--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:24:15 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2518/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -533.08 -537.23
2 -533.14 -536.21
--------------------------------------
TOTAL -533.11 -536.84
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890637 0.087046 0.346414 1.456484 0.857326 1330.55 1415.78 1.002
r(A<->C){all} 0.160190 0.021631 0.000015 0.455892 0.118878 158.98 172.83 1.005
r(A<->G){all} 0.174044 0.021294 0.000104 0.464696 0.138300 134.69 233.13 1.002
r(A<->T){all} 0.164650 0.019856 0.000068 0.453064 0.127073 125.82 139.23 1.000
r(C<->G){all} 0.169999 0.022380 0.000108 0.470889 0.124624 202.31 222.61 1.000
r(C<->T){all} 0.170193 0.020121 0.000015 0.457106 0.136268 86.98 96.64 1.001
r(G<->T){all} 0.160924 0.018495 0.000076 0.430477 0.125231 238.56 289.59 1.002
pi(A){all} 0.200522 0.000395 0.162896 0.239556 0.200186 981.98 1181.36 1.000
pi(C){all} 0.266610 0.000483 0.225301 0.311423 0.266179 1289.01 1296.62 1.000
pi(G){all} 0.332670 0.000557 0.286995 0.377635 0.332160 1326.63 1365.20 1.000
pi(T){all} 0.200198 0.000401 0.162755 0.241033 0.200020 940.06 1188.10 1.000
alpha{1,2} 0.408215 0.220875 0.000126 1.359506 0.242012 754.30 822.74 1.000
alpha{3} 0.463612 0.236763 0.000128 1.404857 0.300600 1387.67 1444.33 1.000
pinvar{all} 0.995865 0.000026 0.986891 0.999998 0.997475 1267.84 1354.03 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -513.956977
Model 2: PositiveSelection -513.957012
Model 0: one-ratio -513.957046
Model 7: beta -513.956866
Model 8: beta&w>1 -513.956866
Model 0 vs 1 1.3799999987895717E-4
Model 2 vs 1 6.999999982326699E-5
Model 8 vs 7 0.0
>C1
VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
>C2
VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
>C3
VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
>C4
VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
>C5
VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
>C6
VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=130
C1 VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
C2 VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
C3 VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
C4 VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
C5 VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
C6 VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
**************************************************
C1 DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
C2 DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
C3 DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
C4 DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
C5 DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
C6 DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
**************************************************
C1 NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
C2 NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
C3 NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
C4 NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
C5 NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
C6 NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
******************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3900]--->[3900]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.462 Mb, Max= 30.660 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
C2 VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
C3 VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
C4 VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
C5 VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
C6 VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
**************************************************
C1 DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
C2 DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
C3 DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
C4 DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
C5 DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
C6 DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
**************************************************
C1 NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
C2 NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
C3 NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
C4 NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
C5 NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
C6 NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
******************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT
C2 GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT
C3 GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT
C4 GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT
C5 GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT
C6 GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT
**************************************************
C1 GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC
C2 GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC
C3 GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC
C4 GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC
C5 GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC
C6 GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC
**************************************************
C1 GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG
C2 GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG
C3 GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG
C4 GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG
C5 GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG
C6 GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG
**************************************************
C1 GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG
C2 GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG
C3 GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG
C4 GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG
C5 GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG
C6 GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG
**************************************************
C1 TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG
C2 TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG
C3 TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG
C4 TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG
C5 TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG
C6 TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG
**************************************************
C1 TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC
C2 TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC
C3 TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC
C4 TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC
C5 TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC
C6 TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC
**************************************************
C1 AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT
C2 AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT
C3 AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT
C4 AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT
C5 AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT
C6 AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT
**************************************************
C1 CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG
C2 CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG
C3 CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG
C4 CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG
C5 CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG
C6 CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG
****************************************
>C1
GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT
GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC
GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG
GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG
TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG
TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC
AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT
CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG
>C2
GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT
GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC
GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG
GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG
TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG
TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC
AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT
CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG
>C3
GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT
GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC
GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG
GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG
TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG
TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC
AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT
CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG
>C4
GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT
GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC
GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG
GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG
TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG
TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC
AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT
CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG
>C5
GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT
GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC
GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG
GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG
TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG
TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC
AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT
CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG
>C6
GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT
GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC
GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG
GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG
TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG
TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC
AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT
CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG
>C1
VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
>C2
VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
>C3
VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
>C4
VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
>C5
VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
>C6
VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 390 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579857766
Setting output file names to "/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 2073541575
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5137492014
Seed = 1358813117
Swapseed = 1579857766
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -872.838696 -- -24.965149
Chain 2 -- -872.838696 -- -24.965149
Chain 3 -- -872.838696 -- -24.965149
Chain 4 -- -872.838696 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -872.838563 -- -24.965149
Chain 2 -- -872.838696 -- -24.965149
Chain 3 -- -872.838696 -- -24.965149
Chain 4 -- -872.838696 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-872.839] (-872.839) (-872.839) (-872.839) * [-872.839] (-872.839) (-872.839) (-872.839)
500 -- (-549.911) [-545.442] (-545.434) (-549.620) * (-543.941) (-549.415) [-543.370] (-544.302) -- 0:00:00
1000 -- (-543.957) (-540.937) [-546.312] (-542.754) * (-542.417) [-537.196] (-539.097) (-545.090) -- 0:00:00
1500 -- (-549.176) (-543.944) [-541.491] (-539.010) * (-545.264) [-541.135] (-539.693) (-544.488) -- 0:00:00
2000 -- [-538.929] (-542.423) (-541.222) (-547.719) * [-541.812] (-540.304) (-537.340) (-539.786) -- 0:00:00
2500 -- (-539.392) [-545.995] (-546.248) (-543.544) * (-546.285) [-539.758] (-546.959) (-546.095) -- 0:00:00
3000 -- (-550.893) (-540.975) [-545.327] (-539.801) * [-541.872] (-542.133) (-545.851) (-541.093) -- 0:00:00
3500 -- (-540.855) (-544.313) (-546.149) [-539.999] * (-548.740) (-544.990) [-543.488] (-546.375) -- 0:00:00
4000 -- (-539.725) (-546.971) [-541.018] (-541.407) * (-545.672) (-541.248) (-548.996) [-543.962] -- 0:04:09
4500 -- (-554.372) (-544.719) [-547.455] (-540.369) * (-537.561) (-541.539) [-536.286] (-547.908) -- 0:03:41
5000 -- (-540.255) [-540.805] (-539.465) (-541.459) * (-545.533) (-542.162) (-542.744) [-539.031] -- 0:03:19
Average standard deviation of split frequencies: 0.102479
5500 -- (-546.519) (-550.970) (-546.581) [-538.067] * (-542.972) (-536.421) (-543.429) [-538.620] -- 0:03:00
6000 -- (-553.699) (-539.762) [-539.762] (-546.536) * [-541.203] (-541.238) (-538.787) (-542.418) -- 0:02:45
6500 -- (-535.814) (-545.236) (-541.611) [-539.002] * (-548.338) (-543.876) [-539.221] (-550.580) -- 0:02:32
7000 -- (-533.112) [-540.940] (-540.837) (-539.271) * [-539.892] (-552.534) (-542.220) (-545.865) -- 0:02:21
7500 -- [-534.687] (-546.088) (-538.392) (-542.963) * (-539.639) (-546.391) (-547.617) [-544.332] -- 0:02:12
8000 -- [-534.347] (-545.965) (-552.823) (-550.644) * [-538.586] (-541.537) (-544.089) (-541.973) -- 0:02:04
8500 -- (-533.106) (-543.185) (-540.905) [-546.768] * (-547.216) [-540.075] (-544.903) (-538.741) -- 0:01:56
9000 -- (-532.139) [-539.459] (-545.006) (-543.788) * (-541.126) [-541.337] (-546.201) (-538.882) -- 0:01:50
9500 -- (-534.203) [-537.828] (-540.845) (-533.478) * (-539.846) (-550.178) [-536.313] (-550.349) -- 0:01:44
10000 -- (-535.236) [-540.904] (-548.539) (-531.826) * (-545.827) [-544.703] (-540.241) (-540.143) -- 0:01:39
Average standard deviation of split frequencies: 0.077340
10500 -- [-532.243] (-551.764) (-543.863) (-532.035) * (-540.758) (-544.514) (-541.789) [-540.026] -- 0:01:34
11000 -- (-534.068) [-547.769] (-543.002) (-538.751) * (-543.709) (-544.157) [-542.215] (-538.399) -- 0:01:29
11500 -- (-535.205) [-538.676] (-548.506) (-537.292) * (-540.114) (-551.681) [-539.912] (-545.763) -- 0:01:25
12000 -- (-534.453) (-543.684) [-539.736] (-532.587) * (-541.592) [-538.722] (-544.993) (-540.392) -- 0:01:22
12500 -- (-535.661) (-542.152) [-539.902] (-534.349) * (-554.449) [-542.474] (-548.488) (-538.930) -- 0:01:19
13000 -- (-537.605) (-540.504) (-549.593) [-534.486] * (-541.156) (-546.123) (-546.845) [-539.734] -- 0:01:15
13500 -- (-535.525) (-540.293) (-557.463) [-534.544] * (-552.855) (-557.616) (-537.535) [-539.299] -- 0:01:13
14000 -- (-536.104) (-544.320) [-546.612] (-535.080) * (-547.330) (-532.806) (-543.134) [-541.964] -- 0:01:10
14500 -- [-534.345] (-548.039) (-545.118) (-533.834) * (-544.737) (-534.337) [-542.977] (-540.181) -- 0:01:07
15000 -- (-533.783) (-544.846) (-542.288) [-536.607] * (-543.295) (-536.035) (-550.136) [-539.520] -- 0:01:05
Average standard deviation of split frequencies: 0.058926
15500 -- (-533.167) (-541.623) (-540.964) [-532.511] * (-544.674) (-540.787) (-544.971) [-546.257] -- 0:01:03
16000 -- (-533.120) (-542.982) [-554.017] (-532.842) * (-546.191) (-532.695) [-540.807] (-543.438) -- 0:01:01
16500 -- (-532.510) (-542.410) (-540.465) [-532.452] * [-545.406] (-532.449) (-541.548) (-543.899) -- 0:00:59
17000 -- [-535.162] (-541.327) (-532.793) (-533.392) * [-539.437] (-532.745) (-545.899) (-548.743) -- 0:00:57
17500 -- (-532.792) [-545.724] (-533.609) (-532.030) * (-541.821) (-534.348) [-541.347] (-547.571) -- 0:00:56
18000 -- (-534.484) (-540.798) [-533.721] (-536.020) * (-544.592) (-533.853) (-538.012) [-545.461] -- 0:00:54
18500 -- (-532.005) [-539.999] (-531.839) (-536.172) * [-547.790] (-540.148) (-546.675) (-549.221) -- 0:00:53
19000 -- [-533.073] (-539.867) (-534.308) (-534.716) * (-537.343) [-533.282] (-537.609) (-544.185) -- 0:01:43
19500 -- (-533.835) (-549.123) (-536.579) [-537.391] * (-536.438) (-533.321) [-541.093] (-537.216) -- 0:01:40
20000 -- (-534.305) (-545.041) [-534.454] (-533.309) * (-535.996) (-535.367) (-550.300) [-547.516] -- 0:01:38
Average standard deviation of split frequencies: 0.060446
20500 -- (-535.099) (-538.629) (-536.515) [-533.076] * (-535.526) (-534.299) [-538.823] (-540.249) -- 0:01:35
21000 -- (-533.730) (-547.011) [-534.244] (-532.138) * (-536.949) [-534.058] (-543.193) (-544.273) -- 0:01:33
21500 -- [-532.452] (-548.629) (-532.933) (-536.492) * (-539.213) (-532.485) (-543.016) [-539.206] -- 0:01:31
22000 -- [-532.031] (-548.762) (-532.649) (-534.010) * [-535.042] (-534.873) (-548.026) (-543.106) -- 0:01:28
22500 -- (-531.936) (-546.113) (-532.538) [-534.870] * [-534.646] (-532.866) (-539.394) (-541.316) -- 0:01:26
23000 -- (-535.454) (-537.025) (-535.958) [-534.549] * (-534.646) (-533.533) [-546.161] (-542.079) -- 0:01:24
23500 -- (-537.533) [-544.607] (-535.983) (-533.291) * (-534.212) (-533.217) [-541.348] (-542.325) -- 0:01:23
24000 -- (-534.001) (-546.472) [-536.053] (-537.034) * (-534.382) (-534.005) (-538.473) [-540.638] -- 0:01:21
24500 -- (-535.534) [-537.351] (-534.467) (-534.433) * (-532.014) (-534.848) [-537.784] (-535.845) -- 0:01:19
25000 -- (-534.480) (-538.419) (-533.455) [-538.566] * (-531.940) [-533.008] (-542.500) (-538.634) -- 0:01:18
Average standard deviation of split frequencies: 0.058710
25500 -- (-535.451) [-546.046] (-535.118) (-534.501) * (-532.221) [-532.866] (-538.987) (-546.370) -- 0:01:16
26000 -- (-535.893) (-542.916) (-533.668) [-533.446] * (-534.204) (-533.730) (-547.720) [-538.170] -- 0:01:14
26500 -- (-533.639) [-546.887] (-532.632) (-532.569) * (-533.922) (-532.448) [-542.007] (-544.459) -- 0:01:13
27000 -- (-533.993) (-539.733) [-532.236] (-533.372) * (-533.949) (-531.860) [-540.720] (-552.878) -- 0:01:12
27500 -- (-534.927) [-541.989] (-537.001) (-536.049) * (-532.349) [-538.125] (-542.009) (-544.490) -- 0:01:10
28000 -- [-533.667] (-542.605) (-535.134) (-533.756) * (-534.983) [-532.685] (-557.654) (-545.867) -- 0:01:09
28500 -- (-532.609) (-542.470) (-532.504) [-533.370] * (-535.590) (-539.366) (-544.085) [-545.907] -- 0:01:08
29000 -- (-532.944) [-541.094] (-534.588) (-533.870) * (-534.356) [-536.583] (-544.069) (-540.388) -- 0:01:06
29500 -- [-532.791] (-541.708) (-532.428) (-535.857) * (-533.803) [-531.780] (-538.639) (-548.231) -- 0:01:05
30000 -- (-537.428) (-550.906) (-532.707) [-534.902] * [-532.625] (-534.327) (-546.450) (-543.733) -- 0:01:04
Average standard deviation of split frequencies: 0.050308
30500 -- (-535.941) (-553.456) [-533.599] (-534.430) * (-532.543) (-537.745) (-543.949) [-537.503] -- 0:01:03
31000 -- (-537.018) (-546.789) [-532.382] (-534.910) * (-537.037) (-534.099) [-539.814] (-544.345) -- 0:01:02
31500 -- (-532.574) (-544.576) (-533.718) [-532.602] * (-537.242) (-536.381) [-544.765] (-543.135) -- 0:01:01
32000 -- [-531.857] (-543.744) (-533.397) (-532.320) * (-533.500) (-534.441) [-548.990] (-551.413) -- 0:01:00
32500 -- [-534.065] (-559.510) (-539.937) (-533.155) * (-533.860) (-532.389) (-544.769) [-539.407] -- 0:00:59
33000 -- (-533.761) (-542.923) [-533.224] (-538.213) * (-532.771) [-533.968] (-546.426) (-539.664) -- 0:00:58
33500 -- (-534.295) (-532.372) [-533.527] (-538.236) * (-533.234) (-534.428) [-544.642] (-540.205) -- 0:00:57
34000 -- (-533.005) [-531.591] (-544.024) (-534.648) * (-535.347) (-535.440) (-540.753) [-539.394] -- 0:00:56
34500 -- (-535.023) [-532.216] (-533.462) (-535.922) * [-532.933] (-535.748) (-543.122) (-540.945) -- 0:00:55
35000 -- [-532.823] (-534.304) (-533.559) (-538.425) * (-533.811) (-532.993) [-551.923] (-547.689) -- 0:00:55
Average standard deviation of split frequencies: 0.053833
35500 -- (-532.431) (-533.139) [-532.282] (-534.408) * [-535.562] (-531.878) (-543.073) (-536.525) -- 0:00:54
36000 -- (-535.740) (-535.014) [-533.776] (-533.501) * (-533.480) (-533.695) [-541.976] (-542.715) -- 0:01:20
36500 -- (-536.058) (-532.947) (-535.746) [-533.419] * (-536.339) (-532.321) (-545.899) [-539.105] -- 0:01:19
37000 -- [-535.517] (-531.934) (-536.612) (-534.954) * (-534.094) [-533.722] (-544.631) (-541.560) -- 0:01:18
37500 -- (-533.620) (-533.721) [-533.552] (-536.930) * (-533.841) (-533.988) (-540.019) [-542.056] -- 0:01:17
38000 -- [-533.241] (-535.583) (-534.699) (-534.933) * (-532.914) (-534.440) (-546.173) [-540.625] -- 0:01:15
38500 -- (-534.018) (-534.985) (-532.831) [-531.916] * (-534.347) (-535.248) [-541.656] (-542.038) -- 0:01:14
39000 -- (-536.564) [-535.262] (-532.559) (-533.953) * [-532.344] (-535.043) (-540.353) (-541.484) -- 0:01:13
39500 -- (-532.485) (-532.049) (-533.795) [-533.708] * (-532.345) [-533.132] (-545.006) (-542.411) -- 0:01:12
40000 -- (-532.809) [-531.964] (-532.067) (-534.488) * (-533.256) (-532.504) (-547.812) [-541.107] -- 0:01:12
Average standard deviation of split frequencies: 0.056739
40500 -- (-537.550) (-533.462) [-534.515] (-537.448) * [-533.060] (-532.692) (-541.692) (-539.459) -- 0:01:11
41000 -- (-532.577) (-534.403) (-532.910) [-531.695] * (-533.228) (-534.223) (-545.478) [-537.200] -- 0:01:10
41500 -- (-532.464) [-533.443] (-534.997) (-532.482) * (-535.283) [-535.132] (-547.611) (-543.030) -- 0:01:09
42000 -- (-534.768) (-532.752) (-532.369) [-533.071] * (-532.043) (-536.295) (-540.112) [-538.021] -- 0:01:08
42500 -- [-532.994] (-531.943) (-533.366) (-533.507) * (-533.043) [-533.938] (-537.804) (-547.328) -- 0:01:07
43000 -- (-536.833) (-532.225) [-532.516] (-534.387) * [-533.348] (-533.767) (-548.877) (-542.316) -- 0:01:06
43500 -- (-534.445) [-532.138] (-532.169) (-536.099) * (-532.607) (-533.415) [-540.830] (-540.165) -- 0:01:05
44000 -- (-539.805) (-533.865) (-532.140) [-536.428] * [-536.319] (-532.657) (-541.301) (-544.099) -- 0:01:05
44500 -- (-533.325) (-533.449) [-532.837] (-532.517) * (-533.337) [-532.474] (-547.980) (-546.983) -- 0:01:04
45000 -- (-532.408) (-535.540) [-532.376] (-531.452) * (-534.067) (-535.173) [-544.883] (-545.715) -- 0:01:03
Average standard deviation of split frequencies: 0.051240
45500 -- (-531.802) (-533.333) (-532.168) [-531.931] * (-532.887) (-537.619) (-545.417) [-538.341] -- 0:01:02
46000 -- [-532.024] (-535.748) (-532.804) (-535.695) * [-534.409] (-533.985) (-545.032) (-545.065) -- 0:01:02
46500 -- (-532.779) [-532.955] (-534.991) (-532.835) * (-536.819) (-533.977) (-546.935) [-540.364] -- 0:01:01
47000 -- [-533.597] (-535.218) (-532.481) (-534.472) * [-539.149] (-532.153) (-546.345) (-546.630) -- 0:01:00
47500 -- (-531.682) [-533.542] (-532.906) (-536.457) * (-534.878) (-532.335) (-540.921) [-550.398] -- 0:01:00
48000 -- (-532.320) (-534.025) (-533.383) [-535.361] * (-532.118) (-533.050) (-543.155) [-543.930] -- 0:00:59
48500 -- (-534.930) [-532.299] (-535.719) (-534.065) * [-532.185] (-533.760) (-543.851) (-539.117) -- 0:00:58
49000 -- [-534.083] (-532.730) (-535.381) (-540.101) * [-532.170] (-532.713) (-540.985) (-555.328) -- 0:00:58
49500 -- [-533.645] (-533.120) (-534.129) (-533.567) * [-533.787] (-534.216) (-553.798) (-542.211) -- 0:00:57
50000 -- [-533.887] (-533.930) (-533.714) (-533.328) * (-532.055) (-534.616) [-544.082] (-546.825) -- 0:00:57
Average standard deviation of split frequencies: 0.045251
50500 -- (-532.976) (-533.934) [-532.796] (-538.734) * (-533.014) (-531.610) (-542.184) [-540.740] -- 0:00:56
51000 -- [-534.215] (-534.490) (-532.237) (-534.834) * (-534.623) (-534.509) [-544.344] (-547.113) -- 0:00:55
51500 -- (-533.731) (-532.277) (-534.875) [-533.212] * (-533.122) (-534.694) [-537.970] (-542.956) -- 0:00:55
52000 -- [-533.989] (-532.099) (-533.285) (-535.722) * (-534.600) (-533.202) [-541.801] (-547.392) -- 0:00:54
52500 -- [-534.051] (-533.760) (-533.421) (-533.762) * [-534.426] (-532.023) (-544.306) (-543.870) -- 0:01:12
53000 -- (-533.198) (-532.953) [-540.881] (-533.409) * (-534.300) [-533.651] (-547.669) (-548.200) -- 0:01:11
53500 -- [-532.278] (-533.860) (-533.985) (-534.972) * [-536.778] (-534.802) (-544.839) (-540.768) -- 0:01:10
54000 -- (-532.678) (-533.925) (-536.228) [-532.635] * (-537.856) (-533.305) [-540.131] (-543.692) -- 0:01:10
54500 -- (-533.704) [-532.866] (-533.944) (-534.340) * (-537.745) (-533.980) (-547.426) [-536.265] -- 0:01:09
55000 -- (-536.017) [-532.637] (-532.137) (-533.517) * (-536.734) (-532.739) [-541.550] (-552.023) -- 0:01:08
Average standard deviation of split frequencies: 0.040486
55500 -- (-533.848) [-533.271] (-536.406) (-534.206) * (-538.277) (-533.295) [-537.916] (-547.802) -- 0:01:08
56000 -- (-535.982) [-533.085] (-537.238) (-534.680) * (-535.463) (-535.356) (-545.610) [-541.153] -- 0:01:07
56500 -- (-534.653) [-535.238] (-534.820) (-535.273) * (-533.976) [-538.149] (-538.881) (-541.129) -- 0:01:06
57000 -- (-531.947) (-532.822) (-532.450) [-533.059] * (-533.455) (-535.815) [-544.208] (-542.074) -- 0:01:06
