.126) [-533.442] -- 0:00:26

      Average standard deviation of split frequencies: 0.009974

      575500 -- (-533.983) (-534.073) (-534.510) [-532.064] * (-534.870) (-537.847) [-534.135] (-534.962) -- 0:00:26
      576000 -- (-534.032) [-533.640] (-534.359) (-533.535) * [-533.284] (-534.572) (-533.214) (-535.655) -- 0:00:26
      576500 -- (-534.521) [-535.589] (-533.619) (-536.575) * (-533.341) (-536.586) [-534.427] (-534.504) -- 0:00:26
      577000 -- (-533.754) (-538.607) [-535.340] (-535.934) * [-532.187] (-531.983) (-534.850) (-535.213) -- 0:00:26
      577500 -- (-533.161) (-534.475) (-532.565) [-535.368] * [-535.989] (-532.267) (-534.543) (-535.832) -- 0:00:26
      578000 -- (-532.478) [-531.507] (-533.114) (-533.278) * (-534.407) [-532.362] (-533.054) (-533.875) -- 0:00:26
      578500 -- (-533.363) (-533.527) [-532.779] (-537.242) * (-533.125) (-533.068) (-532.074) [-532.010] -- 0:00:26
      579000 -- (-534.281) (-532.529) [-534.924] (-535.948) * (-532.941) [-533.548] (-535.277) (-532.777) -- 0:00:26
      579500 -- [-533.390] (-532.068) (-533.443) (-536.902) * (-532.661) [-533.997] (-532.954) (-532.977) -- 0:00:26
      580000 -- (-535.900) [-532.805] (-534.887) (-536.710) * (-533.301) (-532.142) [-531.904] (-536.315) -- 0:00:26

      Average standard deviation of split frequencies: 0.009590

      580500 -- (-533.773) (-532.295) (-536.018) [-533.960] * (-534.638) [-535.555] (-533.491) (-534.766) -- 0:00:26
      581000 -- (-536.154) [-532.555] (-532.446) (-534.191) * (-536.449) [-534.864] (-536.177) (-539.028) -- 0:00:26
      581500 -- (-534.793) (-533.075) [-532.028] (-531.621) * (-535.514) [-535.034] (-538.101) (-536.325) -- 0:00:26
      582000 -- (-533.178) (-535.882) (-531.854) [-534.594] * (-534.158) (-534.112) (-534.778) [-537.230] -- 0:00:26
      582500 -- (-533.587) (-533.113) (-537.751) [-533.626] * (-532.456) [-532.053] (-535.421) (-533.139) -- 0:00:26
      583000 -- (-531.603) [-532.815] (-536.487) (-534.195) * (-532.259) [-532.780] (-534.163) (-536.716) -- 0:00:26
      583500 -- (-533.468) [-533.085] (-534.807) (-534.778) * (-536.518) (-534.936) [-532.982] (-536.421) -- 0:00:26
      584000 -- (-533.479) (-535.652) (-534.708) [-535.275] * (-533.420) [-533.944] (-532.368) (-540.175) -- 0:00:26
      584500 -- [-536.862] (-536.070) (-537.459) (-532.934) * (-533.563) (-534.012) [-532.530] (-535.280) -- 0:00:26
      585000 -- (-532.495) (-536.238) [-532.353] (-533.898) * [-538.087] (-533.102) (-534.810) (-532.900) -- 0:00:26

      Average standard deviation of split frequencies: 0.009511

      585500 -- (-533.193) [-534.327] (-534.341) (-536.590) * (-536.663) [-532.966] (-534.546) (-532.396) -- 0:00:26
      586000 -- (-534.294) (-538.586) [-534.576] (-534.044) * (-534.067) [-534.647] (-533.062) (-532.224) -- 0:00:26
      586500 -- (-534.053) (-534.839) (-534.529) [-533.185] * (-535.204) (-536.099) (-534.420) [-532.675] -- 0:00:26
      587000 -- (-533.681) (-532.879) (-534.781) [-533.284] * (-535.979) (-536.128) (-533.059) [-532.818] -- 0:00:26
      587500 -- (-532.709) (-532.435) [-533.268] (-537.157) * (-535.131) (-535.008) [-534.325] (-532.254) -- 0:00:25
      588000 -- [-532.503] (-535.067) (-533.725) (-534.869) * (-532.136) (-542.274) (-536.503) [-534.383] -- 0:00:25
      588500 -- (-533.446) (-534.807) (-533.921) [-533.796] * (-533.291) (-533.328) (-534.556) [-533.448] -- 0:00:25
      589000 -- [-533.029] (-534.380) (-531.638) (-534.318) * [-535.594] (-536.526) (-537.016) (-534.238) -- 0:00:25
      589500 -- [-531.997] (-536.118) (-537.889) (-534.566) * (-533.366) (-533.940) [-535.127] (-533.913) -- 0:00:25
      590000 -- (-532.058) (-535.668) (-534.888) [-532.651] * [-533.068] (-533.759) (-538.168) (-533.512) -- 0:00:25

      Average standard deviation of split frequencies: 0.009859

      590500 -- [-531.938] (-535.288) (-534.077) (-535.067) * (-534.030) (-535.372) (-535.196) [-534.112] -- 0:00:25
      591000 -- [-534.130] (-534.694) (-534.126) (-533.299) * (-534.238) [-534.792] (-533.019) (-535.873) -- 0:00:25
      591500 -- (-535.127) (-532.457) [-538.199] (-534.518) * (-533.148) [-532.640] (-532.673) (-534.919) -- 0:00:25
      592000 -- [-532.059] (-532.649) (-534.065) (-538.895) * [-532.164] (-538.083) (-532.250) (-533.036) -- 0:00:25
      592500 -- (-537.276) [-533.920] (-534.748) (-533.731) * [-534.105] (-533.579) (-536.194) (-532.324) -- 0:00:25
      593000 -- (-534.609) [-534.430] (-536.895) (-539.433) * (-534.179) [-536.644] (-534.893) (-532.642) -- 0:00:25
      593500 -- (-533.374) (-537.592) [-536.163] (-533.281) * (-533.291) (-532.609) (-533.960) [-539.374] -- 0:00:25
      594000 -- (-532.337) (-534.100) [-532.340] (-533.421) * (-533.198) [-534.446] (-532.553) (-535.637) -- 0:00:25
      594500 -- [-532.397] (-535.178) (-533.598) (-532.842) * (-533.497) (-532.331) (-532.364) [-536.866] -- 0:00:25
      595000 -- (-532.958) (-533.451) (-532.326) [-534.331] * (-531.888) [-533.543] (-533.563) (-532.064) -- 0:00:25

      Average standard deviation of split frequencies: 0.009817

      595500 -- [-539.542] (-533.367) (-535.267) (-537.069) * [-532.670] (-533.089) (-534.434) (-534.328) -- 0:00:25
      596000 -- (-536.680) [-533.202] (-532.619) (-533.548) * [-533.715] (-533.249) (-535.588) (-534.958) -- 0:00:25
      596500 -- [-534.075] (-537.132) (-534.555) (-532.905) * (-534.318) [-533.783] (-534.049) (-533.514) -- 0:00:25
      597000 -- (-535.369) (-534.811) (-535.484) [-532.075] * (-532.063) [-534.178] (-535.349) (-533.167) -- 0:00:25
      597500 -- [-535.185] (-534.535) (-531.822) (-533.387) * (-531.737) [-531.886] (-533.593) (-533.007) -- 0:00:25
      598000 -- (-533.948) (-533.440) [-532.981] (-535.725) * (-535.245) (-535.444) [-536.275] (-532.218) -- 0:00:25
      598500 -- (-533.646) [-532.630] (-537.723) (-531.413) * (-534.011) [-536.322] (-533.644) (-533.748) -- 0:00:25
      599000 -- (-532.229) [-533.164] (-532.954) (-536.565) * (-533.049) [-535.432] (-531.878) (-532.318) -- 0:00:25
      599500 -- [-532.940] (-533.648) (-533.742) (-534.314) * (-533.335) (-533.939) [-531.775] (-533.872) -- 0:00:25
      600000 -- (-536.155) (-533.068) [-533.257] (-537.658) * (-533.757) [-534.001] (-533.678) (-534.174) -- 0:00:25