57500 -- (-537.137) [-532.934] (-536.874) (-533.492) * (-531.837) (-535.236) (-545.788) [-540.854] -- 0:01:05
58000 -- (-534.250) (-532.361) [-536.945] (-535.182) * (-533.079) [-531.944] (-546.525) (-539.753) -- 0:01:04
58500 -- (-535.260) [-532.029] (-535.918) (-533.178) * (-531.575) (-535.584) (-542.570) [-541.446] -- 0:01:04
59000 -- [-535.179] (-533.445) (-538.414) (-533.081) * (-534.017) [-532.296] (-540.874) (-554.188) -- 0:01:03
59500 -- (-533.254) (-532.827) (-534.165) [-532.583] * (-534.798) (-539.829) (-546.093) [-541.113] -- 0:01:03
60000 -- [-533.934] (-533.407) (-535.795) (-532.533) * [-536.271] (-536.023) (-541.388) (-543.990) -- 0:01:02
Average standard deviation of split frequencies: 0.033672
60500 -- (-534.053) [-535.406] (-533.461) (-533.475) * (-533.274) [-531.497] (-552.425) (-548.062) -- 0:01:02
61000 -- (-532.178) (-531.686) [-533.564] (-536.560) * [-534.677] (-533.894) (-539.842) (-549.897) -- 0:01:01
61500 -- (-533.085) (-533.368) [-532.497] (-536.480) * (-533.381) [-532.947] (-540.161) (-542.738) -- 0:01:01
62000 -- (-532.452) (-532.396) [-531.828] (-532.169) * (-533.928) (-533.754) (-542.754) [-543.093] -- 0:01:00
62500 -- (-533.617) (-532.165) [-535.385] (-533.622) * (-537.343) (-536.135) [-539.439] (-541.407) -- 0:01:00
63000 -- [-531.981] (-532.600) (-532.914) (-535.052) * (-533.295) (-534.490) (-546.324) [-542.910] -- 0:00:59
63500 -- (-532.914) (-533.310) (-534.988) [-533.518] * (-534.043) (-535.180) (-545.427) [-542.250] -- 0:00:58
64000 -- [-535.366] (-534.031) (-536.834) (-534.403) * [-533.043] (-532.041) (-547.092) (-538.435) -- 0:00:58
64500 -- [-533.873] (-536.960) (-533.641) (-533.064) * [-532.948] (-535.137) (-544.125) (-544.979) -- 0:00:58
65000 -- (-533.585) (-534.305) (-534.476) [-534.847] * (-534.419) [-532.064] (-551.690) (-542.377) -- 0:00:57
Average standard deviation of split frequencies: 0.033672
65500 -- (-537.269) (-535.565) (-534.371) [-534.169] * [-534.891] (-531.851) (-553.485) (-542.641) -- 0:00:57
66000 -- (-532.870) [-532.054] (-535.450) (-533.352) * (-532.692) [-531.763] (-541.794) (-543.182) -- 0:00:56
66500 -- [-533.112] (-533.564) (-537.446) (-531.526) * (-534.738) [-533.041] (-546.814) (-545.072) -- 0:00:56
67000 -- (-534.294) (-531.857) [-533.051] (-533.285) * [-535.703] (-533.020) (-544.873) (-548.214) -- 0:00:55
67500 -- (-534.840) (-533.434) [-532.462] (-540.145) * (-535.595) [-534.270] (-545.187) (-557.194) -- 0:00:55
68000 -- (-533.421) (-533.113) (-540.132) [-533.675] * (-533.592) [-533.664] (-544.741) (-539.818) -- 0:00:54
68500 -- (-534.453) (-535.702) (-537.704) [-533.650] * (-535.284) (-532.024) [-533.652] (-534.736) -- 0:00:54
69000 -- (-537.174) (-532.385) (-533.012) [-534.794] * (-535.984) (-533.003) (-532.989) [-534.879] -- 0:01:07
69500 -- (-536.237) [-533.185] (-534.211) (-532.443) * (-533.999) [-533.789] (-534.508) (-532.164) -- 0:01:06
70000 -- (-532.578) (-533.222) [-533.234] (-531.875) * (-533.707) (-532.680) [-534.118] (-532.292) -- 0:01:06
Average standard deviation of split frequencies: 0.032141
70500 -- (-535.505) [-534.157] (-531.787) (-532.408) * (-534.285) (-532.073) [-536.554] (-534.049) -- 0:01:05
71000 -- (-532.604) [-532.430] (-536.059) (-532.822) * (-538.326) [-534.037] (-535.412) (-534.156) -- 0:01:05
71500 -- (-531.842) (-531.686) [-534.672] (-534.612) * (-535.743) (-533.261) [-533.769] (-534.281) -- 0:01:04
72000 -- [-535.162] (-534.453) (-533.698) (-536.032) * (-531.674) (-532.566) [-532.602] (-533.479) -- 0:01:04
72500 -- (-534.020) (-535.141) (-533.454) [-533.553] * (-531.880) (-534.051) [-532.572] (-534.562) -- 0:01:03
73000 -- (-536.218) [-532.571] (-535.603) (-539.324) * [-533.511] (-535.469) (-537.710) (-535.008) -- 0:01:03
73500 -- (-534.182) (-534.044) (-533.737) [-532.241] * (-533.105) (-535.765) (-534.905) [-533.143] -- 0:01:03
74000 -- (-533.809) (-534.609) (-533.697) [-534.151] * (-531.912) [-534.045] (-535.085) (-534.647) -- 0:01:02
74500 -- (-535.962) (-535.947) (-534.188) [-535.261] * (-532.920) (-533.427) (-532.333) [-533.444] -- 0:01:02
75000 -- [-532.708] (-534.739) (-535.136) (-532.087) * (-531.907) (-532.681) (-535.764) [-533.530] -- 0:01:01
Average standard deviation of split frequencies: 0.028843
75500 -- (-533.953) (-533.974) [-532.203] (-532.616) * [-532.283] (-535.241) (-536.477) (-535.370) -- 0:01:01
76000 -- (-533.533) [-536.047] (-534.688) (-532.521) * [-535.091] (-538.118) (-536.111) (-536.165) -- 0:01:00
76500 -- [-533.521] (-540.322) (-534.055) (-532.734) * (-533.027) (-533.373) [-533.987] (-533.720) -- 0:01:00
77000 -- (-532.705) (-538.051) (-534.727) [-532.287] * [-533.468] (-532.906) (-534.529) (-536.703) -- 0:00:59
77500 -- [-532.892] (-540.622) (-533.049) (-533.635) * (-532.688) [-533.428] (-532.845) (-533.155) -- 0:00:59
78000 -- [-534.290] (-533.161) (-532.393) (-535.359) * (-532.761) (-534.370) (-535.171) [-534.580] -- 0:00:59
78500 -- [-535.055] (-532.986) (-535.846) (-532.880) * (-533.485) (-535.127) [-537.007] (-532.932) -- 0:00:58
79000 -- (-533.667) (-533.848) [-532.694] (-532.770) * (-532.122) [-533.279] (-534.988) (-533.952) -- 0:00:58
79500 -- (-534.514) (-535.629) [-532.006] (-537.891) * (-536.035) (-535.787) (-533.751) [-535.082] -- 0:00:57
80000 -- (-532.186) [-534.541] (-535.660) (-536.291) * [-534.787] (-533.721) (-534.590) (-533.862) -- 0:00:57
Average standard deviation of split frequencies: 0.028106
80500 -- [-531.626] (-532.305) (-532.364) (-535.515) * (-532.010) [-533.796] (-533.135) (-533.850) -- 0:00:57
81000 -- (-533.991) (-532.308) [-533.663] (-534.961) * (-535.623) (-535.652) [-533.305] (-537.919) -- 0:00:56
81500 -- (-532.417) (-534.437) [-533.702] (-533.619) * (-536.153) (-536.607) [-533.954] (-532.669) -- 0:00:56
82000 -- (-533.403) [-531.999] (-534.439) (-535.795) * (-534.429) (-535.222) (-534.234) [-534.200] -- 0:00:55
82500 -- (-533.987) (-534.019) [-533.978] (-535.778) * (-535.923) (-535.468) (-533.560) [-534.331] -- 0:00:55
83000 -- [-534.134] (-540.469) (-534.244) (-532.224) * (-534.595) [-534.220] (-537.212) (-533.212) -- 0:00:55
83500 -- [-533.361] (-544.723) (-534.998) (-532.215) * (-535.042) [-532.458] (-534.648) (-532.114) -- 0:00:54
84000 -- (-534.319) [-535.940] (-537.989) (-534.584) * [-535.045] (-533.508) (-533.830) (-531.997) -- 0:00:54
84500 -- [-532.604] (-533.429) (-536.051) (-534.862) * [-535.301] (-532.476) (-534.314) (-532.626) -- 0:01:05
85000 -- (-532.762) (-532.464) [-532.490] (-533.931) * (-536.273) [-532.204] (-533.825) (-532.525) -- 0:01:04
Average standard deviation of split frequencies: 0.031062
85500 -- [-536.283] (-531.811) (-532.963) (-533.246) * [-532.901] (-536.916) (-534.999) (-534.622) -- 0:01:04
86000 -- (-532.726) [-532.825] (-535.667) (-534.272) * (-532.865) (-535.065) [-532.490] (-536.088) -- 0:01:03
86500 -- (-533.579) (-532.412) (-537.583) [-534.955] * (-537.315) (-533.964) (-532.991) [-534.189] -- 0:01:03
87000 -- (-534.568) (-533.308) (-537.901) [-536.936] * (-537.383) [-534.339] (-533.408) (-531.980) -- 0:01:02
87500 -- (-538.295) [-533.930] (-535.549) (-536.096) * (-535.296) [-533.489] (-532.333) (-532.460) -- 0:01:02
88000 -- (-532.562) (-531.805) [-532.739] (-540.212) * [-534.554] (-535.212) (-534.070) (-532.544) -- 0:01:02
88500 -- [-533.473] (-532.249) (-532.627) (-535.466) * (-531.644) (-533.755) (-532.663) [-533.086] -- 0:01:01
89000 -- (-533.368) [-533.750] (-532.706) (-534.201) * [-532.448] (-536.458) (-533.761) (-534.637) -- 0:01:01
89500 -- [-537.924] (-536.888) (-534.416) (-534.943) * (-532.140) (-533.995) [-532.118] (-532.221) -- 0:01:01
90000 -- (-539.111) (-533.695) [-535.028] (-533.858) * (-533.059) (-533.749) (-532.323) [-533.388] -- 0:01:00
Average standard deviation of split frequencies: 0.029896
90500 -- [-532.262] (-533.573) (-534.657) (-535.352) * (-534.597) (-535.519) [-532.427] (-536.109) -- 0:01:00
91000 -- [-533.138] (-534.934) (-534.489) (-540.886) * (-534.323) (-534.373) (-531.800) [-533.189] -- 0:00:59
91500 -- [-535.434] (-535.248) (-539.047) (-535.056) * (-533.286) (-533.558) (-533.578) [-533.568] -- 0:00:59
92000 -- (-532.488) [-537.718] (-532.776) (-535.885) * (-533.384) (-534.231) [-535.115] (-534.030) -- 0:00:59
92500 -- (-533.453) [-533.712] (-533.112) (-536.021) * [-534.100] (-533.210) (-533.176) (-534.439) -- 0:00:58
93000 -- [-532.900] (-533.600) (-538.569) (-533.660) * (-536.059) (-533.807) (-534.960) [-533.138] -- 0:00:58
93500 -- [-534.507] (-534.625) (-536.628) (-537.011) * (-535.038) (-532.313) (-533.314) [-534.900] -- 0:00:58
94000 -- (-537.033) (-533.593) [-533.959] (-534.386) * (-531.678) [-531.654] (-533.180) (-534.415) -- 0:00:57
94500 -- [-533.281] (-532.610) (-533.973) (-535.253) * (-531.880) (-531.970) [-532.932] (-535.522) -- 0:00:57
95000 -- (-533.443) (-532.519) [-534.135] (-536.163) * (-533.120) (-539.138) (-533.831) [-535.077] -- 0:00:57
Average standard deviation of split frequencies: 0.028429
95500 -- (-532.771) [-532.038] (-537.794) (-537.889) * (-533.212) (-538.328) (-533.378) [-533.252] -- 0:00:56
96000 -- (-532.608) (-533.813) (-535.156) [-537.062] * [-535.914] (-534.901) (-532.758) (-533.737) -- 0:00:56
96500 -- (-535.873) [-531.897] (-533.766) (-535.424) * (-534.622) [-535.918] (-535.761) (-535.389) -- 0:00:56
97000 -- (-534.816) [-534.150] (-535.617) (-533.754) * [-531.943] (-534.895) (-534.151) (-533.464) -- 0:00:55
97500 -- [-533.733] (-537.622) (-534.967) (-535.335) * (-536.278) (-533.323) (-539.982) [-532.980] -- 0:00:55
98000 -- (-535.639) (-534.271) [-534.255] (-536.371) * (-533.694) (-532.802) [-538.177] (-538.673) -- 0:00:55
98500 -- [-533.028] (-533.663) (-533.765) (-533.768) * (-535.829) (-533.805) (-531.665) [-534.541] -- 0:00:54
99000 -- (-534.283) (-533.959) (-536.788) [-536.780] * (-532.609) (-534.310) (-532.034) [-533.247] -- 0:00:54
99500 -- (-535.814) [-535.441] (-533.276) (-534.025) * (-535.370) [-532.593] (-532.971) (-532.751) -- 0:01:03
100000 -- (-537.369) [-534.514] (-534.468) (-535.267) * (-535.838) (-532.112) [-533.874] (-535.627) -- 0:01:02
Average standard deviation of split frequencies: 0.026796
100500 -- (-535.091) (-532.245) [-534.362] (-535.130) * (-532.471) (-533.683) (-534.119) [-531.974] -- 0:01:02
101000 -- [-533.925] (-533.449) (-536.374) (-534.964) * (-532.344) (-532.892) (-533.196) [-533.865] -- 0:01:02
101500 -- (-533.641) [-532.653] (-532.798) (-535.180) * [-532.529] (-534.700) (-534.905) (-532.645) -- 0:01:01
102000 -- [-533.216] (-532.433) (-532.961) (-535.668) * (-536.417) [-531.542] (-533.022) (-535.407) -- 0:01:01
102500 -- [-534.455] (-532.973) (-532.372) (-533.367) * (-535.538) (-531.524) (-532.800) [-535.590] -- 0:01:01
103000 -- (-534.896) (-533.621) [-532.679] (-533.640) * (-534.677) [-531.700] (-533.086) (-532.626) -- 0:01:00
103500 -- (-534.583) (-536.094) [-532.304] (-534.255) * (-532.779) (-533.309) [-533.011] (-532.039) -- 0:01:00
104000 -- (-533.046) [-533.375] (-532.202) (-539.761) * (-532.499) [-532.712] (-533.761) (-532.664) -- 0:01:00
104500 -- (-533.816) (-533.986) [-536.158] (-537.670) * (-534.275) (-533.159) (-533.017) [-535.235] -- 0:00:59
105000 -- (-534.999) [-533.083] (-540.679) (-532.641) * (-533.237) [-532.466] (-538.000) (-534.841) -- 0:00:59
Average standard deviation of split frequencies: 0.023640
105500 -- [-536.603] (-533.417) (-533.126) (-535.663) * [-533.529] (-532.499) (-535.547) (-533.873) -- 0:00:59
106000 -- (-533.797) (-538.329) [-533.600] (-535.180) * (-534.161) (-534.892) [-533.635] (-533.448) -- 0:00:59
106500 -- [-532.551] (-532.955) (-534.025) (-534.312) * (-532.734) (-534.093) [-537.292] (-535.609) -- 0:00:58
107000 -- [-536.994] (-532.516) (-533.154) (-535.002) * (-533.959) [-534.930] (-533.266) (-535.400) -- 0:00:58
107500 -- [-537.230] (-532.544) (-532.549) (-534.381) * [-533.327] (-533.896) (-532.876) (-537.464) -- 0:00:58
108000 -- (-534.259) (-536.643) (-532.432) [-532.266] * (-533.707) [-532.597] (-534.702) (-537.625) -- 0:00:57
108500 -- (-534.134) (-535.886) [-532.567] (-534.104) * (-533.806) (-533.880) [-532.762] (-536.381) -- 0:00:57
109000 -- (-534.152) (-533.107) [-532.708] (-532.678) * (-533.593) (-533.826) [-533.571] (-535.380) -- 0:00:57
109500 -- [-532.711] (-533.284) (-533.437) (-535.899) * (-534.296) [-535.182] (-534.809) (-532.230) -- 0:00:56
110000 -- (-532.722) (-533.200) (-534.099) [-533.516] * (-532.486) [-535.887] (-533.163) (-535.043) -- 0:00:56
Average standard deviation of split frequencies: 0.022195
110500 -- [-534.117] (-533.342) (-537.096) (-534.904) * [-532.857] (-532.114) (-536.296) (-532.296) -- 0:00:56
111000 -- (-537.458) [-533.261] (-533.170) (-532.158) * (-533.796) [-532.954] (-534.032) (-533.055) -- 0:00:56
111500 -- (-534.644) [-531.946] (-532.551) (-533.950) * (-535.492) (-532.555) (-535.416) [-533.605] -- 0:00:55
112000 -- (-536.374) [-533.545] (-533.844) (-532.755) * (-539.222) (-533.471) [-533.904] (-532.948) -- 0:00:55
112500 -- (-532.338) [-534.211] (-534.167) (-534.745) * (-533.102) (-533.942) (-533.787) [-533.905] -- 0:00:55
113000 -- [-531.787] (-538.785) (-533.733) (-535.316) * (-533.893) (-531.610) (-533.452) [-531.783] -- 0:00:54
113500 -- [-532.525] (-532.812) (-532.545) (-536.353) * (-535.587) (-535.732) (-534.104) [-531.554] -- 0:00:54
114000 -- [-531.833] (-533.159) (-532.572) (-534.041) * (-533.951) (-536.248) (-533.518) [-533.118] -- 0:00:54
114500 -- (-539.267) (-532.749) (-535.202) [-534.528] * (-534.545) (-532.296) (-532.063) [-534.038] -- 0:00:54
115000 -- [-532.417] (-536.683) (-532.434) (-533.418) * [-533.425] (-534.742) (-534.779) (-533.381) -- 0:01:01
Average standard deviation of split frequencies: 0.024835
115500 -- [-534.793] (-536.341) (-532.932) (-536.222) * (-531.853) (-531.976) [-535.169] (-537.310) -- 0:01:01
116000 -- (-532.861) [-532.521] (-534.120) (-533.036) * (-531.698) (-534.245) (-536.052) [-532.419] -- 0:01:00
116500 -- (-539.852) (-532.992) (-534.487) [-532.301] * [-533.315] (-536.570) (-535.092) (-531.473) -- 0:01:00
117000 -- (-533.011) (-533.267) (-537.230) [-532.281] * (-532.653) (-538.168) (-532.864) [-535.556] -- 0:01:00
117500 -- (-532.917) (-532.330) [-536.238] (-533.198) * (-534.967) [-532.742] (-533.824) (-532.508) -- 0:01:00
118000 -- (-534.583) (-531.810) [-534.052] (-535.932) * (-532.032) (-536.341) [-534.908] (-532.384) -- 0:00:59
118500 -- [-532.007] (-532.345) (-534.711) (-534.135) * (-532.530) [-535.321] (-537.067) (-532.865) -- 0:00:59
119000 -- (-533.174) (-533.178) (-534.692) [-533.823] * (-535.552) [-534.056] (-534.976) (-535.176) -- 0:00:59
119500 -- (-535.925) (-533.117) (-532.476) [-533.529] * (-533.414) (-534.733) (-532.621) [-535.625] -- 0:00:58
120000 -- (-534.707) [-534.461] (-533.615) (-537.329) * (-533.920) (-533.201) [-534.972] (-532.517) -- 0:00:58
Average standard deviation of split frequencies: 0.026044
120500 -- (-533.579) (-534.710) [-531.969] (-534.632) * (-535.481) (-533.175) (-532.582) [-532.311] -- 0:00:58
121000 -- (-533.056) (-533.232) [-533.453] (-533.602) * (-532.368) (-531.852) (-535.068) [-532.259] -- 0:00:58
121500 -- (-533.673) [-532.218] (-535.484) (-533.308) * (-532.221) [-533.118] (-535.663) (-533.199) -- 0:00:57
122000 -- [-534.625] (-532.438) (-532.905) (-537.754) * (-533.826) [-531.868] (-536.644) (-534.853) -- 0:00:57
122500 -- (-534.434) [-535.125] (-534.966) (-535.946) * [-531.787] (-534.584) (-533.839) (-537.345) -- 0:00:57
123000 -- [-534.925] (-533.503) (-534.677) (-533.266) * [-532.034] (-534.250) (-534.188) (-532.524) -- 0:00:57
123500 -- (-532.215) (-532.739) (-533.191) [-532.970] * (-533.487) (-531.949) (-533.035) [-533.344] -- 0:00:56
124000 -- [-535.831] (-534.845) (-535.808) (-531.705) * (-532.397) (-532.453) (-531.564) [-534.546] -- 0:00:56
124500 -- (-533.380) [-533.459] (-534.740) (-532.047) * (-532.229) (-534.913) (-532.462) [-533.369] -- 0:00:56
125000 -- (-532.425) [-532.354] (-534.820) (-531.594) * (-534.908) (-536.806) [-532.607] (-532.938) -- 0:00:56
Average standard deviation of split frequencies: 0.024506
125500 -- (-532.632) (-534.638) (-532.923) [-541.242] * (-533.099) [-536.506] (-532.929) (-533.322) -- 0:00:55
126000 -- (-534.276) [-534.946] (-533.531) (-533.624) * [-532.259] (-534.919) (-534.784) (-533.200) -- 0:00:55
126500 -- (-534.333) (-533.196) [-532.434] (-533.985) * (-533.041) (-535.303) (-531.956) [-535.301] -- 0:00:55
127000 -- [-533.046] (-534.119) (-532.596) (-533.423) * (-537.024) [-537.495] (-533.697) (-532.213) -- 0:00:54
127500 -- (-532.257) [-532.898] (-532.764) (-536.664) * (-541.613) [-533.346] (-532.001) (-532.766) -- 0:00:54
128000 -- (-532.290) (-537.447) (-535.021) [-535.621] * [-532.076] (-534.354) (-533.673) (-535.099) -- 0:00:54
128500 -- (-533.911) (-534.117) (-536.923) [-534.595] * (-533.444) (-532.340) [-534.836] (-533.870) -- 0:00:54
129000 -- (-535.862) [-532.107] (-539.030) (-534.869) * [-533.219] (-533.823) (-534.395) (-542.177) -- 0:00:54
129500 -- [-534.161] (-533.017) (-536.259) (-535.620) * (-536.089) (-533.607) (-533.682) [-535.503] -- 0:00:53
130000 -- (-535.171) (-534.986) (-539.746) [-536.327] * (-531.976) (-534.064) (-533.020) [-532.195] -- 0:00:53
Average standard deviation of split frequencies: 0.025073
130500 -- [-532.486] (-535.797) (-533.483) (-534.270) * (-533.625) (-535.376) [-533.513] (-534.854) -- 0:00:59
131000 -- (-532.042) [-532.102] (-537.494) (-533.116) * (-537.413) [-531.692] (-532.571) (-537.374) -- 0:00:59
131500 -- (-533.123) (-540.042) [-532.916] (-531.947) * (-536.452) [-534.812] (-534.466) (-535.807) -- 0:00:59
132000 -- (-534.450) [-533.476] (-535.769) (-535.994) * [-533.395] (-537.193) (-535.470) (-533.791) -- 0:00:59
132500 -- (-533.269) [-533.881] (-539.963) (-535.965) * (-535.271) [-534.102] (-532.290) (-532.512) -- 0:00:58
133000 -- (-533.496) (-533.606) [-533.205] (-534.005) * [-539.986] (-534.707) (-532.301) (-532.805) -- 0:00:58
133500 -- [-533.515] (-533.281) (-535.316) (-537.993) * (-538.479) (-534.500) (-536.590) [-533.290] -- 0:00:58
134000 -- (-533.054) [-532.077] (-536.594) (-536.873) * (-538.379) (-542.811) (-537.604) [-532.776] -- 0:00:58
134500 -- (-533.680) (-536.400) [-532.430] (-535.343) * (-532.905) (-538.591) (-536.815) [-537.367] -- 0:00:57
135000 -- (-533.618) (-534.318) (-535.595) [-535.542] * [-533.579] (-532.334) (-534.850) (-532.298) -- 0:00:57
Average standard deviation of split frequencies: 0.022622
135500 -- [-532.185] (-534.541) (-532.429) (-534.861) * [-537.680] (-532.732) (-533.719) (-535.911) -- 0:00:57
136000 -- (-533.209) (-534.914) (-531.718) [-534.387] * (-534.117) (-533.552) (-533.958) [-533.973] -- 0:00:57
136500 -- (-534.065) (-534.677) [-532.924] (-532.664) * [-532.179] (-536.464) (-534.206) (-534.193) -- 0:00:56
137000 -- (-533.454) [-533.009] (-532.695) (-535.081) * [-535.122] (-536.408) (-535.250) (-533.601) -- 0:00:56
137500 -- (-533.014) (-538.080) (-534.094) [-534.122] * (-534.662) [-534.609] (-534.404) (-534.084) -- 0:00:56
138000 -- (-533.001) (-534.194) (-534.328) [-533.361] * (-534.465) (-533.766) (-536.024) [-535.243] -- 0:00:56
138500 -- (-535.242) [-533.869] (-534.074) (-533.854) * [-532.373] (-536.762) (-538.095) (-532.859) -- 0:00:55
139000 -- (-533.843) [-541.004] (-532.394) (-532.134) * [-535.889] (-534.197) (-534.106) (-532.711) -- 0:00:55
139500 -- (-532.176) [-536.396] (-537.225) (-532.806) * (-534.418) (-537.059) [-533.622] (-533.031) -- 0:00:55
140000 -- (-533.340) (-535.818) [-537.260] (-534.211) * (-537.737) (-540.244) [-533.223] (-536.458) -- 0:00:55
Average standard deviation of split frequencies: 0.021518
140500 -- (-534.169) (-538.369) [-533.040] (-535.482) * (-539.263) [-534.637] (-532.337) (-533.361) -- 0:00:55
141000 -- (-533.028) (-540.496) [-533.932] (-535.535) * (-532.833) (-535.395) [-533.338] (-534.786) -- 0:00:54
141500 -- [-532.668] (-535.235) (-533.621) (-534.801) * (-531.965) [-532.218] (-534.907) (-533.156) -- 0:00:54
142000 -- (-536.137) (-538.534) [-533.730] (-536.902) * (-531.521) (-532.201) [-533.047] (-534.228) -- 0:00:54
142500 -- (-532.319) [-532.361] (-534.859) (-535.475) * [-532.789] (-531.933) (-536.089) (-535.972) -- 0:00:54
143000 -- (-532.390) [-534.779] (-534.586) (-532.901) * [-533.012] (-535.777) (-532.170) (-535.056) -- 0:00:53
143500 -- [-533.527] (-533.025) (-532.133) (-533.239) * (-532.942) (-533.788) [-533.896] (-537.493) -- 0:00:53
144000 -- (-533.419) (-533.057) (-533.498) [-531.887] * [-538.964] (-533.196) (-533.778) (-539.135) -- 0:00:53
144500 -- [-532.750] (-535.510) (-535.238) (-532.705) * [-534.914] (-533.308) (-532.945) (-532.824) -- 0:00:53
145000 -- (-532.461) [-538.522] (-533.815) (-532.130) * (-533.949) [-534.685] (-534.279) (-533.456) -- 0:00:53
Average standard deviation of split frequencies: 0.020142
145500 -- (-535.240) [-533.135] (-536.112) (-533.684) * (-533.346) (-536.164) [-532.054] (-532.261) -- 0:00:52
146000 -- (-534.826) (-536.081) [-534.102] (-533.216) * (-536.020) (-535.496) (-534.381) [-535.562] -- 0:00:52
146500 -- (-535.836) [-532.435] (-535.387) (-533.143) * [-536.469] (-532.609) (-532.735) (-534.306) -- 0:00:58
147000 -- (-533.859) [-537.528] (-532.992) (-534.580) * [-536.834] (-534.483) (-534.261) (-531.683) -- 0:00:58
147500 -- (-534.649) (-532.886) (-534.312) [-533.573] * (-537.337) (-533.199) (-533.429) [-532.286] -- 0:00:57
148000 -- [-534.505] (-536.263) (-533.383) (-533.188) * (-537.551) (-534.464) (-533.755) [-532.328] -- 0:00:57
148500 -- [-534.514] (-536.249) (-534.501) (-532.359) * (-536.140) [-533.369] (-536.595) (-535.619) -- 0:00:57
149000 -- (-533.804) [-533.317] (-542.571) (-531.905) * [-533.323] (-536.233) (-534.058) (-536.501) -- 0:00:57
149500 -- (-534.040) (-533.642) (-535.582) [-532.950] * [-535.899] (-536.720) (-531.985) (-535.209) -- 0:00:56
150000 -- [-532.547] (-534.690) (-533.799) (-531.605) * (-537.183) (-538.425) [-532.422] (-533.649) -- 0:00:56
Average standard deviation of split frequencies: 0.021572
150500 -- (-540.813) [-533.280] (-532.643) (-532.543) * [-534.695] (-535.095) (-531.891) (-534.339) -- 0:00:56
151000 -- (-538.190) (-532.197) (-533.080) [-533.978] * (-533.278) [-534.024] (-533.213) (-533.000) -- 0:00:56
151500 -- (-536.897) (-535.906) [-532.448] (-533.916) * (-533.740) (-535.381) (-533.445) [-532.326] -- 0:00:56
152000 -- [-534.417] (-533.488) (-535.181) (-534.798) * (-532.588) [-534.404] (-533.435) (-533.082) -- 0:00:55
152500 -- [-533.299] (-533.510) (-535.460) (-536.065) * [-533.220] (-533.341) (-534.679) (-532.909) -- 0:00:55
153000 -- (-534.906) (-532.594) (-535.984) [-533.583] * (-534.222) (-533.774) [-533.451] (-534.446) -- 0:00:55
153500 -- (-532.344) (-534.425) [-533.732] (-540.416) * [-531.964] (-534.167) (-532.929) (-535.931) -- 0:00:55
154000 -- (-534.041) [-533.731] (-533.772) (-533.943) * (-535.242) [-532.984] (-532.882) (-535.525) -- 0:00:54
154500 -- (-532.125) (-532.658) [-532.482] (-533.745) * (-538.427) (-532.320) (-532.934) [-535.428] -- 0:00:54
155000 -- (-531.805) (-531.722) [-532.104] (-535.460) * (-545.104) [-532.110] (-534.770) (-532.572) -- 0:00:54
Average standard deviation of split frequencies: 0.022042
155500 -- (-532.815) [-533.043] (-534.130) (-535.400) * (-534.406) (-534.644) [-536.469] (-532.819) -- 0:00:54
156000 -- [-533.513] (-534.772) (-533.450) (-533.921) * (-536.365) (-535.225) (-535.563) [-534.718] -- 0:00:54
156500 -- (-533.306) (-533.248) [-534.571] (-534.420) * (-533.409) [-537.262] (-539.245) (-533.993) -- 0:00:53
157000 -- [-533.293] (-532.781) (-534.360) (-533.499) * (-534.144) [-536.089] (-534.372) (-532.531) -- 0:00:53
157500 -- (-540.883) (-532.688) (-535.055) [-531.768] * [-533.722] (-532.994) (-534.462) (-533.969) -- 0:00:53
158000 -- [-533.647] (-533.073) (-533.882) (-545.733) * (-534.242) (-533.889) (-531.987) [-535.177] -- 0:00:53
158500 -- (-534.514) (-532.418) (-534.924) [-532.885] * (-534.597) (-534.846) [-534.447] (-531.967) -- 0:00:53
159000 -- (-535.865) (-534.670) (-534.475) [-533.757] * [-532.775] (-534.853) (-532.169) (-534.104) -- 0:00:52
159500 -- (-532.692) (-532.492) (-534.641) [-531.594] * [-533.143] (-537.201) (-533.426) (-536.453) -- 0:00:52
160000 -- (-535.809) (-535.045) (-533.279) [-531.594] * (-533.891) [-532.811] (-536.704) (-535.701) -- 0:00:52
Average standard deviation of split frequencies: 0.022168
160500 -- (-532.139) (-533.543) [-534.093] (-536.336) * [-536.012] (-532.882) (-534.732) (-533.005) -- 0:00:52
161000 -- [-531.897] (-538.587) (-534.037) (-533.007) * (-536.607) [-531.899] (-533.934) (-534.273) -- 0:00:52
161500 -- (-535.234) (-532.872) [-534.449] (-533.693) * [-533.083] (-532.304) (-533.419) (-532.873) -- 0:00:51
162000 -- (-537.589) (-533.394) [-533.698] (-532.643) * (-532.646) (-533.916) (-540.831) [-534.661] -- 0:00:56
162500 -- (-536.193) (-537.091) (-531.633) [-536.877] * (-537.445) (-532.917) (-533.214) [-534.957] -- 0:00:56
163000 -- (-535.177) [-537.999] (-538.821) (-531.756) * (-534.534) (-532.829) [-537.612] (-534.086) -- 0:00:56
163500 -- [-535.535] (-537.455) (-533.468) (-533.137) * (-536.509) [-534.603] (-535.197) (-532.495) -- 0:00:56
164000 -- (-532.864) (-534.808) [-532.089] (-535.237) * (-533.016) (-533.929) [-532.625] (-537.390) -- 0:00:56
164500 -- [-532.538] (-536.530) (-535.775) (-534.403) * [-532.782] (-531.850) (-535.489) (-535.648) -- 0:00:55
165000 -- [-533.986] (-535.617) (-535.771) (-533.168) * (-533.734) (-533.437) (-536.292) [-533.306] -- 0:00:55
Average standard deviation of split frequencies: 0.020775
165500 -- (-534.002) (-535.799) (-532.880) [-533.711] * [-533.946] (-532.796) (-535.092) (-531.591) -- 0:00:55
166000 -- [-532.152] (-534.291) (-533.315) (-533.171) * [-532.813] (-534.994) (-532.786) (-532.557) -- 0:00:55
166500 -- (-533.329) (-534.166) [-535.093] (-538.313) * [-533.066] (-533.863) (-535.707) (-532.927) -- 0:00:55
167000 -- (-531.941) [-533.346] (-535.138) (-533.893) * (-532.618) (-532.127) (-532.317) [-532.851] -- 0:00:54
167500 -- [-531.974] (-533.873) (-535.452) (-532.127) * (-534.088) (-532.398) [-532.156] (-532.538) -- 0:00:54
168000 -- [-531.866] (-535.496) (-534.923) (-537.212) * (-535.103) (-535.654) (-536.351) [-537.343] -- 0:00:54
168500 -- [-532.849] (-536.762) (-534.273) (-535.739) * (-534.368) [-534.948] (-533.312) (-532.174) -- 0:00:54
169000 -- (-536.295) (-532.755) [-534.064] (-534.338) * [-535.041] (-532.827) (-534.720) (-532.895) -- 0:00:54
169500 -- (-532.336) (-534.331) (-535.413) [-534.010] * [-535.212] (-535.393) (-537.715) (-534.116) -- 0:00:53
170000 -- (-533.065) (-533.438) (-534.395) [-531.950] * [-533.379] (-533.216) (-533.888) (-534.024) -- 0:00:53
Average standard deviation of split frequencies: 0.018875
170500 -- (-536.185) (-532.017) (-533.060) [-531.885] * (-533.539) [-533.073] (-533.686) (-532.861) -- 0:00:53
171000 -- (-532.139) (-536.913) [-533.187] (-533.167) * [-534.827] (-534.347) (-533.610) (-535.235) -- 0:00:53
171500 -- [-533.930] (-535.604) (-537.799) (-533.001) * (-533.854) [-533.522] (-535.209) (-533.705) -- 0:00:53
172000 -- (-533.754) [-532.378] (-534.881) (-534.481) * (-533.167) (-532.177) (-533.749) [-534.878] -- 0:00:52
172500 -- (-533.109) (-534.771) (-532.622) [-531.577] * (-533.053) (-533.933) [-532.107] (-535.390) -- 0:00:52
173000 -- [-535.777] (-536.651) (-535.240) (-533.314) * (-536.764) [-532.555] (-533.103) (-534.206) -- 0:00:52
173500 -- (-532.268) [-534.358] (-532.911) (-534.065) * [-534.079] (-537.090) (-532.756) (-533.292) -- 0:00:52
174000 -- (-533.688) [-534.839] (-532.799) (-533.887) * (-533.636) (-533.333) [-532.234] (-538.207) -- 0:00:52
174500 -- (-536.708) (-532.156) (-536.034) [-532.148] * (-534.843) (-533.982) (-537.743) [-535.064] -- 0:00:52
175000 -- (-533.836) [-534.592] (-535.565) (-533.834) * (-537.428) [-533.262] (-538.561) (-533.332) -- 0:00:51
Average standard deviation of split frequencies: 0.018451
175500 -- (-536.897) (-532.465) [-535.827] (-534.906) * (-532.630) (-532.277) (-532.710) [-532.875] -- 0:00:51
176000 -- (-540.567) (-534.684) [-535.713] (-533.356) * (-535.055) [-532.583] (-532.552) (-535.795) -- 0:00:51
176500 -- (-532.871) (-535.022) [-535.991] (-533.927) * (-536.575) [-531.968] (-537.644) (-531.526) -- 0:00:51
177000 -- (-534.539) (-534.683) (-532.448) [-537.198] * (-534.257) (-537.134) (-533.271) [-532.597] -- 0:00:51
177500 -- (-534.981) [-533.285] (-533.142) (-533.099) * (-537.488) (-537.770) [-535.043] (-532.579) -- 0:00:50
178000 -- (-535.050) (-535.582) (-535.194) [-532.116] * (-533.024) [-534.623] (-534.279) (-532.833) -- 0:00:50
178500 -- (-535.010) (-534.154) (-534.308) [-533.241] * (-534.107) (-533.948) (-539.120) [-531.724] -- 0:00:50
179000 -- [-535.488] (-532.672) (-534.841) (-532.832) * (-532.917) (-532.665) [-531.927] (-532.090) -- 0:00:55
179500 -- (-535.524) [-535.051] (-534.050) (-535.191) * (-532.917) (-533.356) (-536.055) [-533.668] -- 0:00:54
180000 -- (-537.607) (-535.871) [-533.720] (-535.705) * [-533.023] (-532.163) (-535.102) (-535.927) -- 0:00:54
Average standard deviation of split frequencies: 0.017804
180500 -- (-532.422) [-532.050] (-532.439) (-533.516) * (-535.020) [-532.450] (-540.923) (-533.921) -- 0:00:54
181000 -- (-534.161) (-532.545) (-533.288) [-532.086] * (-533.426) [-533.157] (-550.945) (-532.101) -- 0:00:54
181500 -- [-534.842] (-533.794) (-537.533) (-532.529) * (-533.897) [-533.088] (-537.094) (-534.856) -- 0:00:54
182000 -- (-532.376) (-536.260) [-535.389] (-532.988) * [-532.968] (-532.928) (-535.306) (-534.994) -- 0:00:53
182500 -- [-535.693] (-533.267) (-535.931) (-534.389) * (-533.593) [-534.436] (-534.918) (-533.547) -- 0:00:53
183000 -- (-534.324) [-535.136] (-535.379) (-535.319) * (-534.384) (-535.061) (-534.516) [-535.480] -- 0:00:53
183500 -- (-533.078) (-532.404) [-534.790] (-538.833) * (-533.850) (-532.425) (-535.575) [-532.933] -- 0:00:53
184000 -- [-532.858] (-532.393) (-537.667) (-534.502) * (-533.464) (-531.714) (-534.252) [-531.877] -- 0:00:53
184500 -- (-531.775) [-534.171] (-537.598) (-534.416) * (-533.899) [-534.400] (-531.520) (-536.521) -- 0:00:53
185000 -- (-535.402) (-538.518) [-534.660] (-532.404) * (-533.230) [-531.876] (-531.652) (-535.827) -- 0:00:52
Average standard deviation of split frequencies: 0.019994
185500 -- [-537.843] (-532.697) (-532.760) (-533.267) * (-535.165) [-531.757] (-535.114) (-536.220) -- 0:00:52
186000 -- (-535.751) [-534.420] (-533.814) (-537.484) * [-535.115] (-531.843) (-533.459) (-532.004) -- 0:00:52
186500 -- (-536.191) (-535.655) [-533.065] (-533.959) * (-532.544) (-532.351) [-532.948] (-531.625) -- 0:00:52
187000 -- (-533.225) [-536.751] (-532.033) (-533.284) * (-535.658) (-535.889) (-534.198) [-533.385] -- 0:00:52
187500 -- (-535.619) (-534.852) (-533.644) [-534.159] * (-534.722) (-531.699) [-534.673] (-537.271) -- 0:00:52
188000 -- [-533.168] (-535.057) (-534.255) (-533.154) * (-534.658) (-534.687) [-535.267] (-533.555) -- 0:00:51
188500 -- (-534.381) (-533.114) [-533.415] (-535.778) * [-536.751] (-539.682) (-535.724) (-533.172) -- 0:00:51
189000 -- (-533.687) (-533.142) [-531.720] (-533.184) * [-533.736] (-533.894) (-535.313) (-535.427) -- 0:00:51
189500 -- (-533.033) (-534.126) [-532.681] (-534.154) * [-534.705] (-539.993) (-533.577) (-534.229) -- 0:00:51
190000 -- [-534.914] (-533.483) (-533.063) (-536.137) * (-531.960) (-536.904) (-534.520) [-534.101] -- 0:00:51
Average standard deviation of split frequencies: 0.019367
190500 -- [-536.648] (-534.950) (-535.284) (-534.446) * [-534.897] (-533.973) (-533.010) (-535.980) -- 0:00:50
191000 -- [-536.567] (-534.381) (-533.475) (-534.383) * (-536.775) (-536.722) [-533.093] (-534.640) -- 0:00:50
191500 -- (-535.967) (-532.480) (-532.453) [-532.742] * (-535.226) (-536.538) [-535.552] (-536.095) -- 0:00:50
192000 -- (-533.818) (-535.555) [-534.916] (-534.676) * (-533.497) (-533.044) [-536.035] (-535.675) -- 0:00:50
192500 -- [-534.321] (-533.460) (-533.242) (-534.548) * (-534.525) (-532.428) [-533.383] (-536.815) -- 0:00:50
193000 -- (-532.382) [-532.924] (-538.642) (-534.407) * (-533.522) (-533.032) (-532.611) [-533.893] -- 0:00:50
193500 -- (-532.576) (-532.725) [-537.029] (-535.361) * (-534.099) (-537.618) (-533.847) [-532.096] -- 0:00:50
194000 -- (-541.370) (-532.688) (-535.123) [-531.669] * [-531.578] (-537.499) (-532.879) (-532.724) -- 0:00:49
194500 -- (-537.749) (-532.634) [-534.937] (-532.399) * (-534.101) [-533.828] (-537.072) (-534.469) -- 0:00:49
195000 -- (-533.817) (-534.245) [-532.367] (-532.965) * (-533.595) (-532.269) (-533.333) [-532.316] -- 0:00:49
Average standard deviation of split frequencies: 0.019241
195500 -- (-533.585) [-533.660] (-533.757) (-532.265) * [-532.488] (-534.657) (-533.088) (-532.723) -- 0:00:53
196000 -- [-535.064] (-533.105) (-532.582) (-532.769) * [-533.565] (-533.604) (-532.260) (-534.479) -- 0:00:53
196500 -- [-533.523] (-535.663) (-532.427) (-535.167) * (-534.716) [-533.228] (-533.270) (-534.999) -- 0:00:53
197000 -- (-533.266) (-533.758) [-532.494] (-533.915) * (-533.305) (-537.097) (-534.291) [-534.137] -- 0:00:52
197500 -- [-532.047] (-532.629) (-533.843) (-535.254) * (-536.006) (-538.882) [-534.618] (-532.291) -- 0:00:52
198000 -- (-532.648) (-533.482) (-534.434) [-535.992] * [-534.467] (-535.770) (-535.925) (-534.134) -- 0:00:52
198500 -- (-532.744) (-532.795) (-531.628) [-533.366] * (-533.615) (-532.788) [-534.827] (-534.012) -- 0:00:52
199000 -- [-532.440] (-537.085) (-535.498) (-532.040) * (-535.760) (-532.125) (-535.874) [-531.796] -- 0:00:52
199500 -- (-533.612) (-534.024) [-532.825] (-535.446) * (-533.915) (-532.404) (-534.716) [-531.650] -- 0:00:52
200000 -- [-533.066] (-541.298) (-537.747) (-534.810) * (-533.284) (-532.321) (-534.491) [-532.996] -- 0:00:51
Average standard deviation of split frequencies: 0.017273
200500 -- (-534.026) [-533.295] (-534.786) (-535.009) * (-532.342) [-532.567] (-536.652) (-532.938) -- 0:00:51
201000 -- (-532.018) [-535.189] (-531.741) (-533.752) * [-536.375] (-534.225) (-533.473) (-533.413) -- 0:00:51
201500 -- (-534.837) (-534.276) [-531.846] (-534.150) * (-534.906) (-532.268) [-533.094] (-535.462) -- 0:00:51
202000 -- (-533.698) (-534.565) [-536.296] (-537.235) * (-534.987) [-532.136] (-536.089) (-532.741) -- 0:00:51
202500 -- [-534.371] (-532.503) (-535.301) (-532.443) * (-537.854) (-531.611) [-533.376] (-534.307) -- 0:00:51
203000 -- (-535.947) (-533.872) [-534.639] (-532.955) * (-535.746) (-531.675) [-533.134] (-533.708) -- 0:00:51
203500 -- (-532.646) [-534.340] (-534.212) (-536.881) * (-533.993) [-531.792] (-533.512) (-536.277) -- 0:00:50
204000 -- (-534.480) (-536.029) [-533.745] (-533.114) * [-534.321] (-533.238) (-536.407) (-532.810) -- 0:00:50
204500 -- [-532.562] (-536.821) (-535.448) (-531.888) * (-533.772) (-535.974) [-534.023] (-536.514) -- 0:00:50
205000 -- (-532.623) (-533.517) (-535.040) [-532.511] * (-532.311) (-535.868) [-532.605] (-534.288) -- 0:00:50
Average standard deviation of split frequencies: 0.017365
205500 -- (-535.614) (-537.372) (-534.734) [-533.395] * [-533.647] (-533.345) (-532.727) (-532.102) -- 0:00:50
206000 -- (-531.751) (-534.426) [-532.197] (-533.708) * [-532.806] (-537.298) (-534.971) (-533.091) -- 0:00:50
206500 -- [-533.071] (-532.879) (-534.826) (-533.938) * [-537.131] (-536.099) (-533.559) (-537.257) -- 0:00:49
207000 -- [-532.908] (-537.810) (-533.661) (-535.374) * (-537.084) (-532.911) (-532.419) [-538.313] -- 0:00:49
207500 -- (-533.126) [-533.544] (-532.880) (-537.067) * (-537.048) [-533.411] (-534.388) (-537.591) -- 0:00:49
208000 -- (-533.166) (-532.612) [-534.086] (-535.928) * (-534.314) [-533.153] (-535.711) (-532.767) -- 0:00:49
208500 -- (-535.053) (-532.094) (-537.190) [-534.117] * (-535.816) (-533.019) [-535.455] (-534.236) -- 0:00:49
209000 -- (-537.658) [-533.401] (-533.070) (-531.995) * (-535.369) (-533.857) [-531.801] (-534.098) -- 0:00:49
209500 -- (-532.701) [-538.692] (-531.719) (-533.243) * (-533.162) (-533.454) (-533.159) [-532.799] -- 0:00:49
210000 -- (-535.236) (-535.697) (-531.877) [-532.639] * (-536.062) (-533.998) [-533.522] (-532.788) -- 0:00:48
Average standard deviation of split frequencies: 0.018560
210500 -- (-533.794) (-533.476) (-532.185) [-535.207] * (-534.653) [-535.360] (-536.234) (-533.166) -- 0:00:48
211000 -- (-533.535) (-536.856) (-532.527) [-534.938] * [-547.983] (-533.561) (-535.568) (-535.369) -- 0:00:48
211500 -- [-533.548] (-534.737) (-533.697) (-534.793) * [-531.905] (-533.814) (-533.616) (-534.565) -- 0:00:48
212000 -- (-539.346) (-534.782) [-532.924] (-534.461) * (-531.984) (-534.822) [-538.269] (-536.509) -- 0:00:52
212500 -- (-531.981) (-536.725) (-535.372) [-533.874] * (-534.078) (-536.508) [-533.474] (-537.611) -- 0:00:51
213000 -- [-531.649] (-537.309) (-533.190) (-532.587) * (-533.607) [-535.242] (-535.592) (-534.905) -- 0:00:51
213500 -- [-533.843] (-533.328) (-536.044) (-534.665) * [-534.650] (-533.420) (-534.166) (-536.406) -- 0:00:51
214000 -- (-532.521) (-535.230) [-532.243] (-532.861) * (-533.665) (-535.702) [-533.943] (-534.687) -- 0:00:51
214500 -- (-538.226) (-535.817) (-532.907) [-532.558] * (-538.133) (-532.889) (-533.010) [-531.834] -- 0:00:51
215000 -- (-536.686) (-532.618) [-533.081] (-538.006) * (-536.628) [-534.395] (-535.145) (-533.786) -- 0:00:51
Average standard deviation of split frequencies: 0.019096
215500 -- (-538.246) [-533.760] (-533.392) (-539.391) * (-536.373) (-532.180) (-535.385) [-533.528] -- 0:00:50
216000 -- [-534.877] (-536.827) (-537.040) (-535.736) * (-534.332) [-534.165] (-532.702) (-534.497) -- 0:00:50
216500 -- (-534.617) (-535.822) (-535.091) [-533.738] * (-535.015) (-532.270) [-534.458] (-535.702) -- 0:00:50
217000 -- (-542.159) [-532.285] (-533.079) (-532.444) * [-532.421] (-533.759) (-533.491) (-533.660) -- 0:00:50
217500 -- (-535.127) (-533.398) (-534.381) [-536.263] * (-533.722) [-533.717] (-536.057) (-534.941) -- 0:00:50
218000 -- (-534.350) (-533.733) [-533.187] (-532.576) * (-531.879) [-533.655] (-533.909) (-535.003) -- 0:00:50
218500 -- (-537.899) (-532.368) [-537.473] (-532.823) * [-534.904] (-532.267) (-532.232) (-533.090) -- 0:00:50
219000 -- (-533.035) (-532.876) [-536.089] (-532.585) * (-538.432) (-534.393) (-532.776) [-532.578] -- 0:00:49
219500 -- (-533.818) [-534.771] (-535.065) (-533.901) * (-537.871) (-533.697) (-535.398) [-531.789] -- 0:00:49
220000 -- [-536.191] (-535.269) (-534.767) (-534.034) * (-537.880) [-535.068] (-534.881) (-531.673) -- 0:00:49
Average standard deviation of split frequencies: 0.016823
220500 -- (-536.613) [-533.197] (-532.387) (-534.732) * (-533.167) [-532.774] (-536.387) (-534.946) -- 0:00:49
221000 -- (-534.667) (-536.335) [-532.373] (-534.241) * (-533.219) (-532.986) (-541.780) [-537.500] -- 0:00:49
221500 -- [-534.614] (-536.578) (-533.369) (-537.527) * (-532.659) [-532.464] (-534.476) (-532.918) -- 0:00:49
222000 -- (-537.862) (-535.713) [-532.266] (-537.768) * [-533.746] (-533.736) (-537.243) (-532.413) -- 0:00:49
222500 -- (-536.039) (-535.624) [-532.242] (-532.617) * (-535.232) [-534.328] (-533.959) (-533.303) -- 0:00:48
223000 -- (-534.506) (-533.377) (-533.793) [-533.206] * (-535.586) (-532.109) [-534.211] (-535.745) -- 0:00:48
223500 -- (-534.719) (-533.325) [-534.685] (-537.449) * (-533.497) [-531.727] (-533.675) (-535.001) -- 0:00:48
224000 -- (-532.802) (-534.506) [-532.627] (-538.070) * (-535.253) (-531.566) [-533.205] (-540.916) -- 0:00:48
224500 -- (-532.985) (-536.129) (-538.886) [-533.921] * [-533.130] (-533.085) (-531.983) (-533.433) -- 0:00:48
225000 -- (-531.634) [-532.951] (-535.328) (-535.852) * [-532.888] (-535.160) (-531.810) (-535.830) -- 0:00:48
Average standard deviation of split frequencies: 0.016687
225500 -- (-532.092) (-535.252) (-533.108) [-533.655] * (-535.611) (-532.761) [-534.854] (-532.891) -- 0:00:48
226000 -- (-533.297) (-535.100) (-531.741) [-532.904] * (-533.803) (-534.998) (-534.488) [-536.385] -- 0:00:47
226500 -- (-536.021) (-535.322) [-534.078] (-536.274) * (-532.951) (-534.389) [-536.251] (-537.157) -- 0:00:47
227000 -- (-533.898) (-534.618) [-532.545] (-533.465) * [-532.214] (-537.033) (-534.106) (-537.218) -- 0:00:47
227500 -- (-537.804) [-537.533] (-536.878) (-534.191) * (-534.100) (-533.253) [-532.793] (-536.782) -- 0:00:47
228000 -- (-536.436) (-533.026) (-534.498) [-534.324] * (-533.676) [-533.558] (-538.499) (-535.173) -- 0:00:50
228500 -- (-536.335) (-533.451) [-534.390] (-534.064) * [-536.743] (-533.859) (-534.958) (-537.048) -- 0:00:50
229000 -- (-537.521) (-537.402) (-533.726) [-535.323] * [-531.585] (-534.370) (-532.986) (-533.882) -- 0:00:50
229500 -- [-532.426] (-533.790) (-538.629) (-534.992) * (-532.964) [-532.993] (-534.041) (-536.401) -- 0:00:50
230000 -- (-534.059) (-532.270) [-536.351] (-532.744) * (-533.529) (-532.458) [-535.434] (-536.553) -- 0:00:50
Average standard deviation of split frequencies: 0.016894
230500 -- (-539.685) (-535.839) (-533.040) [-533.385] * (-533.229) [-533.203] (-537.245) (-537.079) -- 0:00:50
231000 -- (-532.965) [-533.567] (-532.037) (-532.909) * (-534.008) (-533.843) (-535.265) [-533.223] -- 0:00:49
231500 -- (-533.649) (-532.542) (-538.109) [-532.873] * (-533.688) (-533.888) [-534.127] (-532.879) -- 0:00:49
232000 -- (-532.803) [-532.360] (-533.874) (-533.365) * (-532.154) [-534.313] (-534.011) (-532.673) -- 0:00:49
232500 -- (-532.353) [-533.883] (-533.086) (-533.497) * (-535.804) (-536.075) [-533.129] (-534.177) -- 0:00:49
233000 -- (-533.784) [-533.515] (-533.163) (-534.791) * (-533.159) [-532.867] (-534.424) (-532.807) -- 0:00:49
233500 -- (-533.254) (-534.647) [-533.199] (-535.858) * (-534.015) (-535.158) [-533.041] (-532.558) -- 0:00:49
234000 -- [-533.195] (-539.055) (-533.077) (-535.317) * [-536.185] (-534.231) (-533.328) (-533.609) -- 0:00:49
234500 -- (-538.042) [-541.210] (-533.800) (-532.349) * [-535.646] (-532.338) (-534.933) (-534.612) -- 0:00:48
235000 -- [-533.517] (-535.362) (-532.627) (-534.441) * (-535.711) (-532.972) [-532.750] (-536.177) -- 0:00:48
Average standard deviation of split frequencies: 0.016479
235500 -- [-531.787] (-532.743) (-541.023) (-535.074) * (-533.632) (-533.502) (-535.187) [-532.004] -- 0:00:48
236000 -- (-531.798) (-532.662) (-536.897) [-535.869] * (-534.633) (-532.775) (-532.253) [-535.278] -- 0:00:48
236500 -- (-533.869) [-532.014] (-535.237) (-535.344) * (-531.761) (-533.146) (-535.975) [-533.165] -- 0:00:48
237000 -- (-533.013) [-531.952] (-536.062) (-533.922) * (-532.071) [-533.740] (-533.948) (-539.566) -- 0:00:48
237500 -- (-532.823) (-535.606) (-536.334) [-532.807] * (-532.531) [-532.279] (-535.840) (-532.968) -- 0:00:48
238000 -- (-532.684) [-537.190] (-532.914) (-535.088) * (-534.833) [-532.488] (-534.094) (-535.106) -- 0:00:48
238500 -- (-532.481) (-534.146) [-532.938] (-532.301) * (-536.383) (-532.306) [-532.819] (-534.389) -- 0:00:47
239000 -- (-532.876) [-533.094] (-535.978) (-532.094) * (-535.518) (-532.197) [-536.752] (-534.525) -- 0:00:47
239500 -- [-531.545] (-533.105) (-534.639) (-533.085) * (-533.384) (-532.910) (-532.513) [-533.617] -- 0:00:47
240000 -- (-533.919) [-535.044] (-533.073) (-532.653) * (-535.601) [-534.472] (-533.971) (-535.033) -- 0:00:47
Average standard deviation of split frequencies: 0.016361
240500 -- (-533.823) (-535.370) [-533.386] (-531.877) * (-533.793) (-535.229) [-531.902] (-534.071) -- 0:00:47
241000 -- [-535.078] (-533.100) (-534.031) (-532.849) * (-534.056) (-532.727) (-532.693) [-534.207] -- 0:00:47
241500 -- [-533.145] (-534.622) (-537.053) (-539.070) * (-533.874) (-534.039) [-534.023] (-532.570) -- 0:00:47
242000 -- (-535.103) [-532.376] (-533.446) (-540.991) * (-533.845) (-533.044) [-532.781] (-534.058) -- 0:00:46
242500 -- [-532.316] (-536.908) (-533.834) (-534.287) * (-536.070) (-533.238) [-531.562] (-533.074) -- 0:00:46
243000 -- (-533.445) [-533.680] (-532.869) (-531.978) * (-533.955) (-534.625) (-531.776) [-533.338] -- 0:00:46
243500 -- [-531.751] (-535.179) (-536.339) (-533.410) * (-533.304) (-531.884) (-532.073) [-533.210] -- 0:00:46
244000 -- (-531.748) (-532.859) [-532.122] (-532.073) * (-532.264) (-534.940) (-535.872) [-534.573] -- 0:00:49
244500 -- (-532.580) [-532.939] (-534.567) (-533.057) * (-531.650) (-542.129) [-534.105] (-537.221) -- 0:00:49
245000 -- (-533.723) (-533.926) [-532.074] (-532.844) * [-532.453] (-538.638) (-534.572) (-533.519) -- 0:00:49
Average standard deviation of split frequencies: 0.016683
245500 -- (-537.091) [-535.929] (-533.983) (-536.935) * [-536.615] (-534.980) (-534.965) (-531.677) -- 0:00:49
246000 -- (-539.654) (-536.206) (-532.668) [-532.590] * (-533.681) (-532.492) [-536.648] (-536.945) -- 0:00:49
246500 -- (-534.003) (-536.795) [-533.816] (-531.967) * (-535.082) (-534.705) [-532.243] (-535.935) -- 0:00:48
247000 -- (-531.935) [-533.942] (-534.478) (-532.853) * (-531.806) (-533.383) (-532.340) [-531.832] -- 0:00:48
247500 -- (-534.083) (-532.406) (-534.523) [-533.124] * (-531.967) (-534.230) (-533.495) [-532.912] -- 0:00:48
248000 -- [-531.980] (-533.833) (-533.979) (-533.285) * [-532.190] (-533.424) (-536.648) (-532.431) -- 0:00:48
248500 -- (-532.823) (-535.307) (-534.883) [-533.790] * [-532.270] (-533.648) (-535.301) (-532.502) -- 0:00:48
249000 -- (-535.566) [-535.424] (-533.037) (-538.052) * (-531.965) (-541.841) [-535.003] (-532.779) -- 0:00:48
249500 -- [-534.631] (-534.640) (-532.013) (-534.944) * (-533.252) [-537.339] (-533.414) (-534.331) -- 0:00:48
250000 -- (-531.928) (-535.994) [-532.584] (-537.759) * [-537.251] (-533.145) (-534.079) (-536.230) -- 0:00:48
Average standard deviation of split frequencies: 0.016262
250500 -- (-532.099) (-531.760) (-532.098) [-534.255] * (-534.320) (-533.739) [-532.699] (-533.863) -- 0:00:47
251000 -- (-532.710) (-532.221) [-534.313] (-532.897) * (-533.051) (-531.740) [-535.437] (-531.721) -- 0:00:47
251500 -- [-534.232] (-532.308) (-534.152) (-533.124) * (-534.317) [-532.600] (-536.402) (-532.583) -- 0:00:47
252000 -- (-532.198) [-533.183] (-532.353) (-532.666) * (-532.972) (-533.829) [-533.042] (-534.618) -- 0:00:47
252500 -- (-535.627) (-532.945) (-532.696) [-532.820] * (-532.750) (-536.744) (-533.032) [-536.062] -- 0:00:47
253000 -- [-532.855] (-533.143) (-532.849) (-534.210) * (-536.928) (-535.332) (-533.445) [-532.148] -- 0:00:47
253500 -- (-532.177) (-532.682) (-534.461) [-535.026] * [-531.921] (-535.672) (-536.224) (-534.041) -- 0:00:47
254000 -- (-534.079) [-533.918] (-537.306) (-533.319) * (-531.842) [-533.555] (-531.837) (-536.770) -- 0:00:46
254500 -- [-534.258] (-535.105) (-534.039) (-535.042) * (-533.796) (-536.607) [-535.493] (-531.933) -- 0:00:46
255000 -- (-534.311) (-538.767) (-535.142) [-532.887] * (-534.203) (-535.035) (-535.639) [-536.448] -- 0:00:46
Average standard deviation of split frequencies: 0.015381
255500 -- (-534.712) (-534.596) (-532.877) [-533.681] * [-534.513] (-531.579) (-533.248) (-536.087) -- 0:00:46
256000 -- [-533.647] (-533.845) (-531.668) (-533.785) * (-533.667) (-536.597) [-533.039] (-533.596) -- 0:00:46
256500 -- (-533.667) [-533.015] (-543.831) (-537.192) * (-535.470) [-535.624] (-534.295) (-533.434) -- 0:00:46
257000 -- (-535.652) [-533.023] (-534.242) (-534.858) * (-537.351) (-536.093) [-531.869] (-532.144) -- 0:00:49
257500 -- (-531.946) (-534.165) [-532.391] (-536.670) * (-539.078) [-534.881] (-534.982) (-537.186) -- 0:00:49
258000 -- (-532.356) [-534.133] (-533.415) (-532.620) * (-534.498) (-535.430) (-532.412) [-534.303] -- 0:00:48
258500 -- (-533.792) (-535.811) [-533.264] (-532.563) * [-533.121] (-538.159) (-532.383) (-533.391) -- 0:00:48
259000 -- (-535.055) (-535.260) [-536.403] (-533.408) * (-536.247) (-535.450) (-535.464) [-534.285] -- 0:00:48
259500 -- (-533.264) [-536.006] (-534.092) (-537.043) * (-533.831) (-533.596) (-533.234) [-536.420] -- 0:00:48
260000 -- (-532.911) [-533.459] (-532.399) (-533.028) * [-534.771] (-537.177) (-533.604) (-535.023) -- 0:00:48
Average standard deviation of split frequencies: 0.016382
260500 -- (-534.597) [-531.731] (-533.143) (-533.659) * (-537.141) [-534.738] (-534.760) (-532.063) -- 0:00:48
261000 -- (-533.769) [-533.210] (-532.806) (-534.867) * (-537.088) (-534.491) [-535.617] (-532.349) -- 0:00:48
261500 -- (-533.383) (-533.400) [-533.855] (-534.832) * (-536.556) (-533.283) (-534.725) [-533.384] -- 0:00:48
262000 -- [-532.963] (-532.831) (-535.112) (-536.463) * (-533.628) (-532.134) [-536.091] (-534.416) -- 0:00:47
262500 -- (-533.199) [-534.433] (-536.414) (-536.332) * (-532.754) (-534.236) (-532.607) [-536.935] -- 0:00:47
263000 -- (-535.708) [-534.542] (-537.596) (-533.424) * (-531.663) (-533.432) [-535.059] (-534.960) -- 0:00:47
263500 -- [-533.291] (-533.996) (-534.908) (-533.797) * (-537.751) [-533.309] (-532.237) (-537.632) -- 0:00:47
264000 -- (-533.125) [-533.419] (-535.484) (-533.868) * (-535.805) (-534.651) (-531.787) [-534.337] -- 0:00:47
264500 -- [-534.377] (-536.512) (-533.836) (-532.829) * [-533.248] (-536.515) (-532.429) (-533.762) -- 0:00:47
265000 -- (-534.467) (-532.087) [-534.127] (-534.343) * (-535.406) (-532.850) [-535.141] (-535.123) -- 0:00:47
Average standard deviation of split frequencies: 0.016245
265500 -- (-534.161) [-534.113] (-534.856) (-534.155) * (-532.242) (-533.014) [-532.527] (-533.210) -- 0:00:47
266000 -- (-532.325) [-534.287] (-532.261) (-535.129) * (-534.369) (-533.449) (-532.889) [-533.496] -- 0:00:46
266500 -- (-532.472) (-535.609) (-534.256) [-532.206] * (-532.676) (-533.531) [-535.137] (-535.747) -- 0:00:46
267000 -- [-533.099] (-532.095) (-538.326) (-538.124) * (-532.341) [-532.548] (-535.295) (-535.104) -- 0:00:46
267500 -- (-533.126) (-532.632) [-532.013] (-534.497) * (-534.091) (-533.134) [-533.734] (-533.618) -- 0:00:46
268000 -- [-534.402] (-536.039) (-534.374) (-535.444) * (-535.190) (-532.999) (-538.463) [-532.717] -- 0:00:46
268500 -- (-534.422) (-537.226) (-536.352) [-535.846] * (-536.193) (-534.357) (-534.261) [-532.563] -- 0:00:46
269000 -- (-534.647) (-534.050) (-537.926) [-535.900] * (-536.123) (-533.637) (-533.598) [-533.628] -- 0:00:46