      Average standard deviation of split frequencies: 0.009741

      600500 -- (-533.049) (-534.270) [-532.550] (-532.478) * (-535.995) (-534.975) [-533.523] (-536.233) -- 0:00:25
      601000 -- (-537.824) (-534.496) (-531.988) [-533.668] * (-535.649) (-533.590) (-540.297) [-534.058] -- 0:00:25
      601500 -- (-532.764) (-534.548) (-532.391) [-535.267] * (-534.684) (-532.667) (-536.981) [-534.647] -- 0:00:25
      602000 -- [-531.827] (-534.412) (-533.105) (-534.370) * (-534.549) (-532.565) [-535.065] (-534.550) -- 0:00:25
      602500 -- (-532.886) [-533.693] (-533.921) (-534.287) * (-533.417) (-532.800) (-533.691) [-533.417] -- 0:00:25
      603000 -- (-536.081) (-533.822) [-533.294] (-533.720) * (-533.267) (-532.597) (-531.994) [-532.001] -- 0:00:25
      603500 -- (-533.694) (-535.867) [-534.916] (-538.448) * (-537.029) (-533.194) [-536.109] (-535.656) -- 0:00:24
      604000 -- [-533.393] (-534.599) (-532.799) (-534.338) * (-537.212) (-535.005) [-533.235] (-540.802) -- 0:00:24
      604500 -- (-535.558) (-533.713) (-535.831) [-532.853] * [-533.459] (-536.389) (-539.656) (-536.401) -- 0:00:24
      605000 -- (-534.362) (-532.958) (-537.617) [-532.616] * (-531.834) [-535.651] (-533.310) (-534.034) -- 0:00:24

      Average standard deviation of split frequencies: 0.010158

      605500 -- (-532.825) (-531.860) [-535.012] (-533.177) * (-531.834) [-539.192] (-535.032) (-533.937) -- 0:00:24
      606000 -- [-532.492] (-532.398) (-532.209) (-535.168) * (-534.969) (-535.527) [-535.160] (-533.493) -- 0:00:24
      606500 -- (-536.076) (-533.032) [-532.905] (-532.069) * (-532.642) [-534.718] (-536.858) (-534.347) -- 0:00:24
      607000 -- (-534.355) (-532.630) [-536.706] (-531.813) * [-532.146] (-535.168) (-535.443) (-534.334) -- 0:00:24
      607500 -- (-535.489) (-532.658) [-534.224] (-532.480) * (-534.091) [-535.386] (-534.627) (-535.220) -- 0:00:24
      608000 -- (-533.301) [-539.902] (-533.513) (-532.789) * (-538.545) (-532.316) [-532.090] (-541.629) -- 0:00:24
      608500 -- (-535.312) (-532.398) (-535.173) [-532.763] * (-533.095) [-532.054] (-533.824) (-535.359) -- 0:00:24
      609000 -- (-534.445) (-533.107) [-533.827] (-533.364) * [-537.132] (-537.741) (-533.410) (-532.697) -- 0:00:24
      609500 -- (-533.366) (-538.020) [-531.935] (-534.510) * (-533.328) (-532.121) (-531.829) [-537.552] -- 0:00:24
      610000 -- [-534.403] (-535.561) (-532.563) (-539.055) * [-532.557] (-533.408) (-533.923) (-535.211) -- 0:00:24

      Average standard deviation of split frequencies: 0.010518

      610500 -- [-534.240] (-533.741) (-532.779) (-534.632) * (-535.464) [-533.895] (-537.833) (-531.948) -- 0:00:24
      611000 -- [-533.444] (-534.927) (-533.290) (-538.101) * (-534.134) (-533.728) (-535.625) [-531.652] -- 0:00:24
      611500 -- (-533.288) (-537.960) (-534.542) [-533.680] * (-532.079) (-536.159) (-535.423) [-534.539] -- 0:00:24
      612000 -- (-533.780) (-532.581) [-533.823] (-534.750) * [-532.481] (-533.339) (-532.924) (-532.556) -- 0:00:24
      612500 -- (-535.686) (-533.881) [-531.959] (-534.297) * (-534.201) (-532.910) [-533.896] (-532.927) -- 0:00:24
      613000 -- (-534.101) (-532.999) [-532.431] (-533.220) * (-535.159) (-537.551) [-532.033] (-534.353) -- 0:00:24
      613500 -- (-536.551) (-533.926) (-534.298) [-533.757] * (-531.870) (-536.032) (-532.884) [-532.005] -- 0:00:24
      614000 -- (-533.483) [-535.000] (-532.330) (-535.302) * (-531.888) [-533.513] (-533.146) (-534.096) -- 0:00:24
      614500 -- (-533.527) (-532.317) [-532.154] (-538.209) * (-535.265) (-534.237) [-535.340] (-533.474) -- 0:00:24
      615000 -- (-534.964) (-533.753) [-532.292] (-534.194) * (-534.120) (-533.491) (-535.954) [-532.703] -- 0:00:24

      Average standard deviation of split frequencies: 0.010092

      615500 -- (-534.848) (-533.740) [-532.534] (-533.013) * (-534.615) (-532.766) [-531.999] (-534.973) -- 0:00:24
      616000 -- (-535.544) [-536.155] (-533.197) (-533.087) * (-531.592) (-534.673) [-532.969] (-534.206) -- 0:00:24
      616500 -- (-533.904) [-532.919] (-535.065) (-533.403) * (-538.108) [-532.548] (-534.073) (-533.699) -- 0:00:24
      617000 -- (-536.474) (-532.762) [-534.439] (-533.019) * [-534.819] (-534.043) (-532.838) (-532.895) -- 0:00:24
      617500 -- (-542.658) (-532.653) [-535.411] (-533.683) * (-534.201) [-534.591] (-532.873) (-536.495) -- 0:00:24
      618000 -- (-531.760) [-532.680] (-535.562) (-532.237) * (-532.833) (-534.675) (-533.993) [-538.063] -- 0:00:24
      618500 -- (-531.908) (-537.073) [-533.023] (-533.742) * [-535.244] (-531.728) (-533.067) (-533.378) -- 0:00:24
      619000 -- [-531.510] (-534.764) (-534.376) (-536.424) * (-535.943) [-531.833] (-532.612) (-533.990) -- 0:00:24
      619500 -- (-531.816) (-532.356) [-531.622] (-535.434) * (-534.986) (-533.110) (-534.285) [-532.041] -- 0:00:23
      620000 -- (-533.972) (-537.070) [-533.795] (-536.420) * (-535.608) (-531.991) (-532.215) [-533.370] -- 0:00:23

      Average standard deviation of split frequencies: 0.010097

      620500 -- (-537.425) (-537.755) (-538.296) [-533.623] * (-532.042) (-532.948) (-534.046) [-532.613] -- 0:00:23
      621000 -- [-536.477] (-533.685) (-535.386) (-533.829) * (-535.130) (-535.618) [-532.039] (-534.322) -- 0:00:23
      621500 -- (-534.763) (-532.169) [-532.639] (-534.297) * (-534.814) (-534.838) (-533.071) [-532.809] -- 0:00:23
      622000 -- (-532.259) [-532.702] (-535.112) (-533.050) * (-534.604) (-536.429) [-533.769] (-532.655) -- 0:00:23
      622500 -- (-536.347) [-534.490] (-539.374) (-532.464) * (-534.432) (-535.094) (-534.470) [-535.045] -- 0:00:23
      623000 -- [-536.878] (-534.593) (-534.357) (-533.806) * [-531.797] (-533.348) (-533.257) (-531.929) -- 0:00:23
      623500 -- (-535.666) [-534.618] (-534.022) (-535.156) * (-535.562) (-534.725) [-535.754] (-532.612) -- 0:00:23
      624000 -- (-535.436) [-533.530] (-532.972) (-533.422) * (-533.605) (-536.067) (-535.499) [-534.569] -- 0:00:23
      624500 -- (-536.018) [-532.319] (-533.061) (-531.974) * (-534.583) [-534.351] (-532.817) (-536.699) -- 0:00:23
      625000 -- [-534.508] (-534.982) (-533.434) (-534.141) * (-535.269) (-533.867) [-532.767] (-535.476) -- 0:00:23