269500 -- (-535.422) (-534.693) [-533.295] (-533.036) * [-536.608] (-534.809) (-536.082) (-533.714) -- 0:00:46
270000 -- (-532.935) (-534.170) [-532.969] (-533.214) * (-532.617) [-536.145] (-535.073) (-534.230) -- 0:00:45
Average standard deviation of split frequencies: 0.016802
270500 -- (-532.921) [-532.558] (-534.875) (-533.303) * (-532.037) [-531.965] (-534.162) (-533.521) -- 0:00:45
271000 -- (-537.702) (-533.857) [-533.244] (-537.380) * (-534.136) [-531.991] (-534.443) (-532.232) -- 0:00:45
271500 -- (-536.650) (-534.472) [-532.232] (-540.023) * (-535.336) [-532.316] (-533.314) (-533.192) -- 0:00:45
272000 -- (-532.326) [-535.101] (-533.892) (-537.835) * (-533.960) [-531.839] (-532.797) (-532.706) -- 0:00:45
272500 -- (-533.579) [-533.764] (-536.978) (-535.531) * (-533.016) (-536.457) (-533.457) [-538.122] -- 0:00:48
273000 -- [-532.517] (-535.575) (-535.574) (-534.862) * (-534.465) [-532.777] (-534.545) (-536.371) -- 0:00:47
273500 -- (-532.772) (-535.777) [-533.604] (-534.851) * (-532.779) [-534.514] (-535.297) (-534.702) -- 0:00:47
274000 -- (-534.024) (-532.101) [-532.962] (-537.221) * (-533.449) (-534.640) [-533.100] (-532.379) -- 0:00:47
274500 -- [-534.102] (-535.801) (-535.251) (-532.751) * (-535.892) (-534.453) (-533.160) [-532.340] -- 0:00:47
275000 -- (-536.456) (-533.022) (-531.870) [-534.743] * [-534.750] (-534.962) (-534.398) (-534.314) -- 0:00:47
Average standard deviation of split frequencies: 0.014613
275500 -- (-538.775) [-534.929] (-533.725) (-532.640) * [-533.244] (-532.355) (-532.450) (-536.716) -- 0:00:47
276000 -- (-538.351) (-532.221) [-535.099] (-534.017) * (-532.149) (-536.987) (-533.301) [-533.759] -- 0:00:47
276500 -- (-532.317) [-534.376] (-532.699) (-534.201) * (-536.526) (-533.540) (-533.010) [-533.016] -- 0:00:47
277000 -- (-533.356) [-534.105] (-534.281) (-536.221) * (-534.279) (-533.715) [-531.946] (-533.001) -- 0:00:46
277500 -- (-531.976) [-535.246] (-533.047) (-532.610) * [-533.656] (-533.971) (-533.604) (-537.055) -- 0:00:46
278000 -- (-532.055) (-533.931) (-536.486) [-532.932] * (-535.447) (-534.773) [-532.418] (-535.852) -- 0:00:46
278500 -- (-533.229) (-533.201) (-533.922) [-532.299] * [-532.359] (-534.721) (-534.044) (-534.584) -- 0:00:46
279000 -- (-532.183) [-534.350] (-533.461) (-532.939) * [-533.318] (-533.152) (-532.218) (-532.520) -- 0:00:46
279500 -- (-536.996) (-533.902) [-533.277] (-532.468) * (-532.437) [-532.967] (-534.502) (-537.749) -- 0:00:46
280000 -- (-534.596) (-538.189) (-534.232) [-532.671] * [-532.046] (-536.568) (-532.475) (-535.068) -- 0:00:46
Average standard deviation of split frequencies: 0.014463
280500 -- (-533.428) [-533.477] (-531.737) (-532.547) * (-532.435) (-535.063) (-533.892) [-534.666] -- 0:00:46
281000 -- [-537.025] (-534.563) (-533.006) (-531.836) * (-531.629) (-534.096) [-535.120] (-532.516) -- 0:00:46
281500 -- (-535.231) (-534.988) (-535.759) [-532.173] * [-532.418] (-533.095) (-533.428) (-532.516) -- 0:00:45
282000 -- (-533.487) (-534.794) [-533.752] (-533.073) * [-534.513] (-534.396) (-536.970) (-533.158) -- 0:00:45
282500 -- [-533.188] (-534.837) (-533.885) (-533.877) * (-534.082) [-532.914] (-531.839) (-531.976) -- 0:00:45
283000 -- (-534.476) [-532.270] (-536.102) (-534.595) * (-535.081) (-534.967) [-533.636] (-533.926) -- 0:00:45
283500 -- (-532.061) (-534.015) [-533.597] (-536.401) * (-537.437) (-534.875) (-532.237) [-534.607] -- 0:00:45
284000 -- (-532.929) [-533.452] (-532.302) (-534.182) * (-534.227) (-535.976) (-532.127) [-534.240] -- 0:00:45
284500 -- (-536.795) (-536.030) [-532.653] (-532.234) * [-532.784] (-532.357) (-532.197) (-532.768) -- 0:00:45
285000 -- (-532.791) (-535.740) [-533.925] (-532.553) * (-532.463) [-533.964] (-534.763) (-533.042) -- 0:00:45
Average standard deviation of split frequencies: 0.014834
285500 -- (-534.009) [-533.702] (-536.839) (-533.033) * (-532.088) [-533.412] (-536.660) (-532.851) -- 0:00:45
286000 -- (-532.393) (-533.731) [-532.450] (-535.731) * (-533.410) [-532.088] (-533.520) (-534.318) -- 0:00:44
286500 -- [-532.362] (-534.555) (-535.451) (-535.212) * (-533.007) [-535.630] (-532.940) (-535.859) -- 0:00:44
287000 -- (-532.130) (-532.365) [-534.575] (-533.339) * (-533.377) [-538.165] (-533.713) (-534.710) -- 0:00:47
287500 -- [-535.487] (-533.154) (-532.532) (-533.091) * (-534.912) (-531.933) [-532.974] (-532.593) -- 0:00:47
288000 -- (-534.812) (-538.708) (-532.747) [-532.559] * (-533.394) (-531.712) (-535.151) [-531.885] -- 0:00:46
288500 -- (-537.114) (-532.297) (-533.567) [-535.193] * (-534.362) [-532.516] (-534.996) (-534.561) -- 0:00:46
289000 -- (-534.242) (-534.682) [-534.682] (-533.817) * (-532.631) [-534.031] (-532.478) (-534.342) -- 0:00:46
289500 -- (-534.433) (-533.069) (-533.564) [-534.211] * (-532.854) (-533.204) (-533.658) [-533.538] -- 0:00:46
290000 -- (-535.869) (-532.459) [-534.066] (-535.764) * (-535.659) (-532.786) [-535.666] (-535.448) -- 0:00:46
Average standard deviation of split frequencies: 0.014056
290500 -- (-534.004) [-533.602] (-534.533) (-532.164) * (-533.031) (-532.606) (-533.240) [-533.361] -- 0:00:46
291000 -- (-533.982) (-534.847) [-539.382] (-532.077) * (-533.209) (-534.543) [-535.873] (-533.777) -- 0:00:46
291500 -- (-534.153) [-532.432] (-536.876) (-532.047) * (-532.431) (-533.240) (-534.171) [-536.057] -- 0:00:46
292000 -- (-535.101) [-536.666] (-535.154) (-532.105) * (-533.367) (-532.391) [-534.171] (-534.091) -- 0:00:46
292500 -- (-535.992) (-536.175) (-534.132) [-531.844] * [-534.099] (-531.795) (-534.253) (-533.808) -- 0:00:45
293000 -- (-536.620) [-533.958] (-536.233) (-533.155) * (-533.771) (-536.511) (-536.981) [-537.521] -- 0:00:45
293500 -- (-534.249) [-533.824] (-531.975) (-533.907) * (-533.724) (-535.096) [-534.310] (-533.283) -- 0:00:45
294000 -- [-535.666] (-533.750) (-537.471) (-535.890) * (-533.224) [-535.751] (-534.388) (-532.951) -- 0:00:45
294500 -- (-532.677) [-531.903] (-533.216) (-532.387) * (-539.195) (-535.709) [-536.247] (-532.718) -- 0:00:45
295000 -- [-536.882] (-534.428) (-531.937) (-532.651) * (-536.656) (-533.872) [-532.518] (-534.649) -- 0:00:45
Average standard deviation of split frequencies: 0.013979
295500 -- (-534.152) (-533.906) [-535.676] (-533.910) * (-533.297) [-532.039] (-532.498) (-535.572) -- 0:00:45
296000 -- (-532.464) (-533.511) (-536.332) [-536.702] * (-532.901) (-532.046) (-534.256) [-534.181] -- 0:00:45
296500 -- [-531.502] (-538.450) (-534.627) (-535.123) * [-533.636] (-532.646) (-533.499) (-535.941) -- 0:00:45
297000 -- (-533.930) (-540.613) [-535.245] (-533.096) * (-534.117) (-533.709) (-539.879) [-532.754] -- 0:00:44
297500 -- [-532.951] (-535.166) (-537.247) (-533.780) * (-531.733) (-533.621) [-534.040] (-533.373) -- 0:00:44
298000 -- (-536.977) (-537.084) [-533.573] (-533.689) * [-532.408] (-534.249) (-534.045) (-533.444) -- 0:00:44
298500 -- (-533.496) (-540.796) [-533.324] (-534.854) * (-533.582) (-533.901) [-536.551] (-532.038) -- 0:00:44
299000 -- (-533.326) (-535.810) (-533.260) [-533.100] * (-534.880) (-534.944) (-536.065) [-532.396] -- 0:00:44
299500 -- (-532.558) (-533.049) [-534.478] (-533.431) * (-534.166) (-532.973) (-531.742) [-535.690] -- 0:00:44
300000 -- [-532.869] (-532.606) (-536.970) (-533.677) * (-532.104) (-532.965) [-534.458] (-534.114) -- 0:00:44
Average standard deviation of split frequencies: 0.014849
300500 -- (-532.801) [-533.661] (-536.498) (-533.759) * (-533.032) [-538.305] (-535.079) (-535.000) -- 0:00:44
301000 -- [-532.367] (-534.550) (-536.028) (-531.854) * (-531.911) [-533.006] (-536.815) (-533.036) -- 0:00:44
301500 -- (-533.699) [-535.612] (-535.730) (-533.621) * (-533.397) (-535.042) (-533.876) [-533.343] -- 0:00:44
302000 -- (-533.692) [-534.837] (-533.216) (-535.387) * (-531.749) (-534.353) (-535.127) [-533.387] -- 0:00:43
302500 -- (-533.376) [-533.383] (-533.168) (-533.611) * (-535.212) [-535.507] (-532.762) (-534.825) -- 0:00:43
303000 -- [-531.859] (-536.442) (-534.643) (-532.553) * (-533.469) (-533.188) [-532.435] (-533.532) -- 0:00:46
303500 -- (-531.911) (-533.571) (-534.818) [-532.524] * (-538.055) (-532.551) [-531.716] (-535.046) -- 0:00:45
304000 -- (-536.912) (-538.370) [-534.218] (-532.166) * (-533.988) (-536.458) [-532.996] (-536.420) -- 0:00:45
304500 -- (-541.726) (-532.427) (-538.097) [-533.678] * (-535.202) [-533.093] (-533.713) (-539.023) -- 0:00:45
305000 -- (-532.481) (-534.990) (-533.319) [-534.206] * (-532.411) (-533.371) [-533.058] (-535.498) -- 0:00:45
Average standard deviation of split frequencies: 0.013266
305500 -- (-532.821) (-539.124) (-533.981) [-538.368] * (-532.211) (-534.387) (-538.704) [-533.977] -- 0:00:45
306000 -- [-533.934] (-538.334) (-534.544) (-534.693) * (-532.807) (-532.512) [-531.973] (-532.589) -- 0:00:45
306500 -- (-535.390) (-541.140) [-537.110] (-534.473) * (-535.167) [-536.192] (-533.305) (-534.094) -- 0:00:45
307000 -- (-535.167) (-536.774) (-543.154) [-533.107] * (-533.366) (-533.814) [-533.239] (-534.732) -- 0:00:45
307500 -- (-536.006) [-533.262] (-535.030) (-537.761) * [-531.875] (-533.089) (-533.845) (-532.903) -- 0:00:45
308000 -- (-536.338) (-536.317) [-534.427] (-532.117) * (-532.569) (-534.465) [-534.517] (-536.228) -- 0:00:44
308500 -- (-535.191) (-534.895) (-534.831) [-534.963] * (-533.477) (-538.509) [-535.867] (-536.054) -- 0:00:44
309000 -- (-533.124) [-540.018] (-533.125) (-533.977) * [-532.904] (-535.748) (-532.506) (-532.351) -- 0:00:44
309500 -- [-532.439] (-535.177) (-531.935) (-535.214) * (-533.243) (-534.037) [-531.748] (-531.752) -- 0:00:44
310000 -- (-534.762) [-537.307] (-533.615) (-535.471) * [-537.101] (-534.897) (-532.366) (-531.667) -- 0:00:44
Average standard deviation of split frequencies: 0.011949
310500 -- (-532.944) (-539.133) [-532.662] (-534.097) * [-535.165] (-536.600) (-534.809) (-536.541) -- 0:00:44
311000 -- (-534.818) (-534.936) (-534.839) [-533.680] * (-538.120) (-533.010) [-534.788] (-534.379) -- 0:00:44
311500 -- (-533.074) (-534.978) [-533.384] (-534.242) * (-534.771) [-534.603] (-533.852) (-532.755) -- 0:00:44
312000 -- (-536.206) (-532.965) (-534.972) [-534.662] * (-537.110) (-535.125) [-533.813] (-534.211) -- 0:00:44
312500 -- (-536.012) (-533.766) [-533.968] (-533.785) * [-532.257] (-534.011) (-533.658) (-532.170) -- 0:00:44
313000 -- (-534.996) [-534.018] (-533.170) (-534.302) * (-534.266) [-534.570] (-534.279) (-535.119) -- 0:00:43
313500 -- (-536.540) (-533.104) (-534.575) [-534.172] * [-532.703] (-536.314) (-533.193) (-532.704) -- 0:00:43
314000 -- (-535.080) [-534.997] (-532.702) (-534.270) * (-535.697) (-535.881) [-533.859] (-537.280) -- 0:00:43
314500 -- (-533.930) (-533.310) [-536.006] (-534.116) * (-534.532) (-540.936) (-533.159) [-533.661] -- 0:00:43
315000 -- (-537.108) [-534.346] (-533.977) (-535.119) * [-534.603] (-533.116) (-537.516) (-532.987) -- 0:00:43
Average standard deviation of split frequencies: 0.011408
315500 -- (-533.268) (-534.319) (-533.004) [-533.621] * (-532.617) [-531.882] (-532.574) (-534.979) -- 0:00:43
316000 -- [-532.211] (-534.560) (-535.288) (-533.317) * (-532.304) (-532.738) (-533.320) [-532.263] -- 0:00:43
316500 -- (-537.286) [-533.421] (-533.130) (-537.445) * (-538.587) [-534.565] (-533.126) (-533.905) -- 0:00:43
317000 -- (-535.684) [-535.169] (-533.437) (-535.462) * (-538.567) (-537.157) [-534.340] (-532.094) -- 0:00:43
317500 -- [-534.714] (-532.248) (-533.260) (-535.763) * (-534.453) (-532.954) (-537.678) [-532.452] -- 0:00:42
318000 -- (-532.593) (-534.741) [-533.470] (-533.749) * (-532.953) (-533.791) [-531.416] (-534.256) -- 0:00:42
318500 -- (-534.243) (-535.060) (-537.181) [-535.562] * (-532.004) [-532.352] (-536.289) (-533.117) -- 0:00:42
319000 -- [-533.742] (-535.929) (-536.026) (-533.651) * (-536.165) (-534.162) (-534.609) [-532.511] -- 0:00:44
319500 -- (-533.046) [-534.190] (-534.499) (-534.618) * (-536.674) [-533.791] (-536.385) (-531.961) -- 0:00:44
320000 -- [-533.797] (-533.401) (-534.093) (-534.777) * [-535.361] (-533.372) (-532.532) (-535.420) -- 0:00:44
Average standard deviation of split frequencies: 0.012036
320500 -- [-532.324] (-533.163) (-532.899) (-536.143) * [-535.394] (-532.441) (-535.954) (-533.103) -- 0:00:44
321000 -- (-533.849) [-533.993] (-532.978) (-533.584) * (-533.050) (-535.303) (-534.868) [-532.551] -- 0:00:44
321500 -- (-534.042) (-537.350) (-533.905) [-533.187] * (-534.002) (-534.366) [-534.313] (-533.313) -- 0:00:44
322000 -- (-532.811) (-537.049) [-534.381] (-536.894) * [-533.357] (-534.059) (-535.766) (-532.267) -- 0:00:44
322500 -- (-534.881) (-535.079) [-532.727] (-535.938) * (-533.334) (-534.638) (-533.768) [-532.490] -- 0:00:44
323000 -- [-534.731] (-535.797) (-533.581) (-533.168) * (-533.477) (-533.899) (-533.539) [-532.467] -- 0:00:44
323500 -- (-535.164) (-535.054) (-532.434) [-540.869] * (-533.316) [-535.361] (-532.153) (-534.302) -- 0:00:43
324000 -- (-534.162) [-533.809] (-531.887) (-538.169) * (-533.653) (-533.492) (-533.971) [-532.481] -- 0:00:43
324500 -- (-533.291) (-531.665) [-533.982] (-534.624) * (-536.157) (-537.903) [-532.556] (-532.339) -- 0:00:43
325000 -- (-532.653) (-534.399) [-532.222] (-533.873) * (-536.015) [-535.429] (-532.379) (-532.057) -- 0:00:43
Average standard deviation of split frequencies: 0.012382
325500 -- [-533.274] (-535.191) (-533.126) (-536.825) * (-534.432) (-537.341) (-533.464) [-532.159] -- 0:00:43
326000 -- (-534.576) (-533.389) [-532.570] (-541.025) * (-535.107) (-536.791) (-532.550) [-533.878] -- 0:00:43
326500 -- (-532.955) (-536.307) (-534.231) [-539.748] * (-536.789) (-540.075) (-533.983) [-534.889] -- 0:00:43
327000 -- [-534.364] (-532.967) (-534.401) (-535.164) * (-532.275) (-537.734) (-533.214) [-533.420] -- 0:00:43
327500 -- (-534.201) (-535.251) (-533.198) [-532.404] * (-531.721) (-532.926) [-532.520] (-533.619) -- 0:00:43
328000 -- (-535.738) (-534.770) [-533.280] (-532.025) * (-532.155) (-534.277) [-534.210] (-538.054) -- 0:00:43
328500 -- (-542.461) (-535.567) (-533.943) [-534.263] * (-532.996) [-537.894] (-532.165) (-536.139) -- 0:00:42
329000 -- (-534.997) [-535.336] (-533.636) (-534.380) * (-534.263) [-532.821] (-535.806) (-532.551) -- 0:00:42
329500 -- [-532.944] (-534.791) (-533.855) (-533.414) * (-533.914) (-537.888) (-534.032) [-532.522] -- 0:00:42
330000 -- (-538.241) (-533.087) (-535.113) [-532.508] * (-538.019) (-535.288) (-544.031) [-534.755] -- 0:00:42
Average standard deviation of split frequencies: 0.012296
330500 -- (-533.157) (-534.932) (-534.781) [-532.742] * (-532.884) [-534.222] (-536.888) (-533.445) -- 0:00:42
331000 -- [-536.896] (-535.655) (-539.621) (-535.229) * (-534.057) (-533.795) [-533.201] (-539.583) -- 0:00:42
331500 -- [-532.494] (-534.181) (-533.191) (-533.221) * (-534.588) (-535.278) (-535.456) [-534.160] -- 0:00:42
332000 -- (-532.062) (-531.850) (-533.655) [-532.390] * [-533.964] (-533.859) (-533.809) (-536.481) -- 0:00:42
332500 -- (-531.955) (-535.671) [-532.874] (-536.454) * (-536.030) [-535.389] (-538.946) (-533.707) -- 0:00:42
333000 -- [-533.421] (-535.629) (-534.274) (-533.145) * [-532.260] (-534.478) (-533.208) (-537.654) -- 0:00:42
333500 -- [-534.220] (-533.898) (-533.906) (-535.477) * (-533.609) (-531.863) [-533.972] (-537.546) -- 0:00:41
334000 -- (-531.868) [-532.723] (-535.147) (-531.991) * [-532.840] (-532.435) (-533.515) (-533.893) -- 0:00:41
334500 -- (-535.630) [-533.856] (-533.457) (-533.196) * (-535.186) [-532.645] (-532.104) (-535.566) -- 0:00:41
335000 -- (-533.578) (-534.014) (-532.761) [-534.182] * (-532.569) (-533.851) [-533.623] (-532.512) -- 0:00:41
Average standard deviation of split frequencies: 0.011049
335500 -- (-534.082) (-535.419) (-540.321) [-531.941] * (-531.923) (-532.613) [-533.207] (-534.699) -- 0:00:41
336000 -- (-534.706) [-533.402] (-540.516) (-534.193) * (-532.409) (-532.192) (-538.024) [-534.035] -- 0:00:43
336500 -- (-537.248) [-532.376] (-538.401) (-533.867) * (-533.869) [-534.415] (-533.989) (-531.858) -- 0:00:43
337000 -- (-535.479) [-533.971] (-533.441) (-534.996) * (-532.602) [-534.700] (-532.792) (-533.002) -- 0:00:43
337500 -- (-536.921) (-536.035) [-533.273] (-537.837) * (-533.469) (-534.586) [-532.629] (-533.522) -- 0:00:43
338000 -- (-538.237) [-534.910] (-532.356) (-533.510) * (-532.554) (-534.047) (-532.879) [-534.354] -- 0:00:43
338500 -- [-534.369] (-536.409) (-533.761) (-534.251) * [-534.524] (-532.012) (-532.894) (-535.277) -- 0:00:42
339000 -- (-535.462) (-533.190) (-532.509) [-532.411] * (-533.688) [-534.043] (-532.567) (-537.331) -- 0:00:42
339500 -- (-533.632) (-535.386) (-533.662) [-533.333] * (-535.957) (-534.122) [-533.272] (-533.130) -- 0:00:42
340000 -- (-533.632) (-533.553) (-534.935) [-532.687] * [-535.715] (-534.269) (-536.724) (-534.987) -- 0:00:42
Average standard deviation of split frequencies: 0.012367
340500 -- (-534.080) (-534.560) [-535.345] (-534.023) * [-532.605] (-534.095) (-532.237) (-534.084) -- 0:00:42
341000 -- (-533.363) (-534.649) [-536.088] (-534.460) * (-532.573) [-533.580] (-532.839) (-542.055) -- 0:00:42
341500 -- [-532.862] (-533.343) (-534.635) (-535.674) * [-534.131] (-535.288) (-535.139) (-533.745) -- 0:00:42
342000 -- (-534.330) [-532.757] (-534.237) (-545.560) * [-535.609] (-532.977) (-533.609) (-533.253) -- 0:00:42
342500 -- (-534.142) (-533.111) [-532.942] (-534.828) * (-535.488) (-532.942) (-536.273) [-533.917] -- 0:00:42
343000 -- (-532.410) (-531.430) [-536.408] (-532.375) * (-536.085) (-534.728) [-534.358] (-535.537) -- 0:00:42
343500 -- [-532.366] (-532.992) (-534.216) (-531.966) * (-533.379) (-531.924) (-535.148) [-535.569] -- 0:00:42
344000 -- [-533.498] (-534.006) (-533.248) (-532.105) * [-533.772] (-536.100) (-533.085) (-535.103) -- 0:00:41
344500 -- [-535.276] (-533.941) (-533.314) (-536.191) * (-534.882) (-537.724) [-533.751] (-534.429) -- 0:00:41
345000 -- (-533.449) (-535.367) (-534.277) [-532.490] * (-532.633) [-535.839] (-532.255) (-532.202) -- 0:00:41
Average standard deviation of split frequencies: 0.011325
345500 -- (-532.498) (-534.902) (-532.954) [-532.467] * (-533.208) (-538.499) [-534.032] (-533.165) -- 0:00:41
346000 -- (-532.090) [-535.140] (-534.964) (-531.970) * [-534.107] (-535.077) (-536.504) (-534.952) -- 0:00:41
346500 -- (-532.694) (-532.964) [-532.946] (-533.510) * (-533.833) (-535.574) [-532.218] (-533.453) -- 0:00:41
347000 -- (-538.039) [-533.114] (-533.433) (-533.595) * [-532.784] (-533.787) (-532.518) (-536.037) -- 0:00:41
347500 -- (-532.219) (-535.246) [-534.550] (-531.588) * [-533.593] (-532.180) (-531.389) (-534.101) -- 0:00:41
348000 -- (-532.343) (-535.273) (-532.443) [-533.479] * (-532.209) (-534.462) (-531.883) [-534.060] -- 0:00:41
348500 -- [-534.131] (-537.605) (-532.345) (-534.812) * (-534.755) [-532.235] (-532.782) (-536.111) -- 0:00:41
349000 -- [-537.353] (-532.828) (-534.463) (-534.039) * (-532.391) [-533.604] (-535.010) (-539.218) -- 0:00:41
349500 -- (-536.416) (-532.920) [-534.080] (-533.421) * (-533.320) [-535.923] (-532.719) (-533.436) -- 0:00:40
350000 -- (-536.122) (-534.085) [-533.017] (-533.865) * (-538.369) [-537.925] (-533.712) (-535.773) -- 0:00:40
Average standard deviation of split frequencies: 0.009806
350500 -- (-532.007) (-535.086) [-535.984] (-533.907) * (-533.225) (-537.646) [-535.474] (-532.469) -- 0:00:40
351000 -- [-534.070] (-534.631) (-534.251) (-537.061) * (-533.105) (-535.711) [-532.313] (-537.180) -- 0:00:40
351500 -- (-532.703) (-536.954) [-532.740] (-536.713) * (-535.617) (-539.206) [-532.312] (-534.022) -- 0:00:40
352000 -- (-533.292) (-532.111) [-537.001] (-533.649) * (-536.883) [-535.646] (-533.822) (-533.464) -- 0:00:42
352500 -- [-534.431] (-532.365) (-536.884) (-535.169) * [-535.786] (-537.048) (-534.815) (-532.506) -- 0:00:42
353000 -- (-534.588) (-534.408) (-532.667) [-533.069] * (-534.167) (-535.636) [-533.271] (-532.061) -- 0:00:42
353500 -- (-535.112) [-535.396] (-531.850) (-535.328) * (-537.311) (-538.031) (-535.057) [-533.094] -- 0:00:42
354000 -- (-534.865) (-537.595) (-532.860) [-534.905] * (-532.821) (-534.534) [-534.270] (-534.069) -- 0:00:41
354500 -- (-534.383) (-539.475) [-531.680] (-533.357) * (-533.078) (-535.616) [-532.743] (-534.210) -- 0:00:41
355000 -- (-533.240) (-533.674) (-534.781) [-535.504] * (-533.583) [-534.755] (-534.730) (-535.856) -- 0:00:41
Average standard deviation of split frequencies: 0.009581
355500 -- (-532.899) (-534.571) (-533.497) [-532.328] * (-532.883) (-534.438) [-533.756] (-532.290) -- 0:00:41
356000 -- [-534.716] (-536.229) (-533.240) (-533.680) * [-533.000] (-534.469) (-534.007) (-532.890) -- 0:00:41
356500 -- [-537.970] (-534.205) (-532.334) (-540.010) * (-533.696) (-533.131) (-535.301) [-532.489] -- 0:00:41
357000 -- (-538.608) (-536.698) (-533.645) [-532.676] * [-535.371] (-533.854) (-532.577) (-533.945) -- 0:00:41
357500 -- (-537.759) [-531.814] (-540.320) (-532.182) * (-536.477) [-532.055] (-535.749) (-535.157) -- 0:00:41
358000 -- (-539.415) [-535.374] (-534.187) (-533.341) * (-533.364) (-534.221) (-532.529) [-533.033] -- 0:00:41
358500 -- [-533.877] (-532.132) (-538.131) (-533.648) * [-533.024] (-531.720) (-534.307) (-534.159) -- 0:00:41
359000 -- (-533.531) [-533.583] (-535.749) (-532.812) * (-538.161) [-532.716] (-533.147) (-535.235) -- 0:00:41
359500 -- (-534.786) [-533.186] (-533.063) (-537.470) * (-532.636) (-534.152) (-532.833) [-535.201] -- 0:00:40
360000 -- (-534.072) (-532.976) [-533.102] (-536.100) * [-535.541] (-535.581) (-531.878) (-533.256) -- 0:00:40
Average standard deviation of split frequencies: 0.009149
360500 -- [-534.423] (-534.957) (-533.684) (-532.710) * (-538.311) (-532.354) [-532.881] (-532.785) -- 0:00:40
361000 -- [-535.649] (-531.949) (-533.196) (-532.787) * (-535.782) [-532.905] (-533.779) (-533.276) -- 0:00:40
361500 -- (-534.704) [-535.199] (-534.441) (-533.569) * [-533.445] (-532.187) (-536.020) (-537.580) -- 0:00:40
362000 -- [-535.773] (-536.385) (-533.070) (-535.518) * (-534.280) (-537.564) [-532.670] (-534.010) -- 0:00:40
362500 -- (-533.264) [-533.291] (-532.533) (-532.062) * [-535.477] (-534.506) (-534.502) (-534.735) -- 0:00:40
363000 -- (-533.214) [-532.524] (-533.833) (-534.865) * (-538.825) (-531.965) [-535.860] (-535.774) -- 0:00:40
363500 -- [-533.825] (-532.783) (-534.307) (-537.258) * (-537.522) (-535.015) [-533.851] (-535.056) -- 0:00:40
364000 -- (-534.950) (-537.379) [-533.329] (-536.771) * (-534.626) (-534.045) (-534.482) [-533.715] -- 0:00:40
364500 -- [-534.897] (-534.171) (-533.116) (-535.555) * (-536.936) [-534.653] (-532.153) (-532.078) -- 0:00:40
365000 -- (-534.650) (-535.972) (-532.321) [-535.312] * (-541.790) [-537.134] (-532.285) (-532.146) -- 0:00:40
Average standard deviation of split frequencies: 0.009092
365500 -- (-532.846) [-534.768] (-535.486) (-534.725) * (-534.369) (-533.537) [-533.104] (-533.894) -- 0:00:39
366000 -- (-537.276) (-535.116) (-533.165) [-538.013] * (-533.605) (-534.286) (-536.021) [-534.835] -- 0:00:39
366500 -- (-539.392) (-544.422) [-534.785] (-532.870) * (-534.948) (-532.156) (-532.249) [-534.611] -- 0:00:39
367000 -- (-534.332) (-533.188) (-537.746) [-533.668] * (-531.509) (-535.226) [-532.392] (-533.304) -- 0:00:39
367500 -- (-531.834) (-533.516) [-533.067] (-533.582) * (-534.748) [-531.769] (-532.735) (-532.459) -- 0:00:39
368000 -- [-532.522] (-534.112) (-536.425) (-533.872) * (-533.879) [-534.472] (-532.194) (-533.080) -- 0:00:39
368500 -- (-532.709) (-536.195) [-532.647] (-533.888) * (-533.033) [-536.323] (-534.022) (-532.167) -- 0:00:41
369000 -- (-532.340) (-533.133) (-533.127) [-532.884] * (-534.202) (-533.466) (-532.950) [-532.206] -- 0:00:41
369500 -- (-533.161) (-533.793) [-532.385] (-532.404) * (-533.014) [-533.272] (-537.654) (-532.192) -- 0:00:40
370000 -- (-533.801) [-534.328] (-535.990) (-532.716) * (-533.051) [-536.219] (-539.357) (-533.003) -- 0:00:40
Average standard deviation of split frequencies: 0.008902
370500 -- [-534.713] (-533.963) (-532.021) (-533.007) * (-534.775) (-533.651) (-536.803) [-532.872] -- 0:00:40
371000 -- (-535.631) [-533.159] (-535.188) (-534.180) * (-534.571) (-534.526) (-538.890) [-532.348] -- 0:00:40
371500 -- (-533.115) [-532.084] (-532.755) (-535.596) * (-533.359) (-533.634) [-533.339] (-531.731) -- 0:00:40
372000 -- (-534.547) [-532.775] (-537.645) (-533.413) * (-533.693) [-534.248] (-533.828) (-533.215) -- 0:00:40
372500 -- (-533.173) (-534.455) (-540.487) [-532.506] * (-533.549) (-536.344) [-535.000] (-536.873) -- 0:00:40
373000 -- (-534.446) (-533.505) (-535.450) [-532.321] * (-532.780) (-533.604) [-534.892] (-535.916) -- 0:00:40
373500 -- (-535.778) [-536.425] (-533.351) (-533.248) * (-536.008) (-533.405) (-533.249) [-533.397] -- 0:00:40
374000 -- (-534.082) (-531.868) (-533.501) [-534.519] * (-533.031) (-534.172) [-531.656] (-532.277) -- 0:00:40
374500 -- (-532.612) (-538.082) (-532.076) [-533.048] * (-532.774) (-533.184) [-532.960] (-533.515) -- 0:00:40
375000 -- [-535.070] (-533.535) (-535.104) (-533.920) * (-539.460) [-533.506] (-533.649) (-534.069) -- 0:00:40
Average standard deviation of split frequencies: 0.008985
375500 -- (-535.259) (-533.716) [-533.370] (-532.726) * (-531.942) [-534.451] (-534.549) (-533.367) -- 0:00:39
376000 -- (-536.452) (-532.525) [-532.943] (-531.931) * [-533.341] (-533.302) (-535.189) (-537.143) -- 0:00:39
376500 -- [-531.988] (-534.717) (-534.661) (-536.849) * (-533.481) (-533.827) (-534.065) [-540.316] -- 0:00:39
377000 -- [-533.493] (-533.266) (-534.610) (-544.895) * [-532.476] (-534.895) (-531.914) (-535.611) -- 0:00:39
377500 -- (-536.931) (-531.754) (-532.797) [-533.490] * (-534.985) (-537.244) (-536.494) [-534.524] -- 0:00:39
378000 -- (-534.754) (-532.803) (-536.092) [-533.515] * (-533.026) (-533.211) [-536.615] (-533.514) -- 0:00:39
378500 -- (-533.820) (-534.726) [-533.420] (-532.327) * (-533.443) [-533.326] (-532.559) (-537.388) -- 0:00:39
379000 -- [-531.480] (-535.513) (-532.831) (-534.732) * (-532.829) (-532.313) [-532.350] (-537.089) -- 0:00:39
379500 -- (-536.706) (-534.228) [-533.080] (-533.005) * (-533.945) [-532.573] (-533.514) (-533.970) -- 0:00:39
380000 -- (-535.048) (-537.740) [-534.361] (-534.515) * (-532.897) [-534.700] (-532.059) (-534.088) -- 0:00:39
Average standard deviation of split frequencies: 0.008231
380500 -- [-532.983] (-535.970) (-534.437) (-533.618) * (-533.217) [-533.035] (-533.695) (-534.730) -- 0:00:39
381000 -- (-533.384) (-535.074) [-533.916] (-535.670) * (-544.176) (-533.757) (-535.586) [-532.979] -- 0:00:38
381500 -- (-533.285) [-532.377] (-535.341) (-534.513) * (-538.863) (-534.071) [-532.879] (-532.125) -- 0:00:38
382000 -- (-533.291) (-534.540) [-532.782] (-534.181) * (-540.643) (-534.698) [-534.925] (-534.981) -- 0:00:38
382500 -- [-533.145] (-532.734) (-533.514) (-532.118) * (-532.986) (-532.621) (-532.830) [-532.289] -- 0:00:38
383000 -- (-533.796) (-533.556) [-531.731] (-535.535) * [-534.854] (-532.181) (-534.058) (-532.913) -- 0:00:38
383500 -- (-532.656) (-533.801) [-532.796] (-532.853) * (-536.737) [-532.946] (-533.557) (-533.302) -- 0:00:38
384000 -- (-533.017) (-534.165) [-534.398] (-534.044) * (-534.975) (-535.834) [-533.291] (-533.764) -- 0:00:38
384500 -- (-532.819) [-534.218] (-534.955) (-532.158) * (-532.933) (-533.772) [-531.753] (-535.175) -- 0:00:38
385000 -- [-534.752] (-532.593) (-532.577) (-535.810) * (-533.030) (-535.434) [-533.120] (-538.118) -- 0:00:38
Average standard deviation of split frequencies: 0.007759
385500 -- (-535.555) (-534.621) (-531.959) [-532.598] * (-533.980) (-536.898) (-532.662) [-533.199] -- 0:00:39
386000 -- (-532.547) (-534.743) [-532.275] (-535.596) * [-534.989] (-536.298) (-534.068) (-532.088) -- 0:00:39
386500 -- [-533.694] (-533.210) (-536.078) (-534.003) * (-535.847) (-534.292) [-534.990] (-532.014) -- 0:00:39
387000 -- (-534.647) [-536.139] (-536.897) (-533.523) * [-533.922] (-538.019) (-532.676) (-533.846) -- 0:00:39
387500 -- (-533.187) (-534.295) (-534.491) [-531.776] * (-532.356) (-532.152) [-540.636] (-535.852) -- 0:00:39
388000 -- (-531.903) [-533.925] (-534.989) (-531.600) * (-532.390) (-532.523) [-533.895] (-536.671) -- 0:00:39
388500 -- [-534.909] (-532.584) (-533.284) (-534.029) * (-533.933) (-532.897) [-533.844] (-533.415) -- 0:00:39
389000 -- (-532.506) (-533.591) (-535.996) [-533.353] * [-531.641] (-531.570) (-533.602) (-533.605) -- 0:00:39
389500 -- (-535.626) [-535.157] (-534.385) (-534.489) * (-533.750) (-532.042) (-536.709) [-532.507] -- 0:00:39
390000 -- (-534.965) [-534.243] (-533.068) (-539.709) * (-534.421) (-532.895) [-533.189] (-533.083) -- 0:00:39
Average standard deviation of split frequencies: 0.008447
390500 -- (-534.448) [-534.044] (-534.174) (-534.561) * (-533.552) (-535.747) (-534.570) [-533.662] -- 0:00:39
391000 -- (-533.305) (-535.731) [-533.188] (-534.387) * (-533.478) (-534.677) [-535.406] (-532.974) -- 0:00:38
391500 -- (-533.540) (-535.004) (-538.164) [-532.071] * (-533.626) (-532.741) [-533.038] (-532.144) -- 0:00:38
392000 -- (-537.057) (-531.913) (-533.974) [-533.669] * [-532.685] (-533.916) (-532.951) (-531.463) -- 0:00:38
392500 -- [-532.062] (-533.140) (-534.468) (-533.594) * (-534.936) [-533.084] (-539.035) (-534.791) -- 0:00:38
393000 -- (-532.446) [-534.303] (-534.403) (-542.568) * (-534.394) [-531.677] (-543.918) (-532.033) -- 0:00:38
393500 -- (-532.903) [-537.557] (-532.629) (-533.700) * [-532.595] (-532.664) (-534.292) (-534.347) -- 0:00:38
394000 -- (-532.607) [-532.086] (-533.387) (-533.143) * (-532.333) [-533.163] (-531.874) (-536.301) -- 0:00:38
394500 -- (-532.192) [-532.402] (-534.901) (-534.397) * [-533.083] (-533.479) (-536.406) (-533.041) -- 0:00:38
395000 -- [-535.558] (-532.546) (-534.918) (-533.485) * (-534.342) (-539.014) [-537.335] (-531.930) -- 0:00:38
Average standard deviation of split frequencies: 0.008893
395500 -- (-535.500) (-531.745) [-533.312] (-534.113) * (-534.953) (-537.844) (-533.555) [-532.618] -- 0:00:38
396000 -- (-532.080) (-531.671) (-536.377) [-532.258] * [-533.932] (-535.344) (-531.544) (-532.967) -- 0:00:38
396500 -- (-535.184) (-532.936) (-532.897) [-535.722] * (-533.513) [-533.796] (-533.372) (-533.668) -- 0:00:38
397000 -- (-534.493) (-532.459) (-531.757) [-535.358] * [-533.603] (-533.440) (-539.397) (-532.790) -- 0:00:37
397500 -- (-537.876) [-533.399] (-532.183) (-535.936) * (-535.414) (-534.077) [-532.526] (-533.578) -- 0:00:37
398000 -- (-539.786) (-532.522) [-534.291] (-532.807) * [-533.216] (-533.134) (-532.932) (-531.858) -- 0:00:37
398500 -- (-535.658) (-532.946) [-533.063] (-532.782) * (-535.683) (-532.228) (-534.954) [-533.268] -- 0:00:37
399000 -- [-534.949] (-532.379) (-533.002) (-534.098) * (-535.086) [-534.546] (-534.385) (-535.765) -- 0:00:37
399500 -- (-535.337) (-531.705) [-531.773] (-532.577) * (-532.258) (-532.543) (-532.195) [-532.900] -- 0:00:37
400000 -- (-532.983) [-531.703] (-532.259) (-532.653) * [-532.071] (-533.400) (-534.105) (-532.932) -- 0:00:37
Average standard deviation of split frequencies: 0.008604
400500 -- (-534.706) (-533.018) (-534.382) [-533.480] * [-533.450] (-533.511) (-533.368) (-534.589) -- 0:00:37
401000 -- [-533.356] (-531.612) (-532.639) (-533.255) * (-534.183) [-534.864] (-535.596) (-533.850) -- 0:00:37
401500 -- (-532.588) (-532.414) [-532.548] (-534.583) * [-533.714] (-536.909) (-535.631) (-534.776) -- 0:00:37
402000 -- (-536.587) (-535.097) (-533.655) [-533.822] * (-532.432) [-533.698] (-537.393) (-537.409) -- 0:00:38
402500 -- [-533.999] (-532.506) (-533.848) (-534.499) * (-532.344) (-536.172) [-534.369] (-534.064) -- 0:00:38
403000 -- (-533.121) [-533.534] (-535.122) (-541.514) * (-534.777) [-532.339] (-532.518) (-532.706) -- 0:00:38
403500 -- [-534.790] (-532.860) (-533.552) (-533.050) * (-537.807) (-531.501) [-534.884] (-532.553) -- 0:00:38
404000 -- (-533.258) [-533.072] (-532.374) (-532.464) * (-540.759) (-536.151) (-536.877) [-533.630] -- 0:00:38
404500 -- (-532.029) (-533.155) (-537.305) [-532.227] * (-532.640) (-538.019) [-534.318] (-534.696) -- 0:00:38
405000 -- (-536.207) [-535.380] (-534.713) (-535.786) * (-536.466) (-542.553) (-536.168) [-532.381] -- 0:00:38
Average standard deviation of split frequencies: 0.008966
405500 -- (-537.473) (-536.544) (-533.248) [-538.741] * (-534.170) (-533.268) (-533.881) [-532.325] -- 0:00:38
406000 -- (-533.042) [-534.966] (-533.364) (-536.561) * (-532.350) (-532.856) [-533.538] (-532.132) -- 0:00:38
406500 -- [-537.044] (-536.473) (-533.896) (-534.739) * [-531.717] (-534.301) (-532.183) (-534.711) -- 0:00:37
407000 -- (-532.853) (-535.255) (-536.052) [-536.051] * (-531.917) (-533.401) [-535.439] (-532.307) -- 0:00:37
407500 -- (-536.615) (-535.829) (-533.168) [-533.048] * (-535.581) (-532.153) (-535.728) [-535.491] -- 0:00:37
408000 -- (-533.898) (-536.660) [-535.672] (-535.494) * [-535.339] (-537.444) (-532.972) (-535.829) -- 0:00:37
408500 -- (-534.574) [-533.821] (-535.947) (-533.199) * [-533.520] (-532.999) (-533.681) (-533.898) -- 0:00:37
409000 -- (-532.958) (-533.650) [-534.472] (-532.882) * [-532.924] (-532.984) (-533.125) (-534.986) -- 0:00:37
409500 -- (-533.851) (-532.624) [-534.862] (-535.975) * (-533.568) (-534.112) [-535.522] (-535.817) -- 0:00:37
410000 -- (-533.640) (-533.405) [-532.157] (-532.199) * (-533.581) (-531.725) (-535.062) [-540.249] -- 0:00:37
Average standard deviation of split frequencies: 0.008992
410500 -- [-533.294] (-534.496) (-531.723) (-531.990) * (-536.079) (-532.886) (-532.536) [-535.808] -- 0:00:37
411000 -- [-533.247] (-533.301) (-534.365) (-534.097) * (-534.078) (-532.677) (-534.226) [-533.290] -- 0:00:37
411500 -- (-535.631) (-534.962) [-531.762] (-535.585) * (-533.427) (-532.356) (-534.008) [-534.510] -- 0:00:37
412000 -- [-534.577] (-533.098) (-531.933) (-540.527) * (-533.635) (-534.310) [-533.851] (-536.655) -- 0:00:37
412500 -- (-534.032) (-532.466) [-532.994] (-534.274) * (-534.451) (-532.459) [-537.456] (-538.099) -- 0:00:37
413000 -- (-532.322) (-533.448) (-535.414) [-533.398] * [-536.596] (-534.419) (-532.481) (-536.277) -- 0:00:36
413500 -- (-533.982) [-537.276] (-538.037) (-533.806) * (-535.018) (-533.396) [-534.087] (-533.519) -- 0:00:36
414000 -- (-533.870) (-533.149) (-537.453) [-533.047] * [-533.682] (-534.806) (-533.080) (-536.086) -- 0:00:36
414500 -- (-533.384) (-532.830) [-534.842] (-533.939) * (-531.529) (-531.880) [-535.347] (-532.990) -- 0:00:36
415000 -- [-533.560] (-532.338) (-534.453) (-534.318) * (-539.306) [-535.297] (-533.793) (-534.801) -- 0:00:36
Average standard deviation of split frequencies: 0.009191
415500 -- (-535.566) (-536.463) (-532.935) [-532.861] * (-536.822) (-535.626) [-536.573] (-535.039) -- 0:00:36
416000 -- (-537.969) (-532.492) (-533.592) [-532.760] * (-534.569) [-533.169] (-533.168) (-537.954) -- 0:00:36
416500 -- (-534.595) [-534.304] (-534.548) (-534.182) * (-535.184) [-532.173] (-532.767) (-532.609) -- 0:00:36
417000 -- [-533.537] (-533.487) (-533.432) (-535.474) * (-532.723) [-532.988] (-535.025) (-532.757) -- 0:00:37
417500 -- [-533.694] (-532.010) (-532.100) (-535.921) * (-536.360) (-533.583) (-534.100) [-532.713] -- 0:00:37
418000 -- [-532.655] (-536.114) (-532.223) (-531.967) * (-534.955) (-533.712) (-533.352) [-535.189] -- 0:00:37
418500 -- (-533.142) (-535.872) (-536.061) [-533.264] * [-531.810] (-537.229) (-533.524) (-534.601) -- 0:00:37
419000 -- (-533.352) [-533.788] (-535.450) (-532.845) * (-533.173) (-532.590) (-537.612) [-532.601] -- 0:00:37
419500 -- (-531.847) (-536.548) [-532.607] (-532.465) * (-532.522) (-532.213) (-535.733) [-534.516] -- 0:00:37
420000 -- [-533.177] (-534.892) (-533.014) (-532.570) * (-534.826) (-535.858) [-538.852] (-531.959) -- 0:00:37
Average standard deviation of split frequencies: 0.010151
420500 -- (-532.084) [-537.441] (-536.761) (-535.355) * (-537.154) (-534.246) (-534.047) [-533.665] -- 0:00:37
421000 -- (-533.216) (-537.137) [-533.087] (-532.857) * [-533.225] (-539.074) (-533.545) (-533.165) -- 0:00:37
421500 -- (-535.796) [-536.711] (-532.573) (-533.847) * (-533.230) (-535.902) [-534.074] (-536.136) -- 0:00:37
422000 -- (-532.496) [-533.857] (-532.880) (-532.220) * (-533.925) (-534.170) (-534.869) [-541.205] -- 0:00:36
422500 -- (-532.479) [-533.149] (-532.276) (-535.474) * (-535.292) [-532.995] (-533.135) (-534.409) -- 0:00:36
423000 -- [-536.295] (-535.526) (-532.287) (-537.511) * (-537.076) (-533.674) (-538.054) [-534.531] -- 0:00:36
423500 -- (-536.109) [-533.308] (-532.107) (-534.091) * (-540.257) (-532.913) (-539.497) [-533.368] -- 0:00:36
424000 -- [-532.460] (-532.469) (-532.594) (-537.780) * (-533.923) (-533.701) (-534.881) [-533.996] -- 0:00:36
424500 -- (-534.491) (-534.391) [-536.948] (-533.996) * [-536.128] (-534.298) (-532.864) (-534.200) -- 0:00:36
425000 -- (-535.070) (-537.470) [-535.386] (-534.686) * [-534.023] (-537.005) (-532.368) (-533.266) -- 0:00:36
Average standard deviation of split frequencies: 0.009475
425500 -- (-534.092) (-532.381) (-540.305) [-533.220] * (-539.626) (-536.671) [-535.216] (-533.390) -- 0:00:36
426000 -- (-536.840) [-533.045] (-537.789) (-538.306) * (-533.505) (-534.798) [-534.256] (-533.521) -- 0:00:36
426500 -- (-534.054) (-535.074) (-534.905) [-532.661] * [-532.134] (-532.064) (-532.633) (-537.041) -- 0:00:36
427000 -- [-533.968] (-533.400) (-534.936) (-535.826) * (-536.315) [-533.306] (-532.415) (-532.481) -- 0:00:36
427500 -- (-532.039) (-535.576) [-535.436] (-531.731) * (-533.398) (-531.840) (-535.369) [-534.827] -- 0:00:36
428000 -- [-532.764] (-535.105) (-533.913) (-533.157) * (-533.531) [-532.562] (-533.205) (-535.014) -- 0:00:36
428500 -- (-532.626) (-533.271) (-535.760) [-532.459] * (-533.984) (-531.945) (-533.515) [-533.026] -- 0:00:36
429000 -- [-534.655] (-534.626) (-532.654) (-539.352) * (-537.703) (-532.266) (-534.434) [-532.194] -- 0:00:35
429500 -- (-538.062) (-534.475) [-536.710] (-535.059) * (-534.236) (-536.142) [-533.759] (-533.676) -- 0:00:35
430000 -- (-539.737) (-537.490) (-533.774) [-535.584] * (-533.920) (-531.701) [-533.555] (-535.473) -- 0:00:35
Average standard deviation of split frequencies: 0.009401
430500 -- (-533.612) (-535.072) (-532.008) [-534.518] * (-532.530) (-532.047) (-532.933) [-532.305] -- 0:00:35
431000 -- (-532.867) (-533.323) [-532.785] (-534.614) * [-533.370] (-533.861) (-535.303) (-532.235) -- 0:00:35
431500 -- (-534.696) [-534.214] (-532.957) (-531.753) * [-531.490] (-534.315) (-534.586) (-534.050) -- 0:00:35
432000 -- (-533.945) (-533.442) (-533.020) [-533.417] * [-535.284] (-534.617) (-533.263) (-533.538) -- 0:00:36
432500 -- [-533.361] (-533.414) (-539.948) (-532.989) * [-536.116] (-532.746) (-534.762) (-532.785) -- 0:00:36
433000 -- (-536.288) [-532.173] (-532.779) (-532.188) * (-535.781) (-535.659) (-531.563) [-532.732] -- 0:00:36
433500 -- (-537.582) (-532.905) (-533.438) [-533.647] * (-533.298) (-536.006) [-534.243] (-534.741) -- 0:00:36
434000 -- (-532.535) (-531.862) (-533.560) [-533.216] * (-531.908) (-535.581) [-533.297] (-533.466) -- 0:00:36
434500 -- [-532.485] (-532.535) (-535.162) (-533.480) * (-533.383) (-535.755) [-534.788] (-532.261) -- 0:00:36
435000 -- [-535.286] (-534.259) (-533.052) (-533.493) * [-535.570] (-534.926) (-533.097) (-533.073) -- 0:00:36
Average standard deviation of split frequencies: 0.009922
435500 -- [-533.228] (-534.770) (-534.451) (-533.842) * (-533.702) [-534.826] (-534.072) (-536.688) -- 0:00:36
436000 -- [-534.350] (-535.828) (-533.093) (-534.305) * (-534.128) [-534.240] (-537.486) (-534.971) -- 0:00:36
436500 -- (-534.410) (-532.161) (-533.091) [-532.073] * (-538.597) [-533.107] (-532.920) (-535.471) -- 0:00:36
437000 -- (-533.063) (-532.600) (-534.897) [-532.042] * (-535.522) [-532.466] (-537.803) (-531.806) -- 0:00:36
437500 -- (-533.148) (-533.147) [-535.556] (-533.819) * (-535.386) (-535.084) (-534.417) [-533.068] -- 0:00:36
438000 -- (-534.645) [-532.727] (-533.261) (-536.476) * (-535.520) [-532.015] (-534.541) (-533.646) -- 0:00:35
438500 -- (-533.851) (-535.987) (-534.298) [-532.049] * (-535.368) (-531.924) [-533.580] (-532.692) -- 0:00:35
439000 -- [-533.881] (-534.006) (-532.678) (-531.708) * (-538.441) (-532.669) (-533.809) [-533.986] -- 0:00:35
439500 -- [-533.321] (-536.217) (-534.342) (-533.456) * [-535.190] (-536.285) (-535.137) (-532.843) -- 0:00:35
440000 -- [-531.864] (-534.109) (-533.344) (-534.595) * (-531.752) (-535.040) (-532.511) [-533.982] -- 0:00:35
Average standard deviation of split frequencies: 0.010965
440500 -- [-533.863] (-532.849) (-533.666) (-532.729) * (-532.918) (-532.694) (-534.042) [-534.063] -- 0:00:35
441000 -- (-533.632) (-537.898) [-534.039] (-534.068) * [-533.666] (-533.112) (-540.003) (-532.499) -- 0:00:35
441500 -- [-534.205] (-539.484) (-534.272) (-532.502) * [-534.030] (-533.602) (-532.990) (-534.463) -- 0:00:35
442000 -- (-535.050) (-536.975) (-533.172) [-533.079] * (-538.370) [-535.089] (-534.557) (-539.407) -- 0:00:35
442500 -- (-537.673) [-535.757] (-531.902) (-533.065) * (-535.622) [-534.734] (-536.899) (-539.030) -- 0:00:35
443000 -- (-532.254) [-533.735] (-532.537) (-532.574) * (-537.257) (-534.687) (-535.465) [-532.213] -- 0:00:35
443500 -- (-533.052) [-532.938] (-533.956) (-533.831) * (-533.754) (-533.428) (-534.366) [-535.756] -- 0:00:35
444000 -- (-538.553) (-533.203) [-532.738] (-534.062) * (-534.457) (-532.554) [-531.984] (-537.272) -- 0:00:35
444500 -- [-533.093] (-532.885) (-533.112) (-533.289) * (-533.057) (-533.788) [-533.518] (-536.853) -- 0:00:34
445000 -- (-532.419) (-532.080) (-533.794) [-534.125] * [-533.646] (-534.569) (-535.472) (-534.627) -- 0:00:34
Average standard deviation of split frequencies: 0.010371
445500 -- (-535.628) (-533.876) [-532.293] (-533.808) * (-536.185) (-539.515) [-532.349] (-538.386) -- 0:00:34
446000 -- (-532.699) [-534.708] (-532.053) (-535.133) * [-537.581] (-536.845) (-532.583) (-533.468) -- 0:00:34
446500 -- (-534.268) [-535.091] (-532.437) (-533.995) * (-533.395) [-535.296] (-531.850) (-531.695) -- 0:00:34
447000 -- (-534.329) (-533.839) (-532.625) [-531.896] * (-534.066) (-534.465) (-535.076) [-531.908] -- 0:00:34
447500 -- (-537.729) [-538.895] (-532.812) (-535.825) * (-532.147) (-533.274) (-534.543) [-532.431] -- 0:00:34
448000 -- (-539.681) (-536.420) (-532.952) [-534.192] * [-531.858] (-532.705) (-535.029) (-537.439) -- 0:00:34
448500 -- (-535.018) [-532.696] (-532.752) (-533.276) * (-532.775) (-535.687) [-535.764] (-532.831) -- 0:00:35
449000 -- [-535.819] (-535.991) (-532.897) (-533.567) * (-532.421) (-533.508) [-531.786] (-533.585) -- 0:00:35
449500 -- (-533.278) (-538.818) (-534.052) [-536.437] * (-532.040) (-532.062) (-532.103) [-534.325] -- 0:00:35
450000 -- (-533.107) (-535.371) [-531.708] (-533.069) * [-532.946] (-533.324) (-533.300) (-532.387) -- 0:00:35
Average standard deviation of split frequencies: 0.010852
450500 -- (-532.384) (-534.825) [-531.991] (-532.796) * [-533.344] (-533.610) (-534.880) (-534.669) -- 0:00:35
451000 -- (-532.115) (-532.422) [-531.806] (-533.158) * (-532.031) [-532.414] (-536.786) (-535.698) -- 0:00:35
451500 -- [-532.206] (-532.105) (-533.876) (-534.839) * [-537.206] (-533.848) (-542.300) (-536.840) -- 0:00:35
452000 -- [-533.101] (-534.425) (-532.876) (-533.795) * (-535.490) (-536.231) [-534.006] (-534.403) -- 0:00:35
452500 -- (-533.281) (-534.938) [-535.265] (-532.562) * (-537.742) [-533.738] (-535.904) (-535.511) -- 0:00:35
453000 -- [-535.589] (-537.312) (-536.047) (-534.724) * [-532.307] (-532.304) (-533.472) (-531.674) -- 0:00:35
453500 -- (-535.032) (-534.080) (-534.575) [-534.360] * (-532.376) (-532.901) [-533.052] (-533.382) -- 0:00:34
454000 -- (-534.011) (-536.471) [-532.936] (-535.088) * [-532.203] (-534.724) (-534.564) (-534.782) -- 0:00:34
454500 -- (-535.566) (-533.545) [-535.463] (-534.010) * [-534.117] (-538.234) (-531.959) (-532.937) -- 0:00:34
455000 -- (-534.850) [-533.277] (-533.675) (-533.406) * [-540.672] (-531.782) (-540.100) (-532.627) -- 0:00:34
Average standard deviation of split frequencies: 0.010079
455500 -- (-538.488) (-535.845) [-531.867] (-532.781) * (-532.710) (-533.915) (-533.963) [-534.707] -- 0:00:34
456000 -- [-533.568] (-532.967) (-533.499) (-533.520) * (-533.825) (-534.604) [-535.239] (-535.520) -- 0:00:34
456500 -- [-535.089] (-533.107) (-533.667) (-535.127) * [-533.774] (-537.066) (-533.800) (-532.344) -- 0:00:34
457000 -- (-532.946) (-533.825) [-534.745] (-532.706) * (-533.900) (-538.068) (-532.019) [-532.710] -- 0:00:34
457500 -- (-532.792) (-534.810) (-534.546) [-531.737] * (-532.624) (-532.431) [-532.635] (-531.920) -- 0:00:34
458000 -- (-536.261) (-538.859) (-532.588) [-532.504] * [-532.899] (-532.457) (-534.897) (-535.279) -- 0:00:34
458500 -- [-533.448] (-533.888) (-534.068) (-532.733) * (-533.816) (-533.942) (-533.020) [-535.270] -- 0:00:34
459000 -- [-533.862] (-534.598) (-536.085) (-531.892) * [-532.923] (-532.466) (-534.445) (-536.957) -- 0:00:34
459500 -- (-531.492) (-533.051) [-534.251] (-532.359) * (-532.153) (-534.462) [-534.579] (-537.087) -- 0:00:34
460000 -- (-533.490) (-538.322) (-533.302) [-536.990] * (-537.283) [-533.569] (-534.254) (-535.487) -- 0:00:34
Average standard deviation of split frequencies: 0.010169
460500 -- [-534.154] (-533.768) (-534.701) (-536.612) * (-535.282) [-534.608] (-538.029) (-534.642) -- 0:00:33
461000 -- (-533.842) (-536.916) [-536.759] (-537.542) * (-535.182) [-535.721] (-536.586) (-533.572) -- 0:00:33
461500 -- (-533.980) [-537.617] (-534.578) (-532.750) * (-535.595) [-536.524] (-531.875) (-535.768) -- 0:00:33
462000 -- (-533.815) (-534.453) (-535.264) [-532.144] * (-539.679) (-533.328) (-534.246) [-534.407] -- 0:00:33
462500 -- (-533.245) (-535.533) (-533.010) [-532.430] * [-533.812] (-534.153) (-533.204) (-540.097) -- 0:00:33
463000 -- (-533.505) (-534.704) [-539.000] (-532.081) * [-532.186] (-539.348) (-535.575) (-533.959) -- 0:00:33
463500 -- [-535.603] (-536.493) (-531.969) (-532.777) * (-531.974) (-538.120) [-534.480] (-534.996) -- 0:00:33
464000 -- (-535.771) (-532.308) [-533.589] (-532.094) * (-531.937) (-535.498) [-534.149] (-537.522) -- 0:00:33
464500 -- (-533.098) [-533.594] (-533.846) (-533.562) * (-532.075) (-532.473) (-536.572) [-533.648] -- 0:00:33
465000 -- (-532.955) [-534.120] (-534.246) (-535.821) * (-532.706) [-532.410] (-535.068) (-533.961) -- 0:00:33
Average standard deviation of split frequencies: 0.010116
465500 -- (-534.358) (-533.103) (-532.737) [-534.014] * (-532.510) (-532.732) (-532.554) [-532.917] -- 0:00:34
466000 -- (-533.275) [-532.635] (-535.335) (-533.868) * (-533.318) (-534.074) [-532.979] (-535.801) -- 0:00:34
466500 -- (-535.248) [-531.729] (-537.796) (-533.577) * (-533.416) (-542.890) [-532.437] (-532.357) -- 0:00:34
467000 -- (-535.655) (-534.386) (-536.917) [-534.160] * (-533.592) (-532.622) [-532.825] (-534.320) -- 0:00:34
467500 -- [-533.322] (-535.329) (-537.111) (-533.097) * (-535.932) (-532.137) (-533.444) [-533.617] -- 0:00:34
468000 -- [-533.705] (-534.715) (-539.088) (-535.282) * (-532.936) (-535.362) (-532.687) [-532.699] -- 0:00:34
468500 -- [-532.856] (-533.484) (-536.745) (-533.094) * (-533.101) (-536.932) [-532.896] (-532.373) -- 0:00:34
469000 -- (-533.702) (-534.138) (-534.779) [-536.264] * (-543.605) (-537.336) (-533.782) [-532.667] -- 0:00:33
469500 -- (-533.960) (-535.953) [-533.262] (-533.848) * (-533.079) [-536.872] (-534.620) (-533.957) -- 0:00:33
470000 -- (-533.838) (-533.899) [-535.929] (-532.870) * (-535.400) [-535.752] (-532.448) (-532.596) -- 0:00:33
Average standard deviation of split frequencies: 0.009953
470500 -- (-534.171) [-533.528] (-534.195) (-534.395) * (-534.755) (-539.630) (-536.137) [-536.012] -- 0:00:33
471000 -- (-533.278) [-533.442] (-536.546) (-534.098) * (-532.519) (-535.111) (-531.640) [-533.035] -- 0:00:33
471500 -- (-544.061) (-534.011) [-537.144] (-532.158) * [-532.902] (-534.463) (-531.805) (-532.599) -- 0:00:33
472000 -- (-532.120) (-535.590) (-532.675) [-533.905] * [-532.413] (-533.156) (-533.749) (-532.792) -- 0:00:33
472500 -- (-537.545) (-536.573) [-534.527] (-535.213) * (-532.049) [-532.876] (-533.555) (-533.330) -- 0:00:33
473000 -- (-534.590) (-532.377) [-533.304] (-533.237) * (-533.179) (-537.444) [-532.799] (-534.719) -- 0:00:33
473500 -- (-532.883) (-533.895) (-535.621) [-532.025] * [-532.538] (-534.550) (-534.789) (-532.706) -- 0:00:33
474000 -- [-533.180] (-532.180) (-532.386) (-533.798) * [-532.618] (-533.356) (-534.026) (-532.266) -- 0:00:33
474500 -- (-534.833) (-534.069) (-534.073) [-533.087] * (-533.340) [-534.794] (-535.796) (-533.092) -- 0:00:33
475000 -- (-532.844) (-532.505) (-533.311) [-534.315] * (-533.463) (-533.218) [-533.663] (-538.162) -- 0:00:33
Average standard deviation of split frequencies: 0.010708
475500 -- (-533.096) [-533.742] (-538.120) (-537.547) * [-531.842] (-532.979) (-534.460) (-533.596) -- 0:00:33
476000 -- (-533.241) (-535.306) [-534.395] (-534.322) * [-532.364] (-534.723) (-535.794) (-533.264) -- 0:00:33
476500 -- (-533.466) (-535.251) (-535.358) [-533.679] * (-535.526) (-533.830) (-533.323) [-533.583] -- 0:00:32
477000 -- [-532.770] (-533.499) (-536.007) (-533.747) * [-533.251] (-532.524) (-532.651) (-534.655) -- 0:00:32
477500 -- [-533.971] (-535.331) (-533.838) (-533.415) * (-533.454) (-533.137) [-533.682] (-532.776) -- 0:00:32
478000 -- (-534.869) (-534.201) [-533.239] (-533.989) * [-533.712] (-540.086) (-535.794) (-533.650) -- 0:00:32
478500 -- [-534.856] (-536.449) (-533.581) (-533.600) * (-537.224) [-536.524] (-533.545) (-533.038) -- 0:00:32
479000 -- (-536.073) [-535.045] (-534.595) (-534.945) * (-535.290) [-533.585] (-535.752) (-533.971) -- 0:00:32
479500 -- (-535.021) (-535.024) (-535.879) [-532.642] * (-536.893) (-532.518) [-533.348] (-531.594) -- 0:00:32
480000 -- (-537.598) [-532.517] (-535.039) (-535.083) * (-534.646) [-532.296] (-533.155) (-534.401) -- 0:00:32
Average standard deviation of split frequencies: 0.010298
480500 -- (-534.383) (-532.021) [-533.569] (-534.452) * (-536.518) (-532.192) [-532.785] (-536.825) -- 0:00:32