      Average standard deviation of split frequencies: 0.010498

      625500 -- [-534.273] (-535.379) (-533.485) (-536.267) * (-539.684) (-535.287) (-539.296) [-532.672] -- 0:00:23
      626000 -- (-533.647) (-533.542) (-532.829) [-533.451] * (-533.164) (-536.158) (-537.322) [-531.894] -- 0:00:23
      626500 -- (-535.287) [-539.685] (-534.933) (-539.621) * (-533.064) [-532.393] (-532.797) (-534.077) -- 0:00:23
      627000 -- (-534.940) [-534.913] (-536.675) (-533.017) * [-533.541] (-536.998) (-533.060) (-533.013) -- 0:00:23
      627500 -- (-536.689) (-533.124) (-533.472) [-533.131] * (-535.236) [-532.541] (-537.281) (-534.968) -- 0:00:23
      628000 -- (-534.698) (-535.889) (-533.661) [-535.076] * (-531.884) (-532.095) (-535.573) [-534.545] -- 0:00:23
      628500 -- (-534.510) (-532.142) (-539.625) [-537.873] * (-533.541) (-532.279) [-532.706] (-536.292) -- 0:00:23
      629000 -- (-536.083) (-531.902) [-534.389] (-540.302) * (-536.597) (-533.596) [-534.361] (-533.550) -- 0:00:23
      629500 -- (-532.053) [-531.891] (-532.338) (-532.966) * [-533.271] (-534.399) (-534.737) (-532.390) -- 0:00:23
      630000 -- (-532.486) (-533.484) (-532.027) [-531.965] * (-532.630) [-534.212] (-532.767) (-533.702) -- 0:00:23

      Average standard deviation of split frequencies: 0.010465

      630500 -- (-535.375) [-534.414] (-532.863) (-533.555) * [-532.454] (-533.152) (-534.145) (-531.828) -- 0:00:23
      631000 -- (-535.051) (-533.635) (-532.220) [-540.095] * (-536.825) (-536.922) [-535.587] (-534.333) -- 0:00:23
      631500 -- (-532.814) (-531.972) (-533.696) [-534.743] * (-534.045) (-533.172) [-534.080] (-532.310) -- 0:00:23
      632000 -- (-532.907) [-532.452] (-533.155) (-537.628) * (-534.975) (-533.288) [-533.879] (-532.861) -- 0:00:23
      632500 -- [-532.490] (-531.933) (-536.676) (-535.941) * (-535.137) (-532.572) [-536.654] (-534.866) -- 0:00:23
      633000 -- [-533.014] (-534.123) (-533.646) (-534.108) * (-536.225) [-532.424] (-532.337) (-536.082) -- 0:00:23
      633500 -- [-533.194] (-532.691) (-533.757) (-533.747) * (-532.112) (-533.603) [-532.269] (-535.148) -- 0:00:23
      634000 -- (-538.697) [-533.751] (-532.668) (-533.570) * (-532.044) [-534.217] (-532.649) (-533.075) -- 0:00:23
      634500 -- (-535.341) (-534.795) [-533.321] (-533.619) * (-537.810) [-533.809] (-532.181) (-533.669) -- 0:00:23
      635000 -- (-536.170) (-536.056) (-536.319) [-533.287] * (-536.179) (-535.164) (-537.999) [-532.990] -- 0:00:22

      Average standard deviation of split frequencies: 0.010886

      635500 -- [-533.895] (-532.630) (-536.132) (-532.897) * (-532.433) (-532.889) (-535.802) [-532.266] -- 0:00:22
      636000 -- (-534.887) [-536.021] (-535.155) (-532.383) * (-531.848) (-536.440) (-535.239) [-532.921] -- 0:00:22
      636500 -- (-533.699) [-534.786] (-534.630) (-532.287) * (-534.012) [-532.062] (-534.943) (-537.208) -- 0:00:22
      637000 -- (-534.508) (-535.604) (-536.308) [-533.069] * (-535.071) (-532.288) (-533.411) [-535.485] -- 0:00:22
      637500 -- [-535.628] (-535.489) (-535.228) (-533.347) * (-533.839) (-533.690) (-532.220) [-531.665] -- 0:00:22
      638000 -- (-531.852) (-535.456) [-532.135] (-532.650) * [-533.332] (-537.413) (-534.662) (-533.205) -- 0:00:22
      638500 -- (-536.879) [-533.770] (-533.935) (-535.154) * (-533.095) (-535.080) [-532.230] (-539.639) -- 0:00:22
      639000 -- [-532.882] (-533.603) (-532.894) (-535.262) * [-534.853] (-534.520) (-532.089) (-541.401) -- 0:00:22
      639500 -- (-535.278) [-536.314] (-533.527) (-533.011) * (-535.840) [-536.560] (-532.544) (-536.962) -- 0:00:22
      640000 -- (-533.781) (-533.449) (-534.566) [-532.530] * [-534.464] (-533.532) (-533.273) (-535.199) -- 0:00:22

      Average standard deviation of split frequencies: 0.010945

      640500 -- (-537.008) [-533.411] (-532.241) (-536.029) * [-535.067] (-533.751) (-533.572) (-533.411) -- 0:00:22
      641000 -- (-534.240) (-533.312) [-534.865] (-537.168) * (-534.932) (-534.334) [-532.280] (-533.762) -- 0:00:22
      641500 -- [-533.321] (-534.226) (-536.519) (-535.677) * (-535.788) [-532.816] (-537.700) (-534.096) -- 0:00:22
      642000 -- [-534.770] (-534.615) (-535.364) (-533.330) * (-533.343) (-533.019) (-534.971) [-534.145] -- 0:00:22
      642500 -- (-536.463) (-542.449) (-533.921) [-533.085] * (-538.298) [-532.843] (-534.962) (-534.703) -- 0:00:22
      643000 -- (-534.742) (-536.410) (-533.219) [-532.967] * (-536.641) (-535.066) [-535.105] (-536.626) -- 0:00:22
      643500 -- (-532.786) [-533.765] (-534.094) (-534.134) * [-532.719] (-533.055) (-533.361) (-533.229) -- 0:00:22
      644000 -- (-532.496) (-536.962) [-535.255] (-533.303) * [-535.292] (-533.384) (-532.950) (-532.857) -- 0:00:22
      644500 -- (-534.511) [-532.668] (-533.371) (-531.947) * [-534.646] (-534.561) (-534.741) (-533.606) -- 0:00:22
      645000 -- [-531.938] (-533.099) (-532.377) (-534.100) * (-532.352) (-536.149) (-540.872) [-531.662] -- 0:00:22