481000 -- [-533.269] (-532.522) (-532.969) (-533.178) * [-533.392] (-532.260) (-534.125) (-531.815) -- 0:00:32
481500 -- (-533.764) (-534.379) (-532.342) [-531.730] * [-534.102] (-532.521) (-534.064) (-537.073) -- 0:00:33
482000 -- (-531.836) (-532.399) [-534.022] (-532.845) * [-534.011] (-532.063) (-533.363) (-535.920) -- 0:00:33
482500 -- [-532.868] (-531.503) (-533.811) (-532.752) * (-533.874) (-532.981) (-535.623) [-533.415] -- 0:00:33
483000 -- (-533.464) (-538.350) [-533.685] (-533.218) * (-532.995) [-532.675] (-533.294) (-536.055) -- 0:00:33
483500 -- (-532.678) [-533.883] (-533.994) (-535.405) * (-534.919) [-533.398] (-534.422) (-533.196) -- 0:00:33
484000 -- [-532.141] (-532.609) (-532.686) (-533.940) * (-535.411) (-533.089) (-535.520) [-537.373] -- 0:00:33
484500 -- [-531.776] (-535.462) (-533.534) (-532.494) * (-536.216) [-532.983] (-534.356) (-534.484) -- 0:00:32
485000 -- (-533.131) (-537.016) (-533.963) [-532.052] * (-533.932) (-535.495) [-536.099] (-533.556) -- 0:00:32
Average standard deviation of split frequencies: 0.010609
485500 -- (-534.500) (-536.913) [-533.160] (-534.395) * (-533.047) (-535.708) (-532.366) [-532.977] -- 0:00:32
486000 -- [-538.166] (-532.305) (-533.526) (-533.371) * (-531.962) (-535.693) [-532.681] (-533.794) -- 0:00:32
486500 -- [-535.266] (-533.260) (-535.949) (-532.165) * (-531.798) [-533.636] (-532.748) (-533.408) -- 0:00:32
487000 -- (-539.260) [-533.296] (-534.672) (-535.197) * [-534.062] (-533.672) (-533.011) (-532.601) -- 0:00:32
487500 -- (-534.474) [-534.254] (-532.531) (-533.217) * (-534.028) (-533.351) (-534.407) [-532.644] -- 0:00:32
488000 -- (-542.810) (-534.277) [-532.216] (-536.888) * (-533.425) (-533.596) [-532.738] (-535.069) -- 0:00:32
488500 -- (-536.509) (-533.410) [-534.815] (-534.889) * (-536.280) [-532.877] (-535.702) (-534.164) -- 0:00:32
489000 -- (-533.222) [-532.072] (-534.113) (-535.020) * (-541.439) (-534.339) [-533.863] (-532.185) -- 0:00:32
489500 -- (-531.836) [-533.648] (-532.945) (-536.016) * [-534.024] (-534.266) (-532.176) (-533.552) -- 0:00:32
490000 -- (-532.123) (-531.967) [-531.710] (-532.206) * (-536.442) (-533.512) [-535.178] (-535.230) -- 0:00:32
Average standard deviation of split frequencies: 0.010628
490500 -- (-533.226) [-534.444] (-533.316) (-532.278) * (-537.097) (-534.008) [-534.471] (-533.534) -- 0:00:32
491000 -- (-533.914) [-533.589] (-534.900) (-532.238) * (-535.517) (-536.381) [-534.709] (-535.760) -- 0:00:32
491500 -- (-531.926) [-535.108] (-536.297) (-534.581) * (-534.088) [-533.933] (-534.598) (-535.432) -- 0:00:32
492000 -- [-532.260] (-541.840) (-534.591) (-532.968) * [-534.013] (-532.643) (-537.181) (-539.051) -- 0:00:32
492500 -- [-538.474] (-536.670) (-534.526) (-532.878) * (-534.154) (-539.492) [-539.353] (-535.408) -- 0:00:31
493000 -- [-533.049] (-532.432) (-533.233) (-533.130) * (-534.837) (-537.419) [-533.310] (-533.942) -- 0:00:31
493500 -- [-532.009] (-534.719) (-535.005) (-534.452) * (-534.182) [-532.956] (-536.855) (-532.621) -- 0:00:31
494000 -- [-532.320] (-534.507) (-532.362) (-532.759) * (-537.735) (-536.081) [-534.560] (-534.282) -- 0:00:31
494500 -- (-538.029) (-533.294) (-533.127) [-535.384] * (-536.251) (-531.972) (-532.933) [-533.624] -- 0:00:31
495000 -- (-536.318) [-534.026] (-533.779) (-536.593) * (-536.637) (-540.213) (-532.489) [-531.973] -- 0:00:31
Average standard deviation of split frequencies: 0.011167
495500 -- (-538.780) [-533.731] (-534.137) (-532.654) * (-533.743) (-536.405) [-533.408] (-535.912) -- 0:00:31
496000 -- (-532.454) (-535.299) [-532.068] (-534.035) * (-536.122) [-534.062] (-532.444) (-533.374) -- 0:00:31
496500 -- (-532.086) (-536.609) [-534.359] (-532.621) * (-534.773) (-535.351) (-534.366) [-535.448] -- 0:00:31
497000 -- [-533.493] (-533.788) (-533.307) (-534.171) * (-534.481) (-533.931) (-532.372) [-532.409] -- 0:00:31
497500 -- (-534.410) (-532.030) (-535.028) [-533.092] * (-533.497) (-537.346) (-535.471) [-534.145] -- 0:00:31
498000 -- (-533.404) (-532.091) (-532.565) [-533.534] * (-536.044) [-534.521] (-533.759) (-533.984) -- 0:00:31
498500 -- (-532.919) (-535.793) [-531.723] (-537.628) * (-535.457) [-532.073] (-535.371) (-533.863) -- 0:00:32
499000 -- (-532.280) [-532.249] (-536.792) (-533.769) * (-536.842) [-533.829] (-533.464) (-534.005) -- 0:00:32
499500 -- [-535.197] (-536.443) (-534.017) (-533.092) * (-536.175) (-533.851) (-534.010) [-537.040] -- 0:00:32
500000 -- (-534.394) (-536.745) [-532.535] (-532.210) * (-533.068) (-539.539) [-534.413] (-533.421) -- 0:00:32
Average standard deviation of split frequencies: 0.011243
500500 -- (-535.951) (-536.605) [-534.874] (-532.341) * (-536.573) (-534.587) (-538.432) [-533.297] -- 0:00:31
501000 -- (-533.305) (-532.679) (-533.793) [-533.488] * (-538.061) [-537.048] (-532.891) (-534.730) -- 0:00:31
501500 -- (-533.751) (-534.526) (-537.356) [-532.847] * (-532.003) [-533.212] (-537.592) (-534.459) -- 0:00:31
502000 -- (-532.951) (-534.592) (-537.408) [-532.316] * (-537.345) (-532.405) (-536.202) [-532.633] -- 0:00:31
502500 -- (-533.923) (-533.227) (-534.398) [-537.175] * (-536.180) (-533.240) (-534.997) [-537.283] -- 0:00:31
503000 -- (-534.944) [-532.431] (-536.710) (-536.932) * (-537.573) (-533.719) (-532.152) [-532.942] -- 0:00:31
503500 -- (-532.879) (-533.478) (-537.309) [-532.473] * (-532.647) [-532.230] (-532.922) (-532.038) -- 0:00:31
504000 -- (-534.475) [-533.065] (-532.917) (-532.806) * (-536.829) (-535.137) [-532.896] (-534.480) -- 0:00:31
504500 -- (-531.997) (-534.187) [-533.193] (-535.191) * (-533.480) (-532.950) [-534.578] (-537.394) -- 0:00:31
505000 -- [-533.124] (-533.594) (-535.096) (-537.755) * (-534.412) (-532.134) [-533.475] (-532.950) -- 0:00:31
Average standard deviation of split frequencies: 0.010632
505500 -- (-535.074) [-532.685] (-533.679) (-535.946) * (-533.144) (-534.349) (-537.929) [-532.404] -- 0:00:31
506000 -- (-534.224) [-533.840] (-533.777) (-535.917) * [-532.033] (-533.556) (-539.852) (-534.355) -- 0:00:31
506500 -- (-532.461) (-531.894) [-533.500] (-537.890) * [-531.742] (-533.251) (-533.822) (-533.345) -- 0:00:31
507000 -- (-531.863) (-537.351) (-534.442) [-534.365] * [-531.892] (-533.152) (-532.134) (-536.710) -- 0:00:31
507500 -- (-533.773) (-534.410) [-537.480] (-537.545) * (-532.507) [-532.711] (-532.132) (-540.113) -- 0:00:31
508000 -- (-534.076) (-533.108) [-533.194] (-534.059) * [-535.050] (-532.846) (-531.985) (-540.038) -- 0:00:30
508500 -- [-534.170] (-534.827) (-541.204) (-532.725) * (-538.099) (-533.163) (-533.750) [-533.495] -- 0:00:30
509000 -- [-532.329] (-534.855) (-536.113) (-536.717) * (-538.941) [-532.151] (-534.995) (-534.271) -- 0:00:30
509500 -- (-534.466) [-538.256] (-537.427) (-539.754) * (-533.023) [-534.324] (-532.397) (-533.313) -- 0:00:30
510000 -- [-536.153] (-534.732) (-534.669) (-533.535) * [-531.711] (-533.879) (-532.301) (-531.759) -- 0:00:30
Average standard deviation of split frequencies: 0.010860
510500 -- (-533.801) [-533.657] (-533.042) (-533.560) * (-532.664) (-533.838) [-534.094] (-536.107) -- 0:00:30
511000 -- (-533.749) (-532.439) (-532.257) [-533.212] * (-532.678) [-535.653] (-534.303) (-533.046) -- 0:00:30
511500 -- (-531.750) (-531.618) [-531.798] (-539.691) * (-533.767) [-534.756] (-535.508) (-535.015) -- 0:00:30
512000 -- (-536.108) [-532.272] (-532.193) (-536.166) * [-531.898] (-534.309) (-534.232) (-537.757) -- 0:00:30
512500 -- (-537.560) (-531.985) (-533.214) [-534.184] * (-534.590) (-535.305) (-534.161) [-532.603] -- 0:00:30
513000 -- (-533.997) (-536.528) (-532.123) [-533.885] * (-533.817) (-534.430) (-534.673) [-532.183] -- 0:00:30
513500 -- [-533.058] (-534.507) (-532.983) (-534.846) * (-534.905) (-535.227) (-535.392) [-532.447] -- 0:00:30
514000 -- (-535.933) [-535.646] (-533.781) (-533.524) * (-534.553) (-539.040) [-535.694] (-536.626) -- 0:00:30
514500 -- (-534.832) (-532.981) (-535.642) [-532.268] * [-535.436] (-537.044) (-535.487) (-535.833) -- 0:00:30
515000 -- (-533.988) (-534.191) (-536.690) [-535.416] * [-534.463] (-535.129) (-533.460) (-536.915) -- 0:00:30
Average standard deviation of split frequencies: 0.011318
515500 -- (-535.210) [-532.033] (-540.953) (-536.200) * (-533.416) (-533.921) [-533.274] (-532.126) -- 0:00:31
516000 -- (-538.394) (-533.192) [-534.311] (-534.214) * (-535.259) (-533.332) (-532.325) [-533.749] -- 0:00:30
516500 -- (-535.324) [-535.070] (-533.079) (-534.731) * [-535.275] (-534.814) (-536.357) (-533.204) -- 0:00:30
517000 -- [-533.715] (-532.168) (-533.234) (-532.653) * (-537.365) [-536.468] (-535.223) (-538.901) -- 0:00:30
517500 -- [-533.491] (-535.044) (-531.661) (-536.677) * (-534.516) (-534.082) [-532.469] (-532.982) -- 0:00:30
518000 -- (-535.634) [-531.641] (-533.210) (-534.509) * (-539.084) (-537.110) (-531.650) [-532.362] -- 0:00:30
518500 -- (-534.657) (-535.806) (-534.583) [-536.309] * (-534.503) (-533.366) [-534.751] (-532.468) -- 0:00:30
519000 -- (-533.063) (-533.252) (-531.925) [-532.055] * [-532.525] (-534.901) (-531.919) (-535.414) -- 0:00:30
519500 -- (-536.503) (-536.612) (-531.787) [-534.757] * (-534.944) (-536.112) [-534.936] (-538.811) -- 0:00:30
520000 -- (-533.043) (-534.709) (-531.849) [-535.326] * (-534.916) (-534.728) (-536.846) [-534.964] -- 0:00:30
Average standard deviation of split frequencies: 0.011519
520500 -- (-537.583) [-533.156] (-531.846) (-532.604) * (-534.373) (-532.287) (-536.469) [-533.293] -- 0:00:30
521000 -- [-531.856] (-535.606) (-531.721) (-534.045) * (-533.501) (-538.844) [-536.570] (-533.380) -- 0:00:30
521500 -- (-532.306) (-532.560) [-533.027] (-537.679) * (-533.930) (-535.654) (-537.692) [-534.586] -- 0:00:30
522000 -- (-534.912) (-534.515) (-532.762) [-533.736] * (-538.751) [-532.529] (-534.581) (-532.095) -- 0:00:30
522500 -- (-533.109) (-533.804) [-534.589] (-535.419) * (-535.231) (-536.136) [-533.356] (-532.548) -- 0:00:30
523000 -- (-536.327) [-532.454] (-533.696) (-533.719) * (-532.517) (-534.819) (-532.782) [-531.978] -- 0:00:30
523500 -- [-533.172] (-532.333) (-531.861) (-537.166) * (-532.556) (-532.623) [-534.114] (-533.879) -- 0:00:30
524000 -- (-539.668) (-534.017) (-537.353) [-531.643] * [-533.312] (-532.348) (-536.885) (-539.786) -- 0:00:29
524500 -- [-537.029] (-535.756) (-536.084) (-531.717) * (-537.490) [-532.887] (-537.917) (-535.200) -- 0:00:29
525000 -- (-538.659) (-537.067) [-533.660] (-534.460) * (-533.463) (-536.908) (-536.759) [-536.392] -- 0:00:29
Average standard deviation of split frequencies: 0.011900
525500 -- (-538.850) [-535.173] (-533.788) (-533.445) * (-536.910) (-534.245) (-532.698) [-535.371] -- 0:00:29
526000 -- [-533.324] (-540.389) (-534.891) (-533.428) * (-536.350) [-533.224] (-533.370) (-531.809) -- 0:00:29
526500 -- (-532.159) (-534.178) [-539.116] (-534.786) * (-533.021) (-539.082) (-534.481) [-531.823] -- 0:00:29
527000 -- (-534.761) [-534.775] (-537.281) (-536.157) * (-532.514) (-532.188) [-533.589] (-532.580) -- 0:00:29
527500 -- (-532.129) (-540.879) (-534.014) [-532.257] * (-533.216) [-538.183] (-533.366) (-533.210) -- 0:00:29
528000 -- (-533.884) (-532.508) [-534.662] (-534.130) * (-534.719) (-537.349) (-534.411) [-532.017] -- 0:00:29
528500 -- [-533.641] (-532.800) (-532.618) (-534.543) * (-534.866) (-535.784) (-531.602) [-534.938] -- 0:00:29
529000 -- (-532.237) [-532.852] (-532.803) (-532.917) * [-534.248] (-534.129) (-532.796) (-533.318) -- 0:00:29
529500 -- (-534.605) (-534.235) (-532.636) [-532.599] * (-531.965) (-533.835) [-533.593] (-533.200) -- 0:00:29
530000 -- [-531.963] (-538.959) (-531.824) (-533.301) * [-535.063] (-534.463) (-534.891) (-534.432) -- 0:00:29
Average standard deviation of split frequencies: 0.012332
530500 -- [-533.895] (-537.047) (-534.498) (-534.529) * [-537.813] (-535.860) (-534.788) (-534.500) -- 0:00:29
531000 -- (-535.103) (-532.737) [-532.895] (-534.521) * (-536.356) [-534.382] (-535.660) (-535.509) -- 0:00:29
531500 -- [-533.036] (-534.660) (-534.503) (-534.387) * (-537.176) (-535.677) [-534.802] (-534.026) -- 0:00:29
532000 -- (-533.544) [-535.904] (-537.114) (-532.124) * (-533.777) [-533.256] (-533.668) (-532.513) -- 0:00:29
532500 -- (-533.032) [-531.967] (-533.720) (-531.956) * (-533.973) (-532.641) (-532.136) [-531.949] -- 0:00:29
533000 -- (-531.886) (-536.742) (-537.025) [-533.030] * [-534.798] (-533.282) (-532.393) (-534.291) -- 0:00:29
533500 -- [-533.441] (-533.079) (-536.667) (-532.094) * (-535.293) (-534.083) [-534.549] (-534.069) -- 0:00:29
534000 -- (-536.350) (-535.326) (-535.182) [-532.606] * (-532.473) [-533.530] (-533.343) (-532.477) -- 0:00:29
534500 -- [-535.701] (-534.005) (-534.992) (-533.961) * (-534.081) (-533.132) (-533.450) [-532.943] -- 0:00:29
535000 -- (-535.891) [-533.836] (-533.417) (-534.908) * (-534.109) (-532.420) [-534.139] (-535.017) -- 0:00:29
Average standard deviation of split frequencies: 0.012158
535500 -- (-537.084) [-536.749] (-533.141) (-537.588) * (-534.519) (-534.794) (-534.874) [-533.121] -- 0:00:29
536000 -- [-537.529] (-534.223) (-533.419) (-537.402) * (-532.108) (-534.189) [-533.321] (-532.649) -- 0:00:29
536500 -- (-534.512) [-534.600] (-533.432) (-536.452) * (-534.247) [-534.025] (-536.278) (-534.370) -- 0:00:29
537000 -- [-535.779] (-536.578) (-534.105) (-536.159) * [-532.411] (-537.001) (-537.926) (-535.493) -- 0:00:29
537500 -- (-533.229) [-535.124] (-533.214) (-535.670) * (-531.976) (-535.605) (-536.631) [-534.043] -- 0:00:29
538000 -- (-538.151) (-535.920) [-533.068] (-532.876) * (-533.135) [-535.966] (-533.471) (-533.258) -- 0:00:29
538500 -- (-534.709) (-534.625) (-534.689) [-533.527] * (-533.604) [-534.249] (-532.411) (-532.769) -- 0:00:29
539000 -- (-533.121) [-535.801] (-535.570) (-533.869) * (-533.822) (-532.643) (-532.843) [-533.943] -- 0:00:29
539500 -- (-533.249) [-532.590] (-536.619) (-537.163) * [-533.788] (-535.178) (-532.968) (-533.200) -- 0:00:29
540000 -- (-532.320) (-533.187) (-532.511) [-534.733] * (-532.979) (-533.548) [-532.617] (-533.740) -- 0:00:28
Average standard deviation of split frequencies: 0.012104
540500 -- (-532.810) (-532.827) (-534.411) [-533.411] * [-533.706] (-537.533) (-534.612) (-537.871) -- 0:00:28
541000 -- (-535.163) [-534.474] (-532.728) (-535.207) * (-534.935) [-535.953] (-532.284) (-534.452) -- 0:00:28
541500 -- (-535.163) [-532.218] (-534.750) (-533.450) * (-536.961) (-537.062) [-532.626] (-532.380) -- 0:00:28
542000 -- [-533.185] (-536.155) (-534.743) (-539.646) * (-532.913) (-533.777) (-535.010) [-531.903] -- 0:00:28
542500 -- (-532.883) [-533.059] (-532.050) (-533.722) * (-533.375) (-539.059) (-533.302) [-534.525] -- 0:00:28
543000 -- (-534.131) (-536.197) [-532.757] (-537.323) * (-533.054) (-539.935) [-532.158] (-538.940) -- 0:00:28
543500 -- [-532.113] (-532.823) (-534.199) (-533.717) * [-534.227] (-534.458) (-534.002) (-541.381) -- 0:00:28
544000 -- [-534.356] (-533.877) (-534.838) (-535.014) * (-535.112) (-533.847) (-534.721) [-532.715] -- 0:00:28
544500 -- (-533.209) [-533.573] (-536.167) (-535.083) * (-535.018) (-531.928) [-534.141] (-534.192) -- 0:00:28
545000 -- (-536.816) (-533.130) [-536.057] (-534.595) * (-537.028) (-533.471) (-533.795) [-533.738] -- 0:00:28
Average standard deviation of split frequencies: 0.011986
545500 -- (-534.518) (-535.973) [-534.594] (-534.103) * [-531.496] (-535.040) (-536.503) (-532.108) -- 0:00:28
546000 -- [-533.835] (-532.324) (-534.808) (-535.644) * (-532.098) (-531.722) [-533.093] (-532.273) -- 0:00:28
546500 -- (-538.583) (-534.233) [-532.194] (-534.992) * (-535.007) (-533.056) [-531.877] (-532.112) -- 0:00:28
547000 -- (-532.812) [-532.866] (-532.423) (-535.874) * (-533.152) (-533.006) (-537.677) [-533.000] -- 0:00:28
547500 -- (-533.150) [-532.461] (-533.610) (-535.156) * (-531.964) [-535.664] (-536.992) (-533.836) -- 0:00:28
548000 -- (-531.644) (-532.889) (-534.477) [-531.850] * [-534.166] (-534.291) (-536.416) (-540.918) -- 0:00:28
548500 -- (-532.026) (-533.414) [-533.510] (-535.689) * [-533.267] (-533.138) (-533.568) (-540.734) -- 0:00:27
549000 -- [-532.440] (-534.311) (-533.667) (-531.917) * (-532.747) (-532.893) (-535.528) [-532.047] -- 0:00:28
549500 -- (-534.808) [-533.840] (-533.233) (-534.776) * [-532.833] (-532.782) (-532.578) (-535.348) -- 0:00:28
550000 -- (-540.528) [-540.380] (-534.058) (-533.899) * (-533.308) (-535.151) (-532.943) [-531.562] -- 0:00:28
Average standard deviation of split frequencies: 0.011632
550500 -- (-534.508) (-534.857) (-540.559) [-537.292] * (-533.289) (-537.029) [-532.981] (-534.185) -- 0:00:28
551000 -- (-535.311) (-532.429) (-537.953) [-531.823] * [-533.820] (-534.545) (-532.786) (-540.694) -- 0:00:28
551500 -- (-531.662) (-535.554) [-534.770] (-534.375) * (-533.872) (-534.761) [-533.289] (-535.564) -- 0:00:28
552000 -- (-533.107) (-533.932) [-532.097] (-534.286) * (-531.463) (-533.834) (-534.061) [-534.719] -- 0:00:28
552500 -- [-532.552] (-534.066) (-532.556) (-533.910) * (-531.961) (-533.500) [-533.967] (-532.557) -- 0:00:28
553000 -- (-534.374) (-537.729) (-533.406) [-532.192] * (-535.596) [-532.026] (-534.115) (-535.293) -- 0:00:28
553500 -- (-535.027) (-532.252) [-532.672] (-533.919) * [-533.061] (-535.350) (-532.641) (-534.713) -- 0:00:28
554000 -- (-533.439) [-533.414] (-532.452) (-534.903) * (-531.600) (-533.262) [-532.412] (-533.092) -- 0:00:28
554500 -- (-532.034) (-534.245) [-532.410] (-533.353) * (-532.716) [-535.772] (-532.384) (-532.413) -- 0:00:28
555000 -- (-533.285) [-533.940] (-531.775) (-537.055) * (-533.571) [-538.914] (-535.154) (-531.972) -- 0:00:28
Average standard deviation of split frequencies: 0.011393
555500 -- (-533.176) (-532.852) [-534.858] (-535.586) * (-536.626) [-533.294] (-538.029) (-532.329) -- 0:00:28
556000 -- (-533.170) [-533.884] (-532.412) (-533.993) * (-537.398) (-537.464) (-535.225) [-533.173] -- 0:00:27
556500 -- (-533.138) (-535.175) (-534.818) [-533.982] * (-533.142) (-537.800) (-532.112) [-535.917] -- 0:00:27
557000 -- (-532.982) [-533.902] (-534.594) (-532.303) * (-536.494) (-538.045) [-533.818] (-534.376) -- 0:00:27
557500 -- (-535.047) (-532.735) (-533.784) [-532.240] * (-534.747) (-535.461) [-533.556] (-533.513) -- 0:00:27
558000 -- (-534.331) [-532.283] (-532.725) (-532.380) * [-534.700] (-536.468) (-533.364) (-532.517) -- 0:00:27
558500 -- (-536.711) (-532.083) [-533.720] (-533.157) * (-534.685) (-535.075) (-536.501) [-534.026] -- 0:00:27
559000 -- [-533.399] (-537.337) (-534.866) (-536.018) * (-536.892) (-533.282) (-534.399) [-532.118] -- 0:00:27
559500 -- (-531.639) (-532.688) [-534.340] (-537.191) * [-535.642] (-534.706) (-533.921) (-534.648) -- 0:00:27
560000 -- (-533.073) (-535.358) (-532.566) [-533.976] * (-532.385) [-533.562] (-533.503) (-537.538) -- 0:00:27
Average standard deviation of split frequencies: 0.011246
560500 -- [-534.258] (-535.787) (-535.501) (-535.206) * [-532.139] (-533.561) (-533.461) (-539.598) -- 0:00:27
561000 -- (-536.185) (-532.897) [-532.359] (-532.216) * [-534.704] (-534.175) (-533.850) (-535.715) -- 0:00:27
561500 -- (-532.765) (-532.787) (-533.154) [-534.051] * (-533.454) (-532.229) (-532.585) [-533.804] -- 0:00:27
562000 -- (-535.075) [-532.400] (-534.867) (-533.433) * (-533.366) (-532.453) [-533.207] (-531.662) -- 0:00:27
562500 -- (-533.907) (-535.125) [-532.268] (-534.018) * (-537.481) (-532.664) (-534.757) [-535.452] -- 0:00:27
563000 -- (-534.612) [-535.153] (-537.655) (-532.194) * (-534.357) [-536.251] (-536.292) (-537.239) -- 0:00:27
563500 -- (-533.554) (-534.715) (-532.849) [-533.486] * [-536.399] (-532.590) (-533.758) (-536.084) -- 0:00:27
564000 -- (-532.211) (-533.760) (-532.448) [-532.645] * (-537.327) (-531.918) [-536.581] (-535.842) -- 0:00:27
564500 -- [-532.330] (-534.949) (-534.889) (-531.703) * (-537.826) (-531.757) (-534.062) [-536.141] -- 0:00:27
565000 -- (-532.678) (-532.236) [-533.522] (-531.692) * [-533.974] (-531.777) (-534.201) (-534.661) -- 0:00:27
Average standard deviation of split frequencies: 0.011400
565500 -- (-532.683) [-532.872] (-533.073) (-536.975) * (-534.059) (-536.596) [-539.578] (-533.145) -- 0:00:27
566000 -- (-532.681) (-532.268) [-533.837] (-539.301) * [-531.668] (-535.020) (-535.584) (-533.497) -- 0:00:27
566500 -- (-534.930) (-533.355) (-535.118) [-533.244] * (-533.838) [-532.777] (-542.995) (-531.820) -- 0:00:27
567000 -- (-533.359) [-531.432] (-537.413) (-542.013) * (-534.373) (-533.264) (-533.126) [-534.408] -- 0:00:27
567500 -- (-532.769) [-532.644] (-537.151) (-538.410) * [-533.683] (-534.767) (-532.658) (-534.982) -- 0:00:27
568000 -- (-534.122) (-531.933) (-533.271) [-534.088] * (-532.472) (-533.090) [-533.631] (-538.906) -- 0:00:27
568500 -- (-533.289) (-534.901) (-534.031) [-532.243] * (-534.862) (-533.582) (-534.569) [-532.367] -- 0:00:27
569000 -- [-533.048] (-534.734) (-533.936) (-532.997) * (-535.386) (-534.008) (-534.197) [-534.309] -- 0:00:27
569500 -- [-532.879] (-533.493) (-533.850) (-536.006) * (-534.382) (-535.237) [-534.377] (-532.612) -- 0:00:27
570000 -- (-532.087) [-535.357] (-535.586) (-533.999) * (-537.014) [-532.157] (-534.483) (-532.797) -- 0:00:27
Average standard deviation of split frequencies: 0.010636
570500 -- [-531.642] (-533.238) (-532.730) (-534.239) * (-533.643) (-534.599) [-534.130] (-535.606) -- 0:00:27
571000 -- (-532.456) [-532.452] (-534.841) (-535.960) * (-535.855) [-535.222] (-532.798) (-534.536) -- 0:00:27
571500 -- (-536.190) [-533.721] (-536.652) (-533.152) * [-532.983] (-535.433) (-534.366) (-533.715) -- 0:00:26
572000 -- (-532.344) [-532.084] (-533.679) (-538.435) * (-532.500) (-534.982) (-534.800) [-534.333] -- 0:00:26
572500 -- (-533.469) (-531.891) [-532.340] (-535.756) * (-536.847) [-531.961] (-531.746) (-534.858) -- 0:00:26
573000 -- [-534.013] (-537.012) (-535.227) (-531.970) * (-538.048) (-535.427) [-534.221] (-535.218) -- 0:00:26
573500 -- [-537.427] (-535.996) (-533.774) (-535.088) * (-535.423) (-533.350) [-533.352] (-535.741) -- 0:00:26
574000 -- [-536.318] (-535.854) (-532.627) (-535.411) * (-532.245) [-533.570] (-533.884) (-534.321) -- 0:00:26
574500 -- (-535.288) [-534.592] (-536.176) (-534.783) * (-532.388) (-533.683) (-533.569) [-534.233] -- 0:00:26
575000 -- [-533.274] (-532.984) (-534.274) (-532.410) * (-534.510) (-533.170) (-535.126) [-533.442] -- 0:00:26
Average standard deviation of split frequencies: 0.009974
575500 -- (-533.983) (-534.073) (-534.510) [-532.064] * (-534.870) (-537.847) [-534.135] (-534.962) -- 0:00:26
576000 -- (-534.032) [-533.640] (-534.359) (-533.535) * [-533.284] (-534.572) (-533.214) (-535.655) -- 0:00:26
576500 -- (-534.521) [-535.589] (-533.619) (-536.575) * (-533.341) (-536.586) [-534.427] (-534.504) -- 0:00:26
577000 -- (-533.754) (-538.607) [-535.340] (-535.934) * [-532.187] (-531.983) (-534.850) (-535.213) -- 0:00:26
577500 -- (-533.161) (-534.475) (-532.565) [-535.368] * [-535.989] (-532.267) (-534.543) (-535.832) -- 0:00:26
578000 -- (-532.478) [-531.507] (-533.114) (-533.278) * (-534.407) [-532.362] (-533.054) (-533.875) -- 0:00:26
578500 -- (-533.363) (-533.527) [-532.779] (-537.242) * (-533.125) (-533.068) (-532.074) [-532.010] -- 0:00:26
579000 -- (-534.281) (-532.529) [-534.924] (-535.948) * (-532.941) [-533.548] (-535.277) (-532.777) -- 0:00:26
579500 -- [-533.390] (-532.068) (-533.443) (-536.902) * (-532.661) [-533.997] (-532.954) (-532.977) -- 0:00:26
580000 -- (-535.900) [-532.805] (-534.887) (-536.710) * (-533.301) (-532.142) [-531.904] (-536.315) -- 0:00:26
Average standard deviation of split frequencies: 0.009590
580500 -- (-533.773) (-532.295) (-536.018) [-533.960] * (-534.638) [-535.555] (-533.491) (-534.766) -- 0:00:26
581000 -- (-536.154) [-532.555] (-532.446) (-534.191) * (-536.449) [-534.864] (-536.177) (-539.028) -- 0:00:26
581500 -- (-534.793) (-533.075) [-532.028] (-531.621) * (-535.514) [-535.034] (-538.101) (-536.325) -- 0:00:26
582000 -- (-533.178) (-535.882) (-531.854) [-534.594] * (-534.158) (-534.112) (-534.778) [-537.230] -- 0:00:26
582500 -- (-533.587) (-533.113) (-537.751) [-533.626] * (-532.456) [-532.053] (-535.421) (-533.139) -- 0:00:26
583000 -- (-531.603) [-532.815] (-536.487) (-534.195) * (-532.259) [-532.780] (-534.163) (-536.716) -- 0:00:26
583500 -- (-533.468) [-533.085] (-534.807) (-534.778) * (-536.518) (-534.936) [-532.982] (-536.421) -- 0:00:26
584000 -- (-533.479) (-535.652) (-534.708) [-535.275] * (-533.420) [-533.944] (-532.368) (-540.175) -- 0:00:26
584500 -- [-536.862] (-536.070) (-537.459) (-532.934) * (-533.563) (-534.012) [-532.530] (-535.280) -- 0:00:26
585000 -- (-532.495) (-536.238) [-532.353] (-533.898) * [-538.087] (-533.102) (-534.810) (-532.900) -- 0:00:26
Average standard deviation of split frequencies: 0.009511
585500 -- (-533.193) [-534.327] (-534.341) (-536.590) * (-536.663) [-532.966] (-534.546) (-532.396) -- 0:00:26
586000 -- (-534.294) (-538.586) [-534.576] (-534.044) * (-534.067) [-534.647] (-533.062) (-532.224) -- 0:00:26
586500 -- (-534.053) (-534.839) (-534.529) [-533.185] * (-535.204) (-536.099) (-534.420) [-532.675] -- 0:00:26