      Average standard deviation of split frequencies: 0.010581

      645500 -- (-532.214) (-535.559) [-533.469] (-533.608) * [-534.276] (-532.825) (-534.088) (-531.875) -- 0:00:22
      646000 -- (-535.529) (-535.504) (-532.736) [-535.991] * (-535.649) [-534.589] (-535.054) (-534.809) -- 0:00:22
      646500 -- (-537.697) [-534.715] (-532.953) (-535.069) * [-534.296] (-535.269) (-536.698) (-532.785) -- 0:00:22
      647000 -- (-533.210) [-535.364] (-534.665) (-532.638) * (-535.308) (-535.209) (-533.142) [-536.694] -- 0:00:22
      647500 -- (-533.794) [-536.541] (-533.063) (-537.989) * [-534.904] (-536.113) (-536.942) (-533.902) -- 0:00:22
      648000 -- (-536.759) [-534.484] (-533.471) (-536.488) * (-534.469) (-537.791) [-535.011] (-532.223) -- 0:00:22
      648500 -- (-533.106) [-533.193] (-534.008) (-535.607) * (-535.291) (-536.233) [-531.882] (-532.280) -- 0:00:22
      649000 -- [-532.929] (-532.199) (-532.058) (-534.122) * [-532.539] (-537.712) (-533.053) (-532.680) -- 0:00:22
      649500 -- (-533.156) (-532.410) [-533.549] (-535.197) * [-533.295] (-532.717) (-533.065) (-536.185) -- 0:00:22
      650000 -- (-533.102) (-533.626) (-532.285) [-532.372] * (-535.556) [-533.682] (-537.151) (-533.228) -- 0:00:22

      Average standard deviation of split frequencies: 0.010188

      650500 -- (-532.225) (-539.777) (-532.530) [-534.481] * [-533.404] (-533.440) (-536.176) (-532.347) -- 0:00:22
      651000 -- (-532.984) (-537.858) (-534.519) [-540.004] * (-538.490) (-533.619) (-534.993) [-535.131] -- 0:00:21
      651500 -- (-533.187) [-533.225] (-533.997) (-535.741) * (-539.767) (-532.254) [-533.395] (-532.350) -- 0:00:21
      652000 -- (-532.024) (-535.022) [-534.562] (-535.656) * (-534.158) (-532.641) [-532.480] (-534.031) -- 0:00:21
      652500 -- (-535.577) [-534.146] (-532.892) (-532.763) * (-533.311) (-531.573) (-532.469) [-534.943] -- 0:00:21
      653000 -- (-532.341) (-533.151) [-535.277] (-532.517) * [-539.240] (-532.905) (-532.739) (-533.645) -- 0:00:21
      653500 -- (-533.611) (-532.693) (-532.279) [-532.499] * (-532.565) [-531.906] (-532.006) (-538.251) -- 0:00:21
      654000 -- [-533.621] (-534.092) (-534.096) (-533.104) * (-533.436) (-534.183) [-533.705] (-536.773) -- 0:00:21
      654500 -- [-536.057] (-538.328) (-531.962) (-533.548) * (-534.615) (-533.609) (-540.642) [-536.073] -- 0:00:21
      655000 -- (-534.714) (-534.915) (-533.366) [-536.105] * [-536.177] (-535.317) (-533.937) (-533.245) -- 0:00:21

      Average standard deviation of split frequencies: 0.010195

      655500 -- [-535.188] (-535.223) (-536.792) (-536.561) * (-535.556) (-532.336) [-533.088] (-532.897) -- 0:00:21
      656000 -- (-532.735) (-533.493) [-533.236] (-537.242) * (-535.682) (-533.257) [-532.565] (-533.434) -- 0:00:21
      656500 -- (-532.754) [-535.654] (-532.977) (-536.131) * (-535.417) (-533.163) [-531.643] (-538.203) -- 0:00:21
      657000 -- (-532.556) (-534.952) (-532.666) [-533.767] * (-532.212) (-532.615) [-532.937] (-538.310) -- 0:00:21
      657500 -- (-533.749) [-532.275] (-540.573) (-534.921) * (-532.211) (-535.618) [-533.198] (-534.156) -- 0:00:21
      658000 -- [-534.064] (-532.138) (-538.526) (-532.976) * (-531.870) (-539.900) [-533.371] (-532.303) -- 0:00:21
      658500 -- (-531.984) (-532.007) [-535.385] (-538.580) * (-535.519) (-533.271) [-532.608] (-533.684) -- 0:00:21
      659000 -- [-532.380] (-533.859) (-536.654) (-535.765) * [-531.825] (-535.687) (-532.109) (-532.944) -- 0:00:21
      659500 -- (-535.563) (-534.072) [-533.002] (-533.462) * (-535.224) (-535.845) [-534.695] (-535.751) -- 0:00:21
      660000 -- (-533.024) (-535.126) (-535.840) [-532.667] * (-536.232) (-532.881) (-535.653) [-535.509] -- 0:00:21

      Average standard deviation of split frequencies: 0.009677

      660500 -- (-534.074) [-533.689] (-536.738) (-532.770) * [-537.404] (-534.393) (-533.648) (-535.059) -- 0:00:21
      661000 -- (-534.100) (-532.851) [-534.852] (-533.837) * (-534.846) (-535.762) (-539.595) [-535.098] -- 0:00:21
      661500 -- [-532.555] (-533.563) (-533.438) (-533.096) * [-533.645] (-534.171) (-537.071) (-536.787) -- 0:00:21
      662000 -- [-532.129] (-531.673) (-533.887) (-537.620) * (-533.989) (-536.494) (-533.262) [-533.149] -- 0:00:21
      662500 -- (-532.217) [-531.689] (-532.301) (-533.912) * [-533.171] (-535.297) (-534.561) (-532.402) -- 0:00:21
      663000 -- (-532.732) [-532.410] (-534.124) (-532.923) * [-535.311] (-532.587) (-534.702) (-540.369) -- 0:00:21
      663500 -- (-534.373) [-535.300] (-532.381) (-533.667) * (-536.343) [-535.199] (-533.980) (-533.771) -- 0:00:21
      664000 -- (-537.217) (-533.551) [-535.324] (-533.756) * (-534.937) (-533.565) (-536.043) [-533.087] -- 0:00:21
      664500 -- (-551.053) [-536.154] (-533.267) (-545.532) * (-535.033) [-531.978] (-534.343) (-532.770) -- 0:00:21
      665000 -- (-543.040) (-536.263) [-536.528] (-540.728) * (-532.240) (-531.629) (-534.184) [-532.202] -- 0:00:21

      Average standard deviation of split frequencies: 0.009379

      665500 -- (-534.858) (-537.937) [-532.838] (-538.665) * [-531.784] (-534.831) (-532.851) (-533.445) -- 0:00:21
      666000 -- (-532.391) [-533.436] (-532.979) (-533.255) * [-532.332] (-539.348) (-534.929) (-536.536) -- 0:00:21
      666500 -- [-535.151] (-534.097) (-532.324) (-535.375) * (-531.449) [-534.799] (-534.425) (-533.833) -- 0:00:21
      667000 -- (-533.985) [-532.550] (-534.230) (-532.900) * (-535.319) (-533.935) (-532.504) [-531.788] -- 0:00:20
      667500 -- (-533.959) (-532.422) (-535.538) [-532.296] * (-531.813) [-539.022] (-535.841) (-532.506) -- 0:00:20
      668000 -- (-533.982) (-533.557) [-532.916] (-533.241) * (-533.058) (-535.445) (-532.474) [-533.490] -- 0:00:20
      668500 -- (-535.908) [-532.576] (-533.216) (-535.007) * [-534.907] (-533.796) (-532.283) (-533.584) -- 0:00:20
      669000 -- (-533.088) (-533.062) [-533.981] (-536.501) * (-534.970) [-533.267] (-532.760) (-533.687) -- 0:00:20
      669500 -- (-535.885) (-535.323) (-533.607) [-532.054] * (-533.713) [-533.196] (-535.109) (-536.007) -- 0:00:20
      670000 -- [-533.190] (-533.126) (-535.054) (-535.349) * (-536.381) [-533.337] (-534.957) (-534.920) -- 0:00:20