587000 -- (-533.681) (-532.879) (-534.781) [-533.284] * (-535.979) (-536.128) (-533.059) [-532.818] -- 0:00:26
587500 -- (-532.709) (-532.435) [-533.268] (-537.157) * (-535.131) (-535.008) [-534.325] (-532.254) -- 0:00:25
588000 -- [-532.503] (-535.067) (-533.725) (-534.869) * (-532.136) (-542.274) (-536.503) [-534.383] -- 0:00:25
588500 -- (-533.446) (-534.807) (-533.921) [-533.796] * (-533.291) (-533.328) (-534.556) [-533.448] -- 0:00:25
589000 -- [-533.029] (-534.380) (-531.638) (-534.318) * [-535.594] (-536.526) (-537.016) (-534.238) -- 0:00:25
589500 -- [-531.997] (-536.118) (-537.889) (-534.566) * (-533.366) (-533.940) [-535.127] (-533.913) -- 0:00:25
590000 -- (-532.058) (-535.668) (-534.888) [-532.651] * [-533.068] (-533.759) (-538.168) (-533.512) -- 0:00:25
Average standard deviation of split frequencies: 0.009859
590500 -- [-531.938] (-535.288) (-534.077) (-535.067) * (-534.030) (-535.372) (-535.196) [-534.112] -- 0:00:25
591000 -- [-534.130] (-534.694) (-534.126) (-533.299) * (-534.238) [-534.792] (-533.019) (-535.873) -- 0:00:25
591500 -- (-535.127) (-532.457) [-538.199] (-534.518) * (-533.148) [-532.640] (-532.673) (-534.919) -- 0:00:25
592000 -- [-532.059] (-532.649) (-534.065) (-538.895) * [-532.164] (-538.083) (-532.250) (-533.036) -- 0:00:25
592500 -- (-537.276) [-533.920] (-534.748) (-533.731) * [-534.105] (-533.579) (-536.194) (-532.324) -- 0:00:25
593000 -- (-534.609) [-534.430] (-536.895) (-539.433) * (-534.179) [-536.644] (-534.893) (-532.642) -- 0:00:25
593500 -- (-533.374) (-537.592) [-536.163] (-533.281) * (-533.291) (-532.609) (-533.960) [-539.374] -- 0:00:25
594000 -- (-532.337) (-534.100) [-532.340] (-533.421) * (-533.198) [-534.446] (-532.553) (-535.637) -- 0:00:25
594500 -- [-532.397] (-535.178) (-533.598) (-532.842) * (-533.497) (-532.331) (-532.364) [-536.866] -- 0:00:25
595000 -- (-532.958) (-533.451) (-532.326) [-534.331] * (-531.888) [-533.543] (-533.563) (-532.064) -- 0:00:25
Average standard deviation of split frequencies: 0.009817
595500 -- [-539.542] (-533.367) (-535.267) (-537.069) * [-532.670] (-533.089) (-534.434) (-534.328) -- 0:00:25
596000 -- (-536.680) [-533.202] (-532.619) (-533.548) * [-533.715] (-533.249) (-535.588) (-534.958) -- 0:00:25
596500 -- [-534.075] (-537.132) (-534.555) (-532.905) * (-534.318) [-533.783] (-534.049) (-533.514) -- 0:00:25
597000 -- (-535.369) (-534.811) (-535.484) [-532.075] * (-532.063) [-534.178] (-535.349) (-533.167) -- 0:00:25
597500 -- [-535.185] (-534.535) (-531.822) (-533.387) * (-531.737) [-531.886] (-533.593) (-533.007) -- 0:00:25
598000 -- (-533.948) (-533.440) [-532.981] (-535.725) * (-535.245) (-535.444) [-536.275] (-532.218) -- 0:00:25
598500 -- (-533.646) [-532.630] (-537.723) (-531.413) * (-534.011) [-536.322] (-533.644) (-533.748) -- 0:00:25
599000 -- (-532.229) [-533.164] (-532.954) (-536.565) * (-533.049) [-535.432] (-531.878) (-532.318) -- 0:00:25
599500 -- [-532.940] (-533.648) (-533.742) (-534.314) * (-533.335) (-533.939) [-531.775] (-533.872) -- 0:00:25
600000 -- (-536.155) (-533.068) [-533.257] (-537.658) * (-533.757) [-534.001] (-533.678) (-534.174) -- 0:00:25
Average standard deviation of split frequencies: 0.009741
600500 -- (-533.049) (-534.270) [-532.550] (-532.478) * (-535.995) (-534.975) [-533.523] (-536.233) -- 0:00:25
601000 -- (-537.824) (-534.496) (-531.988) [-533.668] * (-535.649) (-533.590) (-540.297) [-534.058] -- 0:00:25
601500 -- (-532.764) (-534.548) (-532.391) [-535.267] * (-534.684) (-532.667) (-536.981) [-534.647] -- 0:00:25
602000 -- [-531.827] (-534.412) (-533.105) (-534.370) * (-534.549) (-532.565) [-535.065] (-534.550) -- 0:00:25
602500 -- (-532.886) [-533.693] (-533.921) (-534.287) * (-533.417) (-532.800) (-533.691) [-533.417] -- 0:00:25
603000 -- (-536.081) (-533.822) [-533.294] (-533.720) * (-533.267) (-532.597) (-531.994) [-532.001] -- 0:00:25
603500 -- (-533.694) (-535.867) [-534.916] (-538.448) * (-537.029) (-533.194) [-536.109] (-535.656) -- 0:00:24
604000 -- [-533.393] (-534.599) (-532.799) (-534.338) * (-537.212) (-535.005) [-533.235] (-540.802) -- 0:00:24
604500 -- (-535.558) (-533.713) (-535.831) [-532.853] * [-533.459] (-536.389) (-539.656) (-536.401) -- 0:00:24
605000 -- (-534.362) (-532.958) (-537.617) [-532.616] * (-531.834) [-535.651] (-533.310) (-534.034) -- 0:00:24
Average standard deviation of split frequencies: 0.010158
605500 -- (-532.825) (-531.860) [-535.012] (-533.177) * (-531.834) [-539.192] (-535.032) (-533.937) -- 0:00:24
606000 -- [-532.492] (-532.398) (-532.209) (-535.168) * (-534.969) (-535.527) [-535.160] (-533.493) -- 0:00:24
606500 -- (-536.076) (-533.032) [-532.905] (-532.069) * (-532.642) [-534.718] (-536.858) (-534.347) -- 0:00:24
607000 -- (-534.355) (-532.630) [-536.706] (-531.813) * [-532.146] (-535.168) (-535.443) (-534.334) -- 0:00:24
607500 -- (-535.489) (-532.658) [-534.224] (-532.480) * (-534.091) [-535.386] (-534.627) (-535.220) -- 0:00:24
608000 -- (-533.301) [-539.902] (-533.513) (-532.789) * (-538.545) (-532.316) [-532.090] (-541.629) -- 0:00:24
608500 -- (-535.312) (-532.398) (-535.173) [-532.763] * (-533.095) [-532.054] (-533.824) (-535.359) -- 0:00:24
609000 -- (-534.445) (-533.107) [-533.827] (-533.364) * [-537.132] (-537.741) (-533.410) (-532.697) -- 0:00:24
609500 -- (-533.366) (-538.020) [-531.935] (-534.510) * (-533.328) (-532.121) (-531.829) [-537.552] -- 0:00:24
610000 -- [-534.403] (-535.561) (-532.563) (-539.055) * [-532.557] (-533.408) (-533.923) (-535.211) -- 0:00:24
Average standard deviation of split frequencies: 0.010518
610500 -- [-534.240] (-533.741) (-532.779) (-534.632) * (-535.464) [-533.895] (-537.833) (-531.948) -- 0:00:24
611000 -- [-533.444] (-534.927) (-533.290) (-538.101) * (-534.134) (-533.728) (-535.625) [-531.652] -- 0:00:24
611500 -- (-533.288) (-537.960) (-534.542) [-533.680] * (-532.079) (-536.159) (-535.423) [-534.539] -- 0:00:24
612000 -- (-533.780) (-532.581) [-533.823] (-534.750) * [-532.481] (-533.339) (-532.924) (-532.556) -- 0:00:24
612500 -- (-535.686) (-533.881) [-531.959] (-534.297) * (-534.201) (-532.910) [-533.896] (-532.927) -- 0:00:24
613000 -- (-534.101) (-532.999) [-532.431] (-533.220) * (-535.159) (-537.551) [-532.033] (-534.353) -- 0:00:24
613500 -- (-536.551) (-533.926) (-534.298) [-533.757] * (-531.870) (-536.032) (-532.884) [-532.005] -- 0:00:24
614000 -- (-533.483) [-535.000] (-532.330) (-535.302) * (-531.888) [-533.513] (-533.146) (-534.096) -- 0:00:24
614500 -- (-533.527) (-532.317) [-532.154] (-538.209) * (-535.265) (-534.237) [-535.340] (-533.474) -- 0:00:24
615000 -- (-534.964) (-533.753) [-532.292] (-534.194) * (-534.120) (-533.491) (-535.954) [-532.703] -- 0:00:24
Average standard deviation of split frequencies: 0.010092
615500 -- (-534.848) (-533.740) [-532.534] (-533.013) * (-534.615) (-532.766) [-531.999] (-534.973) -- 0:00:24
616000 -- (-535.544) [-536.155] (-533.197) (-533.087) * (-531.592) (-534.673) [-532.969] (-534.206) -- 0:00:24
616500 -- (-533.904) [-532.919] (-535.065) (-533.403) * (-538.108) [-532.548] (-534.073) (-533.699) -- 0:00:24
617000 -- (-536.474) (-532.762) [-534.439] (-533.019) * [-534.819] (-534.043) (-532.838) (-532.895) -- 0:00:24
617500 -- (-542.658) (-532.653) [-535.411] (-533.683) * (-534.201) [-534.591] (-532.873) (-536.495) -- 0:00:24
618000 -- (-531.760) [-532.680] (-535.562) (-532.237) * (-532.833) (-534.675) (-533.993) [-538.063] -- 0:00:24
618500 -- (-531.908) (-537.073) [-533.023] (-533.742) * [-535.244] (-531.728) (-533.067) (-533.378) -- 0:00:24
619000 -- [-531.510] (-534.764) (-534.376) (-536.424) * (-535.943) [-531.833] (-532.612) (-533.990) -- 0:00:24
619500 -- (-531.816) (-532.356) [-531.622] (-535.434) * (-534.986) (-533.110) (-534.285) [-532.041] -- 0:00:23
620000 -- (-533.972) (-537.070) [-533.795] (-536.420) * (-535.608) (-531.991) (-532.215) [-533.370] -- 0:00:23
Average standard deviation of split frequencies: 0.010097
620500 -- (-537.425) (-537.755) (-538.296) [-533.623] * (-532.042) (-532.948) (-534.046) [-532.613] -- 0:00:23
621000 -- [-536.477] (-533.685) (-535.386) (-533.829) * (-535.130) (-535.618) [-532.039] (-534.322) -- 0:00:23
621500 -- (-534.763) (-532.169) [-532.639] (-534.297) * (-534.814) (-534.838) (-533.071) [-532.809] -- 0:00:23
622000 -- (-532.259) [-532.702] (-535.112) (-533.050) * (-534.604) (-536.429) [-533.769] (-532.655) -- 0:00:23
622500 -- (-536.347) [-534.490] (-539.374) (-532.464) * (-534.432) (-535.094) (-534.470) [-535.045] -- 0:00:23
623000 -- [-536.878] (-534.593) (-534.357) (-533.806) * [-531.797] (-533.348) (-533.257) (-531.929) -- 0:00:23
623500 -- (-535.666) [-534.618] (-534.022) (-535.156) * (-535.562) (-534.725) [-535.754] (-532.612) -- 0:00:23
624000 -- (-535.436) [-533.530] (-532.972) (-533.422) * (-533.605) (-536.067) (-535.499) [-534.569] -- 0:00:23
624500 -- (-536.018) [-532.319] (-533.061) (-531.974) * (-534.583) [-534.351] (-532.817) (-536.699) -- 0:00:23
625000 -- [-534.508] (-534.982) (-533.434) (-534.141) * (-535.269) (-533.867) [-532.767] (-535.476) -- 0:00:23
Average standard deviation of split frequencies: 0.010498
625500 -- [-534.273] (-535.379) (-533.485) (-536.267) * (-539.684) (-535.287) (-539.296) [-532.672] -- 0:00:23
626000 -- (-533.647) (-533.542) (-532.829) [-533.451] * (-533.164) (-536.158) (-537.322) [-531.894] -- 0:00:23
626500 -- (-535.287) [-539.685] (-534.933) (-539.621) * (-533.064) [-532.393] (-532.797) (-534.077) -- 0:00:23
627000 -- (-534.940) [-534.913] (-536.675) (-533.017) * [-533.541] (-536.998) (-533.060) (-533.013) -- 0:00:23
627500 -- (-536.689) (-533.124) (-533.472) [-533.131] * (-535.236) [-532.541] (-537.281) (-534.968) -- 0:00:23
628000 -- (-534.698) (-535.889) (-533.661) [-535.076] * (-531.884) (-532.095) (-535.573) [-534.545] -- 0:00:23
628500 -- (-534.510) (-532.142) (-539.625) [-537.873] * (-533.541) (-532.279) [-532.706] (-536.292) -- 0:00:23
629000 -- (-536.083) (-531.902) [-534.389] (-540.302) * (-536.597) (-533.596) [-534.361] (-533.550) -- 0:00:23
629500 -- (-532.053) [-531.891] (-532.338) (-532.966) * [-533.271] (-534.399) (-534.737) (-532.390) -- 0:00:23
630000 -- (-532.486) (-533.484) (-532.027) [-531.965] * (-532.630) [-534.212] (-532.767) (-533.702) -- 0:00:23
Average standard deviation of split frequencies: 0.010465
630500 -- (-535.375) [-534.414] (-532.863) (-533.555) * [-532.454] (-533.152) (-534.145) (-531.828) -- 0:00:23
631000 -- (-535.051) (-533.635) (-532.220) [-540.095] * (-536.825) (-536.922) [-535.587] (-534.333) -- 0:00:23
631500 -- (-532.814) (-531.972) (-533.696) [-534.743] * (-534.045) (-533.172) [-534.080] (-532.310) -- 0:00:23
632000 -- (-532.907) [-532.452] (-533.155) (-537.628) * (-534.975) (-533.288) [-533.879] (-532.861) -- 0:00:23
632500 -- [-532.490] (-531.933) (-536.676) (-535.941) * (-535.137) (-532.572) [-536.654] (-534.866) -- 0:00:23
633000 -- [-533.014] (-534.123) (-533.646) (-534.108) * (-536.225) [-532.424] (-532.337) (-536.082) -- 0:00:23
633500 -- [-533.194] (-532.691) (-533.757) (-533.747) * (-532.112) (-533.603) [-532.269] (-535.148) -- 0:00:23
634000 -- (-538.697) [-533.751] (-532.668) (-533.570) * (-532.044) [-534.217] (-532.649) (-533.075) -- 0:00:23
634500 -- (-535.341) (-534.795) [-533.321] (-533.619) * (-537.810) [-533.809] (-532.181) (-533.669) -- 0:00:23
635000 -- (-536.170) (-536.056) (-536.319) [-533.287] * (-536.179) (-535.164) (-537.999) [-532.990] -- 0:00:22
Average standard deviation of split frequencies: 0.010886
635500 -- [-533.895] (-532.630) (-536.132) (-532.897) * (-532.433) (-532.889) (-535.802) [-532.266] -- 0:00:22
636000 -- (-534.887) [-536.021] (-535.155) (-532.383) * (-531.848) (-536.440) (-535.239) [-532.921] -- 0:00:22
636500 -- (-533.699) [-534.786] (-534.630) (-532.287) * (-534.012) [-532.062] (-534.943) (-537.208) -- 0:00:22
637000 -- (-534.508) (-535.604) (-536.308) [-533.069] * (-535.071) (-532.288) (-533.411) [-535.485] -- 0:00:22
637500 -- [-535.628] (-535.489) (-535.228) (-533.347) * (-533.839) (-533.690) (-532.220) [-531.665] -- 0:00:22
638000 -- (-531.852) (-535.456) [-532.135] (-532.650) * [-533.332] (-537.413) (-534.662) (-533.205) -- 0:00:22
638500 -- (-536.879) [-533.770] (-533.935) (-535.154) * (-533.095) (-535.080) [-532.230] (-539.639) -- 0:00:22
639000 -- [-532.882] (-533.603) (-532.894) (-535.262) * [-534.853] (-534.520) (-532.089) (-541.401) -- 0:00:22
639500 -- (-535.278) [-536.314] (-533.527) (-533.011) * (-535.840) [-536.560] (-532.544) (-536.962) -- 0:00:22
640000 -- (-533.781) (-533.449) (-534.566) [-532.530] * [-534.464] (-533.532) (-533.273) (-535.199) -- 0:00:22
Average standard deviation of split frequencies: 0.010945
640500 -- (-537.008) [-533.411] (-532.241) (-536.029) * [-535.067] (-533.751) (-533.572) (-533.411) -- 0:00:22
641000 -- (-534.240) (-533.312) [-534.865] (-537.168) * (-534.932) (-534.334) [-532.280] (-533.762) -- 0:00:22
641500 -- [-533.321] (-534.226) (-536.519) (-535.677) * (-535.788) [-532.816] (-537.700) (-534.096) -- 0:00:22
642000 -- [-534.770] (-534.615) (-535.364) (-533.330) * (-533.343) (-533.019) (-534.971) [-534.145] -- 0:00:22
642500 -- (-536.463) (-542.449) (-533.921) [-533.085] * (-538.298) [-532.843] (-534.962) (-534.703) -- 0:00:22
643000 -- (-534.742) (-536.410) (-533.219) [-532.967] * (-536.641) (-535.066) [-535.105] (-536.626) -- 0:00:22
643500 -- (-532.786) [-533.765] (-534.094) (-534.134) * [-532.719] (-533.055) (-533.361) (-533.229) -- 0:00:22
644000 -- (-532.496) (-536.962) [-535.255] (-533.303) * [-535.292] (-533.384) (-532.950) (-532.857) -- 0:00:22
644500 -- (-534.511) [-532.668] (-533.371) (-531.947) * [-534.646] (-534.561) (-534.741) (-533.606) -- 0:00:22
645000 -- [-531.938] (-533.099) (-532.377) (-534.100) * (-532.352) (-536.149) (-540.872) [-531.662] -- 0:00:22
Average standard deviation of split frequencies: 0.010581
645500 -- (-532.214) (-535.559) [-533.469] (-533.608) * [-534.276] (-532.825) (-534.088) (-531.875) -- 0:00:22
646000 -- (-535.529) (-535.504) (-532.736) [-535.991] * (-535.649) [-534.589] (-535.054) (-534.809) -- 0:00:22
646500 -- (-537.697) [-534.715] (-532.953) (-535.069) * [-534.296] (-535.269) (-536.698) (-532.785) -- 0:00:22
647000 -- (-533.210) [-535.364] (-534.665) (-532.638) * (-535.308) (-535.209) (-533.142) [-536.694] -- 0:00:22
647500 -- (-533.794) [-536.541] (-533.063) (-537.989) * [-534.904] (-536.113) (-536.942) (-533.902) -- 0:00:22
648000 -- (-536.759) [-534.484] (-533.471) (-536.488) * (-534.469) (-537.791) [-535.011] (-532.223) -- 0:00:22
648500 -- (-533.106) [-533.193] (-534.008) (-535.607) * (-535.291) (-536.233) [-531.882] (-532.280) -- 0:00:22
649000 -- [-532.929] (-532.199) (-532.058) (-534.122) * [-532.539] (-537.712) (-533.053) (-532.680) -- 0:00:22
649500 -- (-533.156) (-532.410) [-533.549] (-535.197) * [-533.295] (-532.717) (-533.065) (-536.185) -- 0:00:22
650000 -- (-533.102) (-533.626) (-532.285) [-532.372] * (-535.556) [-533.682] (-537.151) (-533.228) -- 0:00:22
Average standard deviation of split frequencies: 0.010188
650500 -- (-532.225) (-539.777) (-532.530) [-534.481] * [-533.404] (-533.440) (-536.176) (-532.347) -- 0:00:22
651000 -- (-532.984) (-537.858) (-534.519) [-540.004] * (-538.490) (-533.619) (-534.993) [-535.131] -- 0:00:21
651500 -- (-533.187) [-533.225] (-533.997) (-535.741) * (-539.767) (-532.254) [-533.395] (-532.350) -- 0:00:21
652000 -- (-532.024) (-535.022) [-534.562] (-535.656) * (-534.158) (-532.641) [-532.480] (-534.031) -- 0:00:21
652500 -- (-535.577) [-534.146] (-532.892) (-532.763) * (-533.311) (-531.573) (-532.469) [-534.943] -- 0:00:21
653000 -- (-532.341) (-533.151) [-535.277] (-532.517) * [-539.240] (-532.905) (-532.739) (-533.645) -- 0:00:21
653500 -- (-533.611) (-532.693) (-532.279) [-532.499] * (-532.565) [-531.906] (-532.006) (-538.251) -- 0:00:21
654000 -- [-533.621] (-534.092) (-534.096) (-533.104) * (-533.436) (-534.183) [-533.705] (-536.773) -- 0:00:21
654500 -- [-536.057] (-538.328) (-531.962) (-533.548) * (-534.615) (-533.609) (-540.642) [-536.073] -- 0:00:21
655000 -- (-534.714) (-534.915) (-533.366) [-536.105] * [-536.177] (-535.317) (-533.937) (-533.245) -- 0:00:21
Average standard deviation of split frequencies: 0.010195
655500 -- [-535.188] (-535.223) (-536.792) (-536.561) * (-535.556) (-532.336) [-533.088] (-532.897) -- 0:00:21
656000 -- (-532.735) (-533.493) [-533.236] (-537.242) * (-535.682) (-533.257) [-532.565] (-533.434) -- 0:00:21
656500 -- (-532.754) [-535.654] (-532.977) (-536.131) * (-535.417) (-533.163) [-531.643] (-538.203) -- 0:00:21
657000 -- (-532.556) (-534.952) (-532.666) [-533.767] * (-532.212) (-532.615) [-532.937] (-538.310) -- 0:00:21
657500 -- (-533.749) [-532.275] (-540.573) (-534.921) * (-532.211) (-535.618) [-533.198] (-534.156) -- 0:00:21
658000 -- [-534.064] (-532.138) (-538.526) (-532.976) * (-531.870) (-539.900) [-533.371] (-532.303) -- 0:00:21
658500 -- (-531.984) (-532.007) [-535.385] (-538.580) * (-535.519) (-533.271) [-532.608] (-533.684) -- 0:00:21
659000 -- [-532.380] (-533.859) (-536.654) (-535.765) * [-531.825] (-535.687) (-532.109) (-532.944) -- 0:00:21
659500 -- (-535.563) (-534.072) [-533.002] (-533.462) * (-535.224) (-535.845) [-534.695] (-535.751) -- 0:00:21
660000 -- (-533.024) (-535.126) (-535.840) [-532.667] * (-536.232) (-532.881) (-535.653) [-535.509] -- 0:00:21
Average standard deviation of split frequencies: 0.009677
660500 -- (-534.074) [-533.689] (-536.738) (-532.770) * [-537.404] (-534.393) (-533.648) (-535.059) -- 0:00:21
661000 -- (-534.100) (-532.851) [-534.852] (-533.837) * (-534.846) (-535.762) (-539.595) [-535.098] -- 0:00:21
661500 -- [-532.555] (-533.563) (-533.438) (-533.096) * [-533.645] (-534.171) (-537.071) (-536.787) -- 0:00:21
662000 -- [-532.129] (-531.673) (-533.887) (-537.620) * (-533.989) (-536.494) (-533.262) [-533.149] -- 0:00:21
662500 -- (-532.217) [-531.689] (-532.301) (-533.912) * [-533.171] (-535.297) (-534.561) (-532.402) -- 0:00:21
663000 -- (-532.732) [-532.410] (-534.124) (-532.923) * [-535.311] (-532.587) (-534.702) (-540.369) -- 0:00:21
663500 -- (-534.373) [-535.300] (-532.381) (-533.667) * (-536.343) [-535.199] (-533.980) (-533.771) -- 0:00:21
664000 -- (-537.217) (-533.551) [-535.324] (-533.756) * (-534.937) (-533.565) (-536.043) [-533.087] -- 0:00:21
664500 -- (-551.053) [-536.154] (-533.267) (-545.532) * (-535.033) [-531.978] (-534.343) (-532.770) -- 0:00:21
665000 -- (-543.040) (-536.263) [-536.528] (-540.728) * (-532.240) (-531.629) (-534.184) [-532.202] -- 0:00:21
Average standard deviation of split frequencies: 0.009379
665500 -- (-534.858) (-537.937) [-532.838] (-538.665) * [-531.784] (-534.831) (-532.851) (-533.445) -- 0:00:21
666000 -- (-532.391) [-533.436] (-532.979) (-533.255) * [-532.332] (-539.348) (-534.929) (-536.536) -- 0:00:21
666500 -- [-535.151] (-534.097) (-532.324) (-535.375) * (-531.449) [-534.799] (-534.425) (-533.833) -- 0:00:21
667000 -- (-533.985) [-532.550] (-534.230) (-532.900) * (-535.319) (-533.935) (-532.504) [-531.788] -- 0:00:20
667500 -- (-533.959) (-532.422) (-535.538) [-532.296] * (-531.813) [-539.022] (-535.841) (-532.506) -- 0:00:20
668000 -- (-533.982) (-533.557) [-532.916] (-533.241) * (-533.058) (-535.445) (-532.474) [-533.490] -- 0:00:20
668500 -- (-535.908) [-532.576] (-533.216) (-535.007) * [-534.907] (-533.796) (-532.283) (-533.584) -- 0:00:20
669000 -- (-533.088) (-533.062) [-533.981] (-536.501) * (-534.970) [-533.267] (-532.760) (-533.687) -- 0:00:20
669500 -- (-535.885) (-535.323) (-533.607) [-532.054] * (-533.713) [-533.196] (-535.109) (-536.007) -- 0:00:20
670000 -- [-533.190] (-533.126) (-535.054) (-535.349) * (-536.381) [-533.337] (-534.957) (-534.920) -- 0:00:20
Average standard deviation of split frequencies: 0.009621
670500 -- (-532.560) (-534.068) [-533.524] (-534.155) * (-533.934) (-532.991) (-534.703) [-535.336] -- 0:00:20
671000 -- (-535.339) (-538.185) (-535.307) [-533.990] * [-533.142] (-533.532) (-533.713) (-535.574) -- 0:00:20
671500 -- (-539.371) (-533.213) [-532.413] (-532.318) * (-534.467) [-536.077] (-535.678) (-534.474) -- 0:00:20
672000 -- [-533.797] (-534.270) (-534.522) (-531.968) * (-533.386) [-534.711] (-534.965) (-533.174) -- 0:00:20
672500 -- (-532.458) [-534.828] (-532.294) (-531.923) * (-536.043) [-534.971] (-532.962) (-533.140) -- 0:00:20
673000 -- (-533.862) (-536.818) (-532.259) [-535.060] * (-537.612) [-535.267] (-532.671) (-532.314) -- 0:00:20
673500 -- (-532.782) [-534.042] (-532.254) (-533.889) * (-533.151) [-539.029] (-534.088) (-532.482) -- 0:00:20
674000 -- (-534.295) (-534.090) [-532.372] (-533.597) * (-532.148) [-532.249] (-534.217) (-533.626) -- 0:00:20
674500 -- (-531.901) (-532.904) [-536.193] (-536.000) * (-532.858) (-533.624) [-533.271] (-532.580) -- 0:00:20
675000 -- (-532.439) (-533.176) [-534.420] (-533.986) * [-533.905] (-533.283) (-538.902) (-533.592) -- 0:00:20
Average standard deviation of split frequencies: 0.009371
675500 -- (-536.149) (-531.789) (-534.914) [-534.288] * [-535.554] (-534.714) (-535.800) (-536.259) -- 0:00:20
676000 -- (-533.633) (-531.950) (-537.351) [-534.190] * (-536.669) [-532.338] (-538.051) (-535.182) -- 0:00:20
676500 -- (-532.894) (-534.559) (-539.557) [-537.346] * [-532.413] (-533.457) (-535.000) (-537.856) -- 0:00:20
677000 -- (-536.716) (-533.059) (-534.509) [-532.566] * (-533.324) (-533.707) [-538.552] (-534.193) -- 0:00:20
677500 -- (-534.621) (-537.744) (-534.203) [-533.471] * [-538.375] (-533.586) (-533.439) (-534.141) -- 0:00:20
678000 -- (-534.644) [-536.067] (-532.700) (-535.793) * [-531.912] (-535.519) (-532.583) (-532.790) -- 0:00:20
678500 -- (-532.098) (-533.598) [-533.649] (-536.339) * (-533.701) (-531.889) (-531.747) [-536.173] -- 0:00:20
679000 -- [-532.448] (-532.310) (-532.372) (-536.846) * (-533.557) (-534.147) [-533.291] (-532.784) -- 0:00:20
679500 -- (-534.782) [-533.446] (-534.337) (-532.379) * [-532.527] (-532.879) (-535.800) (-535.598) -- 0:00:20
680000 -- (-533.292) (-535.032) [-533.880] (-533.896) * [-532.681] (-535.389) (-533.432) (-540.140) -- 0:00:20
Average standard deviation of split frequencies: 0.009912
680500 -- (-533.624) (-535.379) (-533.253) [-533.051] * (-532.016) [-533.640] (-534.373) (-534.818) -- 0:00:20
681000 -- (-538.188) (-533.402) [-532.249] (-535.390) * (-532.757) (-536.269) [-533.769] (-533.093) -- 0:00:20
681500 -- (-538.104) (-536.756) (-532.803) [-534.603] * (-531.695) (-534.103) [-532.993] (-533.855) -- 0:00:20
682000 -- [-532.739] (-536.679) (-533.596) (-535.595) * (-532.954) [-536.980] (-534.232) (-534.743) -- 0:00:20
682500 -- (-534.961) [-532.825] (-532.983) (-533.944) * (-535.404) (-534.182) (-535.605) [-532.186] -- 0:00:20
683000 -- (-534.185) (-538.352) [-532.740] (-532.559) * (-535.087) (-534.352) (-534.188) [-536.473] -- 0:00:19
683500 -- (-534.802) (-532.485) [-532.399] (-534.589) * (-533.487) [-533.731] (-533.167) (-532.162) -- 0:00:19
684000 -- (-531.808) (-533.695) [-533.530] (-534.979) * (-533.745) (-533.758) (-539.450) [-533.987] -- 0:00:19
684500 -- [-534.380] (-533.056) (-533.145) (-536.413) * (-532.311) (-534.509) (-535.836) [-537.843] -- 0:00:19
685000 -- (-532.669) (-532.557) [-532.767] (-534.769) * (-532.022) (-532.870) (-536.961) [-535.378] -- 0:00:19
Average standard deviation of split frequencies: 0.010222
685500 -- (-532.541) [-533.665] (-532.874) (-531.938) * [-532.467] (-535.946) (-532.856) (-537.326) -- 0:00:19
686000 -- (-532.062) [-532.392] (-536.710) (-533.749) * (-533.881) [-532.993] (-536.687) (-532.715) -- 0:00:19
686500 -- (-533.386) (-531.715) [-535.174] (-532.862) * (-534.603) (-532.893) (-532.651) [-532.522] -- 0:00:19
687000 -- (-533.414) [-533.143] (-532.595) (-534.112) * [-533.725] (-531.713) (-531.818) (-535.712) -- 0:00:19
687500 -- (-537.277) (-532.223) (-532.480) [-532.235] * (-533.727) (-532.494) (-535.301) [-534.487] -- 0:00:19
688000 -- (-532.371) (-535.219) [-532.820] (-532.693) * (-533.324) (-533.270) (-539.137) [-534.946] -- 0:00:19
688500 -- (-533.132) (-532.867) (-532.061) [-537.574] * (-534.771) [-532.219] (-537.931) (-531.945) -- 0:00:19
689000 -- (-535.687) (-532.968) [-533.513] (-532.574) * (-538.496) (-534.919) [-531.971] (-531.851) -- 0:00:19
689500 -- (-536.627) (-534.015) [-531.889] (-533.242) * (-536.618) [-535.371] (-531.954) (-542.714) -- 0:00:19
690000 -- (-532.879) (-533.266) (-531.970) [-535.880] * (-531.914) (-536.462) (-532.507) [-534.018] -- 0:00:19
Average standard deviation of split frequencies: 0.010793
690500 -- (-532.554) (-533.325) (-531.687) [-533.013] * (-533.772) [-538.557] (-536.314) (-534.597) -- 0:00:19
691000 -- (-534.822) (-535.557) [-533.031] (-534.058) * [-531.793] (-533.043) (-536.308) (-536.132) -- 0:00:19
691500 -- (-540.797) (-535.347) [-535.343] (-533.681) * (-533.821) [-536.357] (-538.080) (-538.330) -- 0:00:19
692000 -- [-533.151] (-537.714) (-534.686) (-535.564) * (-534.361) (-535.614) (-535.596) [-533.799] -- 0:00:19
692500 -- (-533.703) [-533.221] (-535.721) (-532.900) * (-533.594) [-532.340] (-534.508) (-533.974) -- 0:00:19