      Average standard deviation of split frequencies: 0.009621

      670500 -- (-532.560) (-534.068) [-533.524] (-534.155) * (-533.934) (-532.991) (-534.703) [-535.336] -- 0:00:20
      671000 -- (-535.339) (-538.185) (-535.307) [-533.990] * [-533.142] (-533.532) (-533.713) (-535.574) -- 0:00:20
      671500 -- (-539.371) (-533.213) [-532.413] (-532.318) * (-534.467) [-536.077] (-535.678) (-534.474) -- 0:00:20
      672000 -- [-533.797] (-534.270) (-534.522) (-531.968) * (-533.386) [-534.711] (-534.965) (-533.174) -- 0:00:20
      672500 -- (-532.458) [-534.828] (-532.294) (-531.923) * (-536.043) [-534.971] (-532.962) (-533.140) -- 0:00:20
      673000 -- (-533.862) (-536.818) (-532.259) [-535.060] * (-537.612) [-535.267] (-532.671) (-532.314) -- 0:00:20
      673500 -- (-532.782) [-534.042] (-532.254) (-533.889) * (-533.151) [-539.029] (-534.088) (-532.482) -- 0:00:20
      674000 -- (-534.295) (-534.090) [-532.372] (-533.597) * (-532.148) [-532.249] (-534.217) (-533.626) -- 0:00:20
      674500 -- (-531.901) (-532.904) [-536.193] (-536.000) * (-532.858) (-533.624) [-533.271] (-532.580) -- 0:00:20
      675000 -- (-532.439) (-533.176) [-534.420] (-533.986) * [-533.905] (-533.283) (-538.902) (-533.592) -- 0:00:20

      Average standard deviation of split frequencies: 0.009371

      675500 -- (-536.149) (-531.789) (-534.914) [-534.288] * [-535.554] (-534.714) (-535.800) (-536.259) -- 0:00:20
      676000 -- (-533.633) (-531.950) (-537.351) [-534.190] * (-536.669) [-532.338] (-538.051) (-535.182) -- 0:00:20
      676500 -- (-532.894) (-534.559) (-539.557) [-537.346] * [-532.413] (-533.457) (-535.000) (-537.856) -- 0:00:20
      677000 -- (-536.716) (-533.059) (-534.509) [-532.566] * (-533.324) (-533.707) [-538.552] (-534.193) -- 0:00:20
      677500 -- (-534.621) (-537.744) (-534.203) [-533.471] * [-538.375] (-533.586) (-533.439) (-534.141) -- 0:00:20
      678000 -- (-534.644) [-536.067] (-532.700) (-535.793) * [-531.912] (-535.519) (-532.583) (-532.790) -- 0:00:20
      678500 -- (-532.098) (-533.598) [-533.649] (-536.339) * (-533.701) (-531.889) (-531.747) [-536.173] -- 0:00:20
      679000 -- [-532.448] (-532.310) (-532.372) (-536.846) * (-533.557) (-534.147) [-533.291] (-532.784) -- 0:00:20
      679500 -- (-534.782) [-533.446] (-534.337) (-532.379) * [-532.527] (-532.879) (-535.800) (-535.598) -- 0:00:20
      680000 -- (-533.292) (-535.032) [-533.880] (-533.896) * [-532.681] (-535.389) (-533.432) (-540.140) -- 0:00:20

      Average standard deviation of split frequencies: 0.009912

      680500 -- (-533.624) (-535.379) (-533.253) [-533.051] * (-532.016) [-533.640] (-534.373) (-534.818) -- 0:00:20
      681000 -- (-538.188) (-533.402) [-532.249] (-535.390) * (-532.757) (-536.269) [-533.769] (-533.093) -- 0:00:20
      681500 -- (-538.104) (-536.756) (-532.803) [-534.603] * (-531.695) (-534.103) [-532.993] (-533.855) -- 0:00:20
      682000 -- [-532.739] (-536.679) (-533.596) (-535.595) * (-532.954) [-536.980] (-534.232) (-534.743) -- 0:00:20
      682500 -- (-534.961) [-532.825] (-532.983) (-533.944) * (-535.404) (-534.182) (-535.605) [-532.186] -- 0:00:20
      683000 -- (-534.185) (-538.352) [-532.740] (-532.559) * (-535.087) (-534.352) (-534.188) [-536.473] -- 0:00:19
      683500 -- (-534.802) (-532.485) [-532.399] (-534.589) * (-533.487) [-533.731] (-533.167) (-532.162) -- 0:00:19
      684000 -- (-531.808) (-533.695) [-533.530] (-534.979) * (-533.745) (-533.758) (-539.450) [-533.987] -- 0:00:19
      684500 -- [-534.380] (-533.056) (-533.145) (-536.413) * (-532.311) (-534.509) (-535.836) [-537.843] -- 0:00:19
      685000 -- (-532.669) (-532.557) [-532.767] (-534.769) * (-532.022) (-532.870) (-536.961) [-535.378] -- 0:00:19

      Average standard deviation of split frequencies: 0.010222

      685500 -- (-532.541) [-533.665] (-532.874) (-531.938) * [-532.467] (-535.946) (-532.856) (-537.326) -- 0:00:19
      686000 -- (-532.062) [-532.392] (-536.710) (-533.749) * (-533.881) [-532.993] (-536.687) (-532.715) -- 0:00:19
      686500 -- (-533.386) (-531.715) [-535.174] (-532.862) * (-534.603) (-532.893) (-532.651) [-532.522] -- 0:00:19
      687000 -- (-533.414) [-533.143] (-532.595) (-534.112) * [-533.725] (-531.713) (-531.818) (-535.712) -- 0:00:19
      687500 -- (-537.277) (-532.223) (-532.480) [-532.235] * (-533.727) (-532.494) (-535.301) [-534.487] -- 0:00:19
      688000 -- (-532.371) (-535.219) [-532.820] (-532.693) * (-533.324) (-533.270) (-539.137) [-534.946] -- 0:00:19
      688500 -- (-533.132) (-532.867) (-532.061) [-537.574] * (-534.771) [-532.219] (-537.931) (-531.945) -- 0:00:19
      689000 -- (-535.687) (-532.968) [-533.513] (-532.574) * (-538.496) (-534.919) [-531.971] (-531.851) -- 0:00:19
      689500 -- (-536.627) (-534.015) [-531.889] (-533.242) * (-536.618) [-535.371] (-531.954) (-542.714) -- 0:00:19
      690000 -- (-532.879) (-533.266) (-531.970) [-535.880] * (-531.914) (-536.462) (-532.507) [-534.018] -- 0:00:19

      Average standard deviation of split frequencies: 0.010793

      690500 -- (-532.554) (-533.325) (-531.687) [-533.013] * (-533.772) [-538.557] (-536.314) (-534.597) -- 0:00:19
      691000 -- (-534.822) (-535.557) [-533.031] (-534.058) * [-531.793] (-533.043) (-536.308) (-536.132) -- 0:00:19
      691500 -- (-540.797) (-535.347) [-535.343] (-533.681) * (-533.821) [-536.357] (-538.080) (-538.330) -- 0:00:19
      692000 -- [-533.151] (-537.714) (-534.686) (-535.564) * (-534.361) (-535.614) (-535.596) [-533.799] -- 0:00:19
      692500 -- (-533.703) [-533.221] (-535.721) (-532.900) * (-533.594) [-532.340] (-534.508) (-533.974) -- 0:00:19
      693000 -- (-539.010) [-533.343] (-533.816) (-533.383) * (-532.146) [-533.847] (-535.044) (-532.714) -- 0:00:19
      693500 -- (-535.188) (-534.648) [-532.176] (-534.685) * (-533.105) (-534.640) (-540.219) [-533.179] -- 0:00:19
      694000 -- (-534.471) [-533.360] (-533.357) (-533.072) * (-533.526) [-534.145] (-532.545) (-534.050) -- 0:00:19
      694500 -- (-534.843) (-536.240) (-535.259) [-532.999] * (-533.243) [-532.201] (-537.571) (-534.923) -- 0:00:19
      695000 -- [-536.428] (-541.527) (-535.971) (-532.959) * (-533.755) (-533.637) (-534.170) [-533.275] -- 0:00:19

      Average standard deviation of split frequencies: 0.010498

      695500 -- [-533.153] (-532.777) (-534.889) (-534.391) * [-532.826] (-533.574) (-533.013) (-534.620) -- 0:00:19
      696000 -- [-533.768] (-535.024) (-534.889) (-533.519) * (-533.922) (-535.725) [-533.834] (-533.952) -- 0:00:19
      696500 -- [-532.372] (-534.453) (-534.873) (-533.437) * (-533.461) (-531.723) [-537.029] (-533.457) -- 0:00:19
      697000 -- (-533.688) (-532.560) [-532.985] (-534.397) * [-533.071] (-532.823) (-532.941) (-531.852) -- 0:00:19
      697500 -- [-532.751] (-535.707) (-532.274) (-535.789) * (-533.378) (-532.615) [-535.775] (-532.024) -- 0:00:19
      698000 -- (-533.976) (-533.406) (-532.453) [-532.983] * (-533.340) [-536.342] (-535.179) (-532.173) -- 0:00:19
      698500 -- (-534.493) (-535.435) [-533.156] (-533.894) * (-533.343) (-533.799) (-534.436) [-533.087] -- 0:00:18
      699000 -- (-534.871) (-533.275) [-532.172] (-532.670) * [-533.289] (-535.703) (-533.536) (-532.330) -- 0:00:18
      699500 -- (-535.119) (-532.122) [-532.825] (-536.521) * (-534.161) (-542.725) [-532.517] (-534.225) -- 0:00:18
      700000 -- (-533.114) [-533.365] (-533.874) (-533.364) * (-532.659) (-534.026) [-532.196] (-533.811) -- 0:00:18

      Average standard deviation of split frequencies: 0.010302

      700500 -- (-532.083) [-534.463] (-533.511) (-534.027) * (-532.149) [-533.924] (-533.035) (-534.822) -- 0:00:18
      701000 -- [-537.349] (-533.995) (-533.070) (-532.697) * [-532.332] (-536.542) (-533.250) (-532.017) -- 0:00:18
      701500 -- (-531.770) (-535.216) (-533.348) [-534.337] * (-532.880) (-533.867) (-532.496) [-534.704] -- 0:00:18
      702000 -- (-537.005) [-532.058] (-535.718) (-534.433) * [-535.212] (-533.048) (-531.585) (-533.578) -- 0:00:18
      702500 -- (-534.127) [-533.973] (-533.527) (-533.022) * (-538.702) [-532.528] (-531.899) (-534.641) -- 0:00:18
      703000 -- (-534.994) [-533.395] (-534.421) (-531.660) * (-534.570) (-533.639) (-532.126) [-532.863] -- 0:00:18
      703500 -- (-535.296) (-538.015) (-537.701) [-532.022] * (-535.296) (-537.086) [-532.658] (-534.710) -- 0:00:18
      704000 -- (-532.773) (-535.416) [-531.749] (-534.610) * (-533.341) (-532.422) (-533.378) [-535.135] -- 0:00:18
      704500 -- (-532.633) (-534.157) (-534.206) [-536.678] * (-533.076) [-533.856] (-536.154) (-532.962) -- 0:00:18
      705000 -- (-533.204) (-534.721) (-532.589) [-533.241] * (-534.240) [-533.657] (-536.267) (-536.019) -- 0:00:18

      Average standard deviation of split frequencies: 0.010516

      705500 -- (-533.837) (-533.792) [-534.924] (-534.771) * (-533.669) (-533.762) (-536.096) [-538.794] -- 0:00:18
      706000 -- (-533.155) (-537.245) [-533.051] (-532.085) * (-533.383) (-533.382) [-534.259] (-532.873) -- 0:00:18
      706500 -- (-536.729) (-532.959) [-533.411] (-532.447) * (-533.221) (-532.469) (-534.777) [-534.080] -- 0:00:18
      707000 -- (-535.035) [-532.827] (-534.422) (-537.854) * (-533.883) (-533.162) [-534.333] (-534.084) -- 0:00:18
      707500 -- (-532.623) (-531.825) [-537.391] (-537.812) * [-533.006] (-537.155) (-533.720) (-533.888) -- 0:00:18
      708000 -- [-536.537] (-533.653) (-535.019) (-534.249) * (-532.097) (-533.296) (-533.340) [-534.268] -- 0:00:18
      708500 -- (-540.830) (-535.096) (-533.483) [-533.675] * (-534.106) [-533.171] (-535.046) (-533.540) -- 0:00:18
      709000 -- (-533.912) (-533.902) [-533.657] (-536.473) * [-534.260] (-532.036) (-532.386) (-531.603) -- 0:00:18
      709500 -- (-533.640) (-534.145) (-531.591) [-533.197] * [-534.676] (-532.586) (-533.731) (-539.137) -- 0:00:18
      710000 -- (-533.859) [-532.468] (-532.791) (-533.153) * (-534.587) [-531.621] (-531.723) (-537.881) -- 0:00:18

      Average standard deviation of split frequencies: 0.010613

      710500 -- (-534.193) (-536.240) [-532.871] (-533.124) * (-537.277) [-533.393] (-535.135) (-532.235) -- 0:00:18
      711000 -- (-533.458) (-535.521) (-532.951) [-536.731] * [-534.830] (-534.295) (-534.419) (-532.803) -- 0:00:18
      711500 -- [-534.211] (-539.595) (-537.087) (-536.270) * (-534.136) (-532.809) (-534.741) [-533.933] -- 0:00:18
      712000 -- (-535.124) (-538.043) [-544.195] (-532.510) * [-533.940] (-533.681) (-532.428) (-534.180) -- 0:00:18
      712500 -- (-534.220) (-533.112) (-535.392) [-535.763] * (-532.544) [-535.381] (-533.347) (-534.305) -- 0:00:18
      713000 -- (-533.380) [-533.846] (-533.774) (-533.720) * (-532.698) [-536.873] (-535.673) (-534.004) -- 0:00:18
      713500 -- (-531.769) (-536.557) [-537.490] (-532.103) * [-532.221] (-537.859) (-532.880) (-538.897) -- 0:00:18
      714000 -- [-532.491] (-538.687) (-534.425) (-532.325) * (-533.606) [-534.008] (-532.642) (-535.954) -- 0:00:18
      714500 -- (-532.018) (-537.227) (-532.713) [-532.960] * (-532.648) (-536.871) [-532.840] (-533.594) -- 0:00:17
      715000 -- (-536.817) [-533.818] (-532.591) (-534.708) * [-534.085] (-533.096) (-536.723) (-533.572) -- 0:00:17

      Average standard deviation of split frequencies: 0.010905

      715500 -- (-533.592) [-533.014] (-534.890) (-532.786) * (-536.107) (-534.553) (-534.819) [-532.637] -- 0:00:17
      716000 -- (-533.122) (-537.119) [-534.012] (-532.180) * (-535.864) [-533.050] (-533.128) (-535.646) -- 0:00:17
      716500 -- (-533.894) [-533.205] (-532.419) (-536.147) * (-534.289) (-535.152) [-532.800] (-533.456) -- 0:00:17
      717000 -- (-534.225) (-534.029) (-533.368) [-534.256] * (-533.792) [-537.535] (-534.517) (-535.262) -- 0:00:17
      717500 -- (-533.635) (-531.805) (-538.042) [-533.068] * (-534.622) [-533.407] (-533.279) (-533.645) -- 0:00:17
      718000 -- (-534.852) [-532.383] (-536.077) (-532.569) * (-534.984) [-532.269] (-533.589) (-533.643) -- 0:00:17
      718500 -- (-534.128) [-532.421] (-535.102) (-532.709) * (-531.705) (-533.936) (-534.900) [-531.973] -- 0:00:17
      719000 -- [-534.591] (-533.324) (-534.495) (-532.333) * (-535.065) (-534.584) [-532.757] (-533.216) -- 0:00:17
      719500 -- (-533.558) [-536.813] (-535.754) (-535.539) * [-532.278] (-534.423) (-534.213) (-539.563) -- 0:00:17
      720000 -- (-533.962) (-535.817) (-535.386) [-535.485] * (-532.319) (-533.087) [-535.864] (-535.907) -- 0:00:17

      Average standard deviation of split frequencies: 0.009975

      720500 -- [-535.902] (-531.930) (-534.831) (-533.805) * (-535.893) (-532.557) (-532.904) [-535.029] -- 0:00:17
      721000 -- [-532.621] (-534.882) (-534.874) (-536.056) * (-536.906) (-534.938) (-538.016) [-534.807] -- 0:00:17
      721500 -- (-533.748) [-533.250] (-533.409) (-533.753) * (-534.930) (-534.784) [-533.248] (-535.274) -- 0:00:17
      722000 -- (-537.072) (-537.105) (-533.414) [-532.145] * (-534.472) (-533.385) [-533.973] (-535.539) -- 0:00:17
      722500 -- (-536.087) (-532.997) [-532.622] (-531.810) * [-534.305] (-532.883) (-533.508) (-532.586) -- 0:00:17
      723000 -- (-534.549) (-532.990) [-533.116] (-535.915) * [-534.076] (-533.825) (-532.886) (-536.091) -- 0:00:17
      723500 -- (-537.393) [-533.579] (-532.803) (-536.239) * (-533.535) (-534.246) [-534.410] (-538.406) -- 0:00:17
      724000 -- [-533.405] (-535.429) (-533.599) (-533.979) * (-538.342) (-532.073) [-534.177] (-533.499) -- 0:00:17
      724500 -- (-532.154) (-533.238) [-533.627] (-533.584) * [-533.374] (-538.043) (-533.394) (-533.866) -- 0:00:17
      725000 -- (-534.130) (-532.813) (-533.204) [-532.570] * (-533.962) (-534.913) (-535.343) [-533.457] -- 0:00:17

      Average standard deviation of split frequencies: 0.010064

      725500 -- (-533.851) [-532.728] (-533.848) (-534.628) * (-535.534) [-532.200] (-548.442) (-534.490) -- 0:00:17
      726000 -- (-534.032) (-531.851) [-535.731] (-536.200) * (-536.137) (-533.215) [-534.095] (-532.832) -- 0:00:17
      726500 -- (-534.130) (-532.675) [-539.002] (-540.350) * [-534.520] (-535.171) (-535.224) (-534.418) -- 0:00:17
      727000 -- [-533.005] (-532.957) (-534.511) (-535.071) * (-534.857) (-534.558) [-531.564] (-535.852) -- 0:00:17
      727500 -- (-535.113) (-532.590) (-532.968) [-534.020] * (-532.350) (-534.885) (-532.985) [-534.856] -- 0:00:17
      728000 -- (-532.530) [-532.578] (-532.961) (-534.814) * (-532.809) [-535.956] (-535.718) (-539.118) -- 0:00:17
      728500 -- [-532.222] (-532.831) (-533.782) (-535.018) * [-532.129] (-534.296) (-533.630) (-536.837) -- 0:00:17
      729000 -- (-533.061) (-534.003) (-535.830) [-532.338] * (-537.277) (-531.954) [-531.723] (-534.408) -- 0:00:17
      729500 -- [-533.173] (-533.960) (-533.502) (-533.206) * (-533.686) (-534.151) [-538.321] (-535.514) -- 0:00:17
      730000 -- (-537.246) (-537.455) (-532.387) [-535.825] * (-534.452) [-535.525] (-533.195) (-532.749) -- 0:00:17

      Average standard deviation of split frequencies: 0.010000

      730500 -- (-536.051) [-536.688] (-532.570) (-534.276) * (-535.576) (-536.064) [-534.630] (-532.748) -- 0:00:16
      731000 -- (-535.216) (-535.277) [-532.511] (-534.159) * (-533.239) [-534.150] (-532.680) (-532.557) -- 0:00:16
      731500 -- (-532.381) (-534.485) [-534.793] (-533.590) * (-533.886) (-535.457) [-536.017] (-534.366) -- 0:00:16
      732000 -- [-535.261] (-532.758) (-534.557) (-534.231) * (-536.345) (-537.770) [-536.464] (-533.556) -- 0:00:16
      732500 -- (-534.908) (-532.417) [-532.847] (-532.553) * (-537.685) (-534.481) (-535.951) [-534.144] -- 0:00:16
      733000 -- (-538.718) [-532.602] (-532.281) (-534.605) * (-532.882) [-534.646] (-533.669) (-533.266) -- 0:00:16
      733500 -- [-533.526] (-536.504) (-537.389) (-534.196) * [-533.739] (-535.550) (-532.283) (-534.833) -- 0:00:16
      734000 -- (-532.978) (-535.166) (-534.724) [-532.644] * (-533.548) (-535.470) (-535.815) [-534.144] -- 0:00:16
      734500 -- (-533.689) (-531.645) (-533.931) [-531.504] * (-533.749) [-534.916] (-537.601) (-533.995) -- 0:00:16
      735000 -- [-533.036] (-532.744) (-535.513) (-533.275) * (-533.294) (-533.712) [-534.760] (-533.423) -- 0:00:16

      Average standard deviation of split frequencies: 0.009888

      735500 -- (-534.023) (-532.482) [-535.870] (-533.525) * (-536.481) [-534.245] (-535.766) (-533.249) -- 0:00:16
      736000 -- (-535.516) (-538.208) [-533.455] (-532.068) * [-532.499] (-532.511) (-535.991) (-532.555) -- 0:00:16
      736500 -- (-535.697) (-535.772) (-532.597) [-532.164] * (-534.481) (-536.011) (-535.357) [-531.786] -- 0:00:16
      737000 -- (-532.345) [-534.231] (-539.911) (-535.632) * (-533.652) (-533.063) [-533.498] (-533.648) -- 0:00:16
      737500 -- (-533.285) (-532.372) (-535.928) [-531.922] * (-533.843) [-532.288] (-534.139) (-537.225) -- 0:00:16
      738000 -- (-534.667) (-539.754) [-537.348] (-532.694) * (-533.088) (-532.805) (-533.191) [-534.578] -- 0:00:16
      738500 -- (-532.809) (-534.004) [-532.481] (-533.594) * [-534.954] (-532.653) (-533.564) (-532.367) -- 0:00:16
      739000 -- (-533.316) [-533.119] (-534.842) (-534.849) * (-536.998) (-534.691) [-533.729] (-535.852) -- 0:00:16
      739500 -- (-533.300) (-536.433) [-532.565] (-533.267) * (-540.449) (-532.532) [-531.878] (-531.940) -- 0:00:16
      740000 -- (-536.723) [-532.434] (-531.989) (-534.385) * (-536.185) (-532.351) (-533.048) [-533.467] -- 0:00:16

      Average standard deviation of split frequencies: 0.009786

      740500 -- (-532.518) [-536.668] (-536.637) (-535.144) * [-533.605] (-532.377) (-534.201) (-534.766) -- 0:00:16
      741000 -- [-531.823] (-534.901) (-532.417) (-534.421) * [-533.076] (-533.875) (-535.108) (-533.165) -- 0:00:16
      741500 -- [-535.183] (-535.749) (-534.007) (-533.531) * (-533.599) [-533.915] (-535.947) (-533.362) -- 0:00:16
      742000 -- (-532.828) [-536.220] (-534.646) (-532.679) * (-532.927) (-532.622) [-532.881] (-534.532) -- 0:00:16
      742500 -- (-535.621) (-533.661) [-533.672] (-532.841) * (-535.555) [-533.704] (-533.714) (-532.685) -- 0:00:16
      743000 -- [-538.554] (-537.921) (-536.757) (-533.978) * [-534.926] (-534.521) (-533.102) (-531.746) -- 0:00:16
      743500 -- (-535.819) [-539.276] (-534.217) (-538.393) * [-532.406] (-533.509) (-532.674) (-534.557) -- 0:00:16
      744000 -- (-535.398) (-537.127) [-534.111] (-535.094) * [-532.618] (-533.147) (-534.509) (-535.232) -- 0:00:16
      744500 -- (-533.005) [-532.450] (-533.284) (-533.889) * (-532.967) [-532.052] (-534.922) (-537.913) -- 0:00:16
      745000 -- [-533.903] (-535.396) (-532.194) (-538.171) * [-532.474] (-535.553) (-532.805) (-533.489) -- 0:00:16

      Average standard deviation of split frequencies: 0.009676

      745500 -- (-533.935) (-531.798) [-532.121] (-536.774) * (-532.072) (-535.992) (-532.215) [-532.625] -- 0:00:16
      746000 -- [-534.473] (-531.931) (-534.510) (-533.396) * (-532.619) [-536.729] (-532.529) (-536.972) -- 0:00:16
      746500 -- (-533.408) [-532.162] (-534.717) (-535.133) * (-532.285) (-535.042) (-532.252) [-532.338] -- 0:00:15
      747000 -- (-532.848) (-533.153) (-537.513) [-533.513] * (-532.815) [-537.527] (-537.352) (-535.909) -- 0:00:15
      747500 -- (-534.178) (-535.054) (-539.248) [-534.232] * (-533.531) (-533.494) [-534.395] (-533.007) -- 0:00:15
      748000 -- (-535.483) (-532.698) (-533.513) [-534.152] * (-532.950) (-532.615) (-535.075) [-535.907] -- 0:00:15
      748500 -- [-533.901] (-532.526) (-534.031) (-534.265) * (-534.408) [-532.309] (-535.461) (-533.876) -- 0:00:15
      749000 -- (-536.984) (-533.953) (-534.580) [-533.579] * (-534.675) (-533.161) (-533.498) [-533.163] -- 0:00:15
      749500 -- (-536.912) (-533.159) (-536.447) [-533.575] * (-535.217) (-534.520) [-533.548] (-534.156) -- 0:00:15
      750000 -- (-534.142) (-534.025) (-534.940) [-532.649] * (-532.517) (-535.678) (-534.019) [-533.377] -- 0:00:15

      Average standard deviation of split frequencies: 0.008909

      750500 -- (-534.954) (-534.778) [-533.289] (-532.719) * (-532.475) (-538.788) (-533.068) [-532.503] -- 0:00:15
      751000 -- (-534.519) (-538.878) (-531.858) [-533.330] * (-533.670) (-534.541) [-533.109] (-532.461) -- 0:00:15
      751500 -- (-533.330) [-532.520] (-531.378) (-533.718) * (-535.173) (-534.180) [-531.602] (-532.603) -- 0:00:15
      752000 -- (-532.331) (-533.713) [-533.496] (-540.586) * (-537.130) (-535.607) [-532.567] (-532.424) -- 0:00:15
      752500 -- (-536.146) (-532.677) [-532.663] (-542.326) * (-537.454) (-533.173) (-532.047) [-533.160] -- 0:00:15
      753000 -- (-532.549) (-534.948) [-533.154] (-536.717) * (-533.162) (-533.614) (-533.470) [-536.533] -- 0:00:15
      753500 -- (-534.984) [-532.810] (-532.463) (-534.896) * (-535.296) (-532.464) [-532.881] (-534.032) -- 0:00:15
      754000 -- [-533.436] (-532.073) (-539.629) (-534.424) * (-535.399) (-534.140) [-533.646] (-532.381) -- 0:00:15
      754500 -- [-532.862] (-534.727) (-537.166) (-534.360) * (-533.635) (-536.946) [-533.133] (-532.867) -- 0:00:15
      755000 -- (-533.686) [-533.195] (-536.049) (-532.251) * [-532.638] (-537.687) (-532.541) (-536.322) -- 0:00:15

      Average standard deviation of split frequencies: 0.008730

      755500 -- (-533.129) (-531.559) [-534.781] (-532.021) * (-531.581) (-534.114) (-533.494) [-533.501] -- 0:00:15
      756000 -- (-533.844) (-534.198) (-534.119) [-534.110] * (-532.560) [-532.655] (-533.890) (-534.950) -- 0:00:15
      756500 -- (-535.177) [-533.888] (-536.593) (-532.897) * (-532.829) (-533.468) [-536.066] (-534.949) -- 0:00:15
      757000 -- (-534.042) (-532.973) (-532.070) [-533.630] * [-534.873] (-534.650) (-534.746) (-539.887) -- 0:00:15
      757500 -- (-534.251) [-533.120] (-537.442) (-532.299) * (-536.473) [-534.094] (-533.605) (-536.383) -- 0:00:15
      758000 -- (-534.571) (-533.479) [-533.073] (-532.281) * (-532.709) (-534.769) (-534.869) [-533.968] -- 0:00:15
      758500 -- (-535.052) (-533.299) (-536.148) [-531.743] * (-533.264) (-539.341) [-534.360] (-535.410) -- 0:00:15
      759000 -- [-536.527] (-537.992) (-532.720) (-534.946) * (-532.369) (-533.384) [-533.832] (-538.051) -- 0:00:15
      759500 -- [-534.810] (-533.724) (-535.510) (-532.807) * (-532.843) (-532.959) [-532.520] (-533.557) -- 0:00:15
      760000 -- (-533.173) (-536.995) (-534.924) [-533.511] * (-538.748) (-532.469) (-535.205) [-535.981] -- 0:00:15

      Average standard deviation of split frequencies: 0.008947

      760500 -- (-533.599) (-532.062) [-535.454] (-533.790) * (-533.159) [-534.045] (-535.289) (-534.840) -- 0:00:15
      761000 -- [-533.443] (-534.002) (-537.675) (-537.328) * [-534.413] (-534.685) (-535.021) (-532.242) -- 0:00:15
      761500 -- [-531.995] (-538.010) (-533.690) (-536.555) * [-533.094] (-533.142) (-536.228) (-532.111) -- 0:00:15
      762000 -- (-533.174) (-537.700) [-532.379] (-532.411) * (-536.576) [-535.926] (-533.837) (-532.999) -- 0:00:14
      762500 -- (-535.949) (-536.846) (-532.108) [-532.024] * [-532.414] (-537.124) (-535.635) (-539.253) -- 0:00:14
      763000 -- [-537.904] (-532.673) (-532.317) (-531.735) * (-534.189) (-533.237) (-536.935) [-538.182] -- 0:00:14
      763500 -- (-535.218) [-533.056] (-531.604) (-534.206) * (-534.083) (-532.633) (-533.180) [-535.806] -- 0:00:14
      764000 -- (-533.391) (-533.599) (-531.813) [-539.671] * (-533.341) (-532.761) [-534.047] (-534.289) -- 0:00:14
      764500 -- [-531.883] (-535.942) (-532.360) (-538.101) * (-534.744) (-534.323) (-535.987) [-533.132] -- 0:00:14
      765000 -- (-535.479) (-534.703) (-533.269) [-538.017] * (-535.466) (-533.321) (-534.892) [-535.866] -- 0:00:14

      Average standard deviation of split frequencies: 0.009154

      765500 -- (-532.675) (-538.779) [-532.411] (-531.745) * (-536.888) (-533.862) (-536.191) [-534.395] -- 0:00:14
      766000 -- [-532.332] (-535.203) (-536.164) (-533.641) * (-536.673) (-532.552) [-534.992] (-534.515) -- 0:00:14