693000 -- (-539.010) [-533.343] (-533.816) (-533.383) * (-532.146) [-533.847] (-535.044) (-532.714) -- 0:00:19
693500 -- (-535.188) (-534.648) [-532.176] (-534.685) * (-533.105) (-534.640) (-540.219) [-533.179] -- 0:00:19
694000 -- (-534.471) [-533.360] (-533.357) (-533.072) * (-533.526) [-534.145] (-532.545) (-534.050) -- 0:00:19
694500 -- (-534.843) (-536.240) (-535.259) [-532.999] * (-533.243) [-532.201] (-537.571) (-534.923) -- 0:00:19
695000 -- [-536.428] (-541.527) (-535.971) (-532.959) * (-533.755) (-533.637) (-534.170) [-533.275] -- 0:00:19
Average standard deviation of split frequencies: 0.010498
695500 -- [-533.153] (-532.777) (-534.889) (-534.391) * [-532.826] (-533.574) (-533.013) (-534.620) -- 0:00:19
696000 -- [-533.768] (-535.024) (-534.889) (-533.519) * (-533.922) (-535.725) [-533.834] (-533.952) -- 0:00:19
696500 -- [-532.372] (-534.453) (-534.873) (-533.437) * (-533.461) (-531.723) [-537.029] (-533.457) -- 0:00:19
697000 -- (-533.688) (-532.560) [-532.985] (-534.397) * [-533.071] (-532.823) (-532.941) (-531.852) -- 0:00:19
697500 -- [-532.751] (-535.707) (-532.274) (-535.789) * (-533.378) (-532.615) [-535.775] (-532.024) -- 0:00:19
698000 -- (-533.976) (-533.406) (-532.453) [-532.983] * (-533.340) [-536.342] (-535.179) (-532.173) -- 0:00:19
698500 -- (-534.493) (-535.435) [-533.156] (-533.894) * (-533.343) (-533.799) (-534.436) [-533.087] -- 0:00:18
699000 -- (-534.871) (-533.275) [-532.172] (-532.670) * [-533.289] (-535.703) (-533.536) (-532.330) -- 0:00:18
699500 -- (-535.119) (-532.122) [-532.825] (-536.521) * (-534.161) (-542.725) [-532.517] (-534.225) -- 0:00:18
700000 -- (-533.114) [-533.365] (-533.874) (-533.364) * (-532.659) (-534.026) [-532.196] (-533.811) -- 0:00:18
Average standard deviation of split frequencies: 0.010302
700500 -- (-532.083) [-534.463] (-533.511) (-534.027) * (-532.149) [-533.924] (-533.035) (-534.822) -- 0:00:18
701000 -- [-537.349] (-533.995) (-533.070) (-532.697) * [-532.332] (-536.542) (-533.250) (-532.017) -- 0:00:18
701500 -- (-531.770) (-535.216) (-533.348) [-534.337] * (-532.880) (-533.867) (-532.496) [-534.704] -- 0:00:18
702000 -- (-537.005) [-532.058] (-535.718) (-534.433) * [-535.212] (-533.048) (-531.585) (-533.578) -- 0:00:18
702500 -- (-534.127) [-533.973] (-533.527) (-533.022) * (-538.702) [-532.528] (-531.899) (-534.641) -- 0:00:18
703000 -- (-534.994) [-533.395] (-534.421) (-531.660) * (-534.570) (-533.639) (-532.126) [-532.863] -- 0:00:18
703500 -- (-535.296) (-538.015) (-537.701) [-532.022] * (-535.296) (-537.086) [-532.658] (-534.710) -- 0:00:18
704000 -- (-532.773) (-535.416) [-531.749] (-534.610) * (-533.341) (-532.422) (-533.378) [-535.135] -- 0:00:18
704500 -- (-532.633) (-534.157) (-534.206) [-536.678] * (-533.076) [-533.856] (-536.154) (-532.962) -- 0:00:18
705000 -- (-533.204) (-534.721) (-532.589) [-533.241] * (-534.240) [-533.657] (-536.267) (-536.019) -- 0:00:18
Average standard deviation of split frequencies: 0.010516
705500 -- (-533.837) (-533.792) [-534.924] (-534.771) * (-533.669) (-533.762) (-536.096) [-538.794] -- 0:00:18
706000 -- (-533.155) (-537.245) [-533.051] (-532.085) * (-533.383) (-533.382) [-534.259] (-532.873) -- 0:00:18
706500 -- (-536.729) (-532.959) [-533.411] (-532.447) * (-533.221) (-532.469) (-534.777) [-534.080] -- 0:00:18
707000 -- (-535.035) [-532.827] (-534.422) (-537.854) * (-533.883) (-533.162) [-534.333] (-534.084) -- 0:00:18
707500 -- (-532.623) (-531.825) [-537.391] (-537.812) * [-533.006] (-537.155) (-533.720) (-533.888) -- 0:00:18
708000 -- [-536.537] (-533.653) (-535.019) (-534.249) * (-532.097) (-533.296) (-533.340) [-534.268] -- 0:00:18
708500 -- (-540.830) (-535.096) (-533.483) [-533.675] * (-534.106) [-533.171] (-535.046) (-533.540) -- 0:00:18
709000 -- (-533.912) (-533.902) [-533.657] (-536.473) * [-534.260] (-532.036) (-532.386) (-531.603) -- 0:00:18
709500 -- (-533.640) (-534.145) (-531.591) [-533.197] * [-534.676] (-532.586) (-533.731) (-539.137) -- 0:00:18
710000 -- (-533.859) [-532.468] (-532.791) (-533.153) * (-534.587) [-531.621] (-531.723) (-537.881) -- 0:00:18
Average standard deviation of split frequencies: 0.010613
710500 -- (-534.193) (-536.240) [-532.871] (-533.124) * (-537.277) [-533.393] (-535.135) (-532.235) -- 0:00:18
711000 -- (-533.458) (-535.521) (-532.951) [-536.731] * [-534.830] (-534.295) (-534.419) (-532.803) -- 0:00:18
711500 -- [-534.211] (-539.595) (-537.087) (-536.270) * (-534.136) (-532.809) (-534.741) [-533.933] -- 0:00:18
712000 -- (-535.124) (-538.043) [-544.195] (-532.510) * [-533.940] (-533.681) (-532.428) (-534.180) -- 0:00:18
712500 -- (-534.220) (-533.112) (-535.392) [-535.763] * (-532.544) [-535.381] (-533.347) (-534.305) -- 0:00:18
713000 -- (-533.380) [-533.846] (-533.774) (-533.720) * (-532.698) [-536.873] (-535.673) (-534.004) -- 0:00:18
713500 -- (-531.769) (-536.557) [-537.490] (-532.103) * [-532.221] (-537.859) (-532.880) (-538.897) -- 0:00:18
714000 -- [-532.491] (-538.687) (-534.425) (-532.325) * (-533.606) [-534.008] (-532.642) (-535.954) -- 0:00:18
714500 -- (-532.018) (-537.227) (-532.713) [-532.960] * (-532.648) (-536.871) [-532.840] (-533.594) -- 0:00:17
715000 -- (-536.817) [-533.818] (-532.591) (-534.708) * [-534.085] (-533.096) (-536.723) (-533.572) -- 0:00:17
Average standard deviation of split frequencies: 0.010905
715500 -- (-533.592) [-533.014] (-534.890) (-532.786) * (-536.107) (-534.553) (-534.819) [-532.637] -- 0:00:17
716000 -- (-533.122) (-537.119) [-534.012] (-532.180) * (-535.864) [-533.050] (-533.128) (-535.646) -- 0:00:17
716500 -- (-533.894) [-533.205] (-532.419) (-536.147) * (-534.289) (-535.152) [-532.800] (-533.456) -- 0:00:17
717000 -- (-534.225) (-534.029) (-533.368) [-534.256] * (-533.792) [-537.535] (-534.517) (-535.262) -- 0:00:17
717500 -- (-533.635) (-531.805) (-538.042) [-533.068] * (-534.622) [-533.407] (-533.279) (-533.645) -- 0:00:17
718000 -- (-534.852) [-532.383] (-536.077) (-532.569) * (-534.984) [-532.269] (-533.589) (-533.643) -- 0:00:17
718500 -- (-534.128) [-532.421] (-535.102) (-532.709) * (-531.705) (-533.936) (-534.900) [-531.973] -- 0:00:17
719000 -- [-534.591] (-533.324) (-534.495) (-532.333) * (-535.065) (-534.584) [-532.757] (-533.216) -- 0:00:17
719500 -- (-533.558) [-536.813] (-535.754) (-535.539) * [-532.278] (-534.423) (-534.213) (-539.563) -- 0:00:17
720000 -- (-533.962) (-535.817) (-535.386) [-535.485] * (-532.319) (-533.087) [-535.864] (-535.907) -- 0:00:17
Average standard deviation of split frequencies: 0.009975
720500 -- [-535.902] (-531.930) (-534.831) (-533.805) * (-535.893) (-532.557) (-532.904) [-535.029] -- 0:00:17
721000 -- [-532.621] (-534.882) (-534.874) (-536.056) * (-536.906) (-534.938) (-538.016) [-534.807] -- 0:00:17
721500 -- (-533.748) [-533.250] (-533.409) (-533.753) * (-534.930) (-534.784) [-533.248] (-535.274) -- 0:00:17
722000 -- (-537.072) (-537.105) (-533.414) [-532.145] * (-534.472) (-533.385) [-533.973] (-535.539) -- 0:00:17
722500 -- (-536.087) (-532.997) [-532.622] (-531.810) * [-534.305] (-532.883) (-533.508) (-532.586) -- 0:00:17
723000 -- (-534.549) (-532.990) [-533.116] (-535.915) * [-534.076] (-533.825) (-532.886) (-536.091) -- 0:00:17
723500 -- (-537.393) [-533.579] (-532.803) (-536.239) * (-533.535) (-534.246) [-534.410] (-538.406) -- 0:00:17
724000 -- [-533.405] (-535.429) (-533.599) (-533.979) * (-538.342) (-532.073) [-534.177] (-533.499) -- 0:00:17
724500 -- (-532.154) (-533.238) [-533.627] (-533.584) * [-533.374] (-538.043) (-533.394) (-533.866) -- 0:00:17
725000 -- (-534.130) (-532.813) (-533.204) [-532.570] * (-533.962) (-534.913) (-535.343) [-533.457] -- 0:00:17
Average standard deviation of split frequencies: 0.010064
725500 -- (-533.851) [-532.728] (-533.848) (-534.628) * (-535.534) [-532.200] (-548.442) (-534.490) -- 0:00:17
726000 -- (-534.032) (-531.851) [-535.731] (-536.200) * (-536.137) (-533.215) [-534.095] (-532.832) -- 0:00:17
726500 -- (-534.130) (-532.675) [-539.002] (-540.350) * [-534.520] (-535.171) (-535.224) (-534.418) -- 0:00:17
727000 -- [-533.005] (-532.957) (-534.511) (-535.071) * (-534.857) (-534.558) [-531.564] (-535.852) -- 0:00:17
727500 -- (-535.113) (-532.590) (-532.968) [-534.020] * (-532.350) (-534.885) (-532.985) [-534.856] -- 0:00:17
728000 -- (-532.530) [-532.578] (-532.961) (-534.814) * (-532.809) [-535.956] (-535.718) (-539.118) -- 0:00:17
728500 -- [-532.222] (-532.831) (-533.782) (-535.018) * [-532.129] (-534.296) (-533.630) (-536.837) -- 0:00:17
729000 -- (-533.061) (-534.003) (-535.830) [-532.338] * (-537.277) (-531.954) [-531.723] (-534.408) -- 0:00:17
729500 -- [-533.173] (-533.960) (-533.502) (-533.206) * (-533.686) (-534.151) [-538.321] (-535.514) -- 0:00:17
730000 -- (-537.246) (-537.455) (-532.387) [-535.825] * (-534.452) [-535.525] (-533.195) (-532.749) -- 0:00:17
Average standard deviation of split frequencies: 0.010000
730500 -- (-536.051) [-536.688] (-532.570) (-534.276) * (-535.576) (-536.064) [-534.630] (-532.748) -- 0:00:16
731000 -- (-535.216) (-535.277) [-532.511] (-534.159) * (-533.239) [-534.150] (-532.680) (-532.557) -- 0:00:16
731500 -- (-532.381) (-534.485) [-534.793] (-533.590) * (-533.886) (-535.457) [-536.017] (-534.366) -- 0:00:16
732000 -- [-535.261] (-532.758) (-534.557) (-534.231) * (-536.345) (-537.770) [-536.464] (-533.556) -- 0:00:16
732500 -- (-534.908) (-532.417) [-532.847] (-532.553) * (-537.685) (-534.481) (-535.951) [-534.144] -- 0:00:16
733000 -- (-538.718) [-532.602] (-532.281) (-534.605) * (-532.882) [-534.646] (-533.669) (-533.266) -- 0:00:16
733500 -- [-533.526] (-536.504) (-537.389) (-534.196) * [-533.739] (-535.550) (-532.283) (-534.833) -- 0:00:16
734000 -- (-532.978) (-535.166) (-534.724) [-532.644] * (-533.548) (-535.470) (-535.815) [-534.144] -- 0:00:16
734500 -- (-533.689) (-531.645) (-533.931) [-531.504] * (-533.749) [-534.916] (-537.601) (-533.995) -- 0:00:16
735000 -- [-533.036] (-532.744) (-535.513) (-533.275) * (-533.294) (-533.712) [-534.760] (-533.423) -- 0:00:16
Average standard deviation of split frequencies: 0.009888
735500 -- (-534.023) (-532.482) [-535.870] (-533.525) * (-536.481) [-534.245] (-535.766) (-533.249) -- 0:00:16
736000 -- (-535.516) (-538.208) [-533.455] (-532.068) * [-532.499] (-532.511) (-535.991) (-532.555) -- 0:00:16
736500 -- (-535.697) (-535.772) (-532.597) [-532.164] * (-534.481) (-536.011) (-535.357) [-531.786] -- 0:00:16
737000 -- (-532.345) [-534.231] (-539.911) (-535.632) * (-533.652) (-533.063) [-533.498] (-533.648) -- 0:00:16
737500 -- (-533.285) (-532.372) (-535.928) [-531.922] * (-533.843) [-532.288] (-534.139) (-537.225) -- 0:00:16
738000 -- (-534.667) (-539.754) [-537.348] (-532.694) * (-533.088) (-532.805) (-533.191) [-534.578] -- 0:00:16
738500 -- (-532.809) (-534.004) [-532.481] (-533.594) * [-534.954] (-532.653) (-533.564) (-532.367) -- 0:00:16
739000 -- (-533.316) [-533.119] (-534.842) (-534.849) * (-536.998) (-534.691) [-533.729] (-535.852) -- 0:00:16
739500 -- (-533.300) (-536.433) [-532.565] (-533.267) * (-540.449) (-532.532) [-531.878] (-531.940) -- 0:00:16
740000 -- (-536.723) [-532.434] (-531.989) (-534.385) * (-536.185) (-532.351) (-533.048) [-533.467] -- 0:00:16
Average standard deviation of split frequencies: 0.009786
740500 -- (-532.518) [-536.668] (-536.637) (-535.144) * [-533.605] (-532.377) (-534.201) (-534.766) -- 0:00:16
741000 -- [-531.823] (-534.901) (-532.417) (-534.421) * [-533.076] (-533.875) (-535.108) (-533.165) -- 0:00:16
741500 -- [-535.183] (-535.749) (-534.007) (-533.531) * (-533.599) [-533.915] (-535.947) (-533.362) -- 0:00:16
742000 -- (-532.828) [-536.220] (-534.646) (-532.679) * (-532.927) (-532.622) [-532.881] (-534.532) -- 0:00:16
742500 -- (-535.621) (-533.661) [-533.672] (-532.841) * (-535.555) [-533.704] (-533.714) (-532.685) -- 0:00:16
743000 -- [-538.554] (-537.921) (-536.757) (-533.978) * [-534.926] (-534.521) (-533.102) (-531.746) -- 0:00:16
743500 -- (-535.819) [-539.276] (-534.217) (-538.393) * [-532.406] (-533.509) (-532.674) (-534.557) -- 0:00:16
744000 -- (-535.398) (-537.127) [-534.111] (-535.094) * [-532.618] (-533.147) (-534.509) (-535.232) -- 0:00:16
744500 -- (-533.005) [-532.450] (-533.284) (-533.889) * (-532.967) [-532.052] (-534.922) (-537.913) -- 0:00:16
745000 -- [-533.903] (-535.396) (-532.194) (-538.171) * [-532.474] (-535.553) (-532.805) (-533.489) -- 0:00:16
Average standard deviation of split frequencies: 0.009676
745500 -- (-533.935) (-531.798) [-532.121] (-536.774) * (-532.072) (-535.992) (-532.215) [-532.625] -- 0:00:16
746000 -- [-534.473] (-531.931) (-534.510) (-533.396) * (-532.619) [-536.729] (-532.529) (-536.972) -- 0:00:16
746500 -- (-533.408) [-532.162] (-534.717) (-535.133) * (-532.285) (-535.042) (-532.252) [-532.338] -- 0:00:15
747000 -- (-532.848) (-533.153) (-537.513) [-533.513] * (-532.815) [-537.527] (-537.352) (-535.909) -- 0:00:15
747500 -- (-534.178) (-535.054) (-539.248) [-534.232] * (-533.531) (-533.494) [-534.395] (-533.007) -- 0:00:15
748000 -- (-535.483) (-532.698) (-533.513) [-534.152] * (-532.950) (-532.615) (-535.075) [-535.907] -- 0:00:15
748500 -- [-533.901] (-532.526) (-534.031) (-534.265) * (-534.408) [-532.309] (-535.461) (-533.876) -- 0:00:15
749000 -- (-536.984) (-533.953) (-534.580) [-533.579] * (-534.675) (-533.161) (-533.498) [-533.163] -- 0:00:15
749500 -- (-536.912) (-533.159) (-536.447) [-533.575] * (-535.217) (-534.520) [-533.548] (-534.156) -- 0:00:15
750000 -- (-534.142) (-534.025) (-534.940) [-532.649] * (-532.517) (-535.678) (-534.019) [-533.377] -- 0:00:15
Average standard deviation of split frequencies: 0.008909
750500 -- (-534.954) (-534.778) [-533.289] (-532.719) * (-532.475) (-538.788) (-533.068) [-532.503] -- 0:00:15
751000 -- (-534.519) (-538.878) (-531.858) [-533.330] * (-533.670) (-534.541) [-533.109] (-532.461) -- 0:00:15
751500 -- (-533.330) [-532.520] (-531.378) (-533.718) * (-535.173) (-534.180) [-531.602] (-532.603) -- 0:00:15
752000 -- (-532.331) (-533.713) [-533.496] (-540.586) * (-537.130) (-535.607) [-532.567] (-532.424) -- 0:00:15
752500 -- (-536.146) (-532.677) [-532.663] (-542.326) * (-537.454) (-533.173) (-532.047) [-533.160] -- 0:00:15
753000 -- (-532.549) (-534.948) [-533.154] (-536.717) * (-533.162) (-533.614) (-533.470) [-536.533] -- 0:00:15
753500 -- (-534.984) [-532.810] (-532.463) (-534.896) * (-535.296) (-532.464) [-532.881] (-534.032) -- 0:00:15
754000 -- [-533.436] (-532.073) (-539.629) (-534.424) * (-535.399) (-534.140) [-533.646] (-532.381) -- 0:00:15
754500 -- [-532.862] (-534.727) (-537.166) (-534.360) * (-533.635) (-536.946) [-533.133] (-532.867) -- 0:00:15
755000 -- (-533.686) [-533.195] (-536.049) (-532.251) * [-532.638] (-537.687) (-532.541) (-536.322) -- 0:00:15
Average standard deviation of split frequencies: 0.008730
755500 -- (-533.129) (-531.559) [-534.781] (-532.021) * (-531.581) (-534.114) (-533.494) [-533.501] -- 0:00:15
756000 -- (-533.844) (-534.198) (-534.119) [-534.110] * (-532.560) [-532.655] (-533.890) (-534.950) -- 0:00:15
756500 -- (-535.177) [-533.888] (-536.593) (-532.897) * (-532.829) (-533.468) [-536.066] (-534.949) -- 0:00:15
757000 -- (-534.042) (-532.973) (-532.070) [-533.630] * [-534.873] (-534.650) (-534.746) (-539.887) -- 0:00:15
757500 -- (-534.251) [-533.120] (-537.442) (-532.299) * (-536.473) [-534.094] (-533.605) (-536.383) -- 0:00:15
758000 -- (-534.571) (-533.479) [-533.073] (-532.281) * (-532.709) (-534.769) (-534.869) [-533.968] -- 0:00:15
758500 -- (-535.052) (-533.299) (-536.148) [-531.743] * (-533.264) (-539.341) [-534.360] (-535.410) -- 0:00:15
759000 -- [-536.527] (-537.992) (-532.720) (-534.946) * (-532.369) (-533.384) [-533.832] (-538.051) -- 0:00:15
759500 -- [-534.810] (-533.724) (-535.510) (-532.807) * (-532.843) (-532.959) [-532.520] (-533.557) -- 0:00:15
760000 -- (-533.173) (-536.995) (-534.924) [-533.511] * (-538.748) (-532.469) (-535.205) [-535.981] -- 0:00:15
Average standard deviation of split frequencies: 0.008947
760500 -- (-533.599) (-532.062) [-535.454] (-533.790) * (-533.159) [-534.045] (-535.289) (-534.840) -- 0:00:15
761000 -- [-533.443] (-534.002) (-537.675) (-537.328) * [-534.413] (-534.685) (-535.021) (-532.242) -- 0:00:15
761500 -- [-531.995] (-538.010) (-533.690) (-536.555) * [-533.094] (-533.142) (-536.228) (-532.111) -- 0:00:15
762000 -- (-533.174) (-537.700) [-532.379] (-532.411) * (-536.576) [-535.926] (-533.837) (-532.999) -- 0:00:14
762500 -- (-535.949) (-536.846) (-532.108) [-532.024] * [-532.414] (-537.124) (-535.635) (-539.253) -- 0:00:14
763000 -- [-537.904] (-532.673) (-532.317) (-531.735) * (-534.189) (-533.237) (-536.935) [-538.182] -- 0:00:14
763500 -- (-535.218) [-533.056] (-531.604) (-534.206) * (-534.083) (-532.633) (-533.180) [-535.806] -- 0:00:14
764000 -- (-533.391) (-533.599) (-531.813) [-539.671] * (-533.341) (-532.761) [-534.047] (-534.289) -- 0:00:14
764500 -- [-531.883] (-535.942) (-532.360) (-538.101) * (-534.744) (-534.323) (-535.987) [-533.132] -- 0:00:14
765000 -- (-535.479) (-534.703) (-533.269) [-538.017] * (-535.466) (-533.321) (-534.892) [-535.866] -- 0:00:14
Average standard deviation of split frequencies: 0.009154
765500 -- (-532.675) (-538.779) [-532.411] (-531.745) * (-536.888) (-533.862) (-536.191) [-534.395] -- 0:00:14
766000 -- [-532.332] (-535.203) (-536.164) (-533.641) * (-536.673) (-532.552) [-534.992] (-534.515) -- 0:00:14
766500 -- (-533.591) [-532.718] (-534.886) (-531.612) * (-531.973) [-534.189] (-533.425) (-537.786) -- 0:00:14
767000 -- (-533.671) (-533.089) (-533.300) [-532.427] * (-532.498) (-532.575) (-532.518) [-533.658] -- 0:00:14
767500 -- (-533.168) [-533.481] (-535.180) (-532.265) * (-532.218) (-534.794) (-534.278) [-532.030] -- 0:00:14
768000 -- [-533.998] (-535.751) (-532.452) (-532.238) * (-535.176) (-533.714) [-533.086] (-534.655) -- 0:00:14
768500 -- [-532.598] (-536.120) (-533.959) (-531.711) * (-533.763) [-533.291] (-532.982) (-537.607) -- 0:00:14
769000 -- (-532.987) [-533.485] (-532.281) (-533.833) * (-542.150) [-532.225] (-532.638) (-532.427) -- 0:00:14
769500 -- [-533.549] (-535.794) (-536.166) (-532.515) * [-534.013] (-531.811) (-534.063) (-532.470) -- 0:00:14
770000 -- [-533.991] (-536.217) (-532.910) (-534.308) * [-533.835] (-535.249) (-533.370) (-531.657) -- 0:00:14
Average standard deviation of split frequencies: 0.008984
770500 -- (-534.070) (-534.338) [-534.170] (-535.336) * (-532.742) (-535.723) [-533.990] (-532.392) -- 0:00:14
771000 -- (-533.526) [-533.843] (-534.299) (-532.990) * [-533.153] (-534.946) (-532.752) (-533.481) -- 0:00:14
771500 -- (-535.253) (-534.536) [-533.132] (-537.837) * (-534.758) (-531.729) [-533.849] (-532.329) -- 0:00:14
772000 -- (-536.275) (-534.481) (-536.852) [-535.091] * (-536.523) [-531.826] (-533.036) (-532.753) -- 0:00:14
772500 -- [-534.170] (-533.200) (-532.466) (-533.037) * [-532.466] (-536.008) (-538.272) (-532.094) -- 0:00:14
773000 -- (-535.600) (-534.354) (-534.316) [-532.017] * (-533.241) [-534.558] (-533.369) (-535.135) -- 0:00:14
773500 -- (-534.190) (-536.708) [-533.638] (-532.563) * (-536.271) [-533.596] (-537.959) (-534.142) -- 0:00:14
774000 -- (-532.824) [-534.175] (-533.857) (-533.004) * (-537.690) (-532.644) (-534.042) [-532.856] -- 0:00:14
774500 -- (-535.382) (-533.512) (-533.162) [-532.541] * (-534.888) [-533.534] (-533.173) (-532.245) -- 0:00:14
775000 -- (-531.748) (-536.785) [-532.528] (-532.623) * (-535.341) (-533.079) (-531.653) [-533.487] -- 0:00:14
Average standard deviation of split frequencies: 0.007897
775500 -- (-533.355) (-535.151) [-533.319] (-533.981) * (-533.108) [-532.278] (-534.835) (-536.209) -- 0:00:14
776000 -- (-534.703) (-542.252) [-537.163] (-536.506) * [-534.521] (-531.570) (-535.478) (-533.011) -- 0:00:14
776500 -- (-533.323) (-534.607) [-535.016] (-542.740) * (-537.453) (-534.954) (-535.584) [-535.915] -- 0:00:14
777000 -- (-532.293) [-532.002] (-541.655) (-538.812) * (-537.833) (-534.708) (-536.204) [-534.600] -- 0:00:14
777500 -- [-534.447] (-534.413) (-535.282) (-538.868) * (-533.810) (-536.776) [-534.076] (-536.205) -- 0:00:14
778000 -- (-534.465) (-534.568) (-535.862) [-537.113] * (-533.159) [-533.233] (-536.854) (-536.193) -- 0:00:13
778500 -- (-533.809) [-536.931] (-538.311) (-532.472) * (-533.939) [-534.942] (-533.632) (-533.813) -- 0:00:13
779000 -- (-533.410) [-533.407] (-537.344) (-531.673) * (-533.829) (-532.072) [-534.639] (-533.937) -- 0:00:13
779500 -- [-533.155] (-538.753) (-534.726) (-533.290) * (-535.592) [-532.555] (-535.108) (-533.066) -- 0:00:13
780000 -- (-535.835) (-540.782) [-534.085] (-532.917) * (-538.028) [-535.626] (-534.675) (-535.045) -- 0:00:13
Average standard deviation of split frequencies: 0.007649
780500 -- (-531.933) (-533.907) [-533.014] (-532.320) * (-535.721) [-539.402] (-535.679) (-533.470) -- 0:00:13
781000 -- (-533.025) (-534.509) [-533.234] (-536.160) * (-533.333) (-537.115) [-534.410] (-535.838) -- 0:00:13
781500 -- [-533.081] (-536.332) (-532.451) (-534.408) * (-536.914) (-534.025) [-533.187] (-535.618) -- 0:00:13
782000 -- (-533.632) (-533.765) [-534.448] (-537.830) * (-533.084) (-535.981) (-536.210) [-533.696] -- 0:00:13
782500 -- (-533.924) (-533.078) (-539.140) [-533.740] * [-534.512] (-536.434) (-535.535) (-534.290) -- 0:00:13
783000 -- (-534.905) [-532.266] (-535.248) (-533.094) * [-537.537] (-536.560) (-535.192) (-536.895) -- 0:00:13
783500 -- (-532.911) (-534.054) [-537.777] (-532.354) * (-540.018) (-533.977) [-534.412] (-534.644) -- 0:00:13
784000 -- (-534.499) (-533.786) (-533.499) [-532.270] * [-533.704] (-532.678) (-533.060) (-532.375) -- 0:00:13
784500 -- (-532.440) [-532.538] (-533.661) (-532.072) * [-536.521] (-533.869) (-533.028) (-532.995) -- 0:00:13
785000 -- (-532.792) (-531.941) [-532.180] (-533.220) * (-535.816) (-532.881) (-533.690) [-536.332] -- 0:00:13
Average standard deviation of split frequencies: 0.007477
785500 -- (-535.203) (-533.174) [-532.640] (-533.921) * (-533.429) (-532.705) [-533.381] (-533.695) -- 0:00:13
786000 -- (-532.146) [-532.720] (-533.599) (-533.502) * [-535.092] (-532.322) (-534.221) (-534.622) -- 0:00:13
786500 -- (-532.220) (-532.438) (-533.631) [-532.566] * (-536.874) (-532.279) [-533.070] (-533.110) -- 0:00:13
787000 -- (-532.730) (-532.547) [-532.139] (-535.265) * [-532.768] (-532.748) (-533.313) (-533.009) -- 0:00:13
787500 -- (-532.817) (-532.884) (-535.164) [-534.405] * [-533.978] (-536.675) (-534.279) (-533.121) -- 0:00:13
788000 -- [-532.777] (-536.272) (-532.522) (-532.045) * (-533.948) [-532.352] (-533.249) (-535.704) -- 0:00:13
788500 -- (-532.438) (-534.673) [-534.162] (-531.806) * [-535.894] (-532.247) (-535.892) (-535.515) -- 0:00:13
789000 -- (-534.857) [-532.765] (-534.541) (-537.958) * (-535.304) (-532.084) (-536.764) [-531.907] -- 0:00:13
789500 -- (-535.201) [-533.226] (-535.291) (-533.415) * (-535.612) (-534.371) [-531.941] (-531.871) -- 0:00:13
790000 -- (-532.940) (-531.767) [-532.062] (-532.572) * (-533.657) [-534.486] (-532.504) (-533.956) -- 0:00:13
Average standard deviation of split frequencies: 0.007353
790500 -- [-532.498] (-533.739) (-537.660) (-532.318) * (-534.078) (-533.320) [-534.021] (-531.730) -- 0:00:13
791000 -- (-535.382) (-532.234) (-535.546) [-533.845] * (-534.094) (-534.747) (-535.463) [-532.529] -- 0:00:13
791500 -- (-533.018) (-532.230) [-535.723] (-534.083) * (-535.815) (-532.768) (-533.997) [-533.237] -- 0:00:13
792000 -- (-533.705) (-532.432) (-534.901) [-533.680] * [-534.071] (-535.338) (-533.984) (-533.163) -- 0:00:13
792500 -- (-533.611) (-533.290) (-534.052) [-533.036] * (-532.917) (-537.684) (-533.573) [-533.893] -- 0:00:13
793000 -- [-531.645] (-533.552) (-533.087) (-537.681) * (-536.403) (-536.771) [-533.817] (-535.679) -- 0:00:13
793500 -- [-532.863] (-533.938) (-536.776) (-535.559) * (-533.573) [-534.874] (-535.468) (-532.475) -- 0:00:13
794000 -- (-532.729) (-532.524) (-533.921) [-532.997] * [-533.779] (-533.304) (-532.732) (-533.896) -- 0:00:12
794500 -- (-532.033) (-536.737) [-534.846] (-533.390) * [-534.669] (-536.776) (-532.451) (-534.245) -- 0:00:12
795000 -- (-532.443) [-536.773] (-533.111) (-534.196) * (-535.114) [-532.704] (-532.306) (-533.113) -- 0:00:12
Average standard deviation of split frequencies: 0.007896
795500 -- (-536.434) (-533.786) [-533.096] (-532.442) * (-535.688) (-536.603) [-532.523] (-535.424) -- 0:00:12
796000 -- (-532.084) (-536.605) (-533.918) [-532.933] * (-537.167) [-534.983] (-533.785) (-534.001) -- 0:00:12
796500 -- [-533.784] (-534.729) (-534.433) (-537.851) * (-532.765) (-533.328) (-533.192) [-534.271] -- 0:00:12
797000 -- (-536.926) (-534.134) [-533.475] (-535.217) * [-533.284] (-532.145) (-540.595) (-533.653) -- 0:00:12
797500 -- (-534.949) [-534.437] (-532.480) (-532.282) * (-533.399) [-533.325] (-537.083) (-534.381) -- 0:00:12
798000 -- (-535.761) (-533.195) [-533.521] (-534.056) * (-532.408) [-537.163] (-535.522) (-534.502) -- 0:00:12
798500 -- [-532.595] (-533.752) (-534.318) (-534.160) * (-533.873) (-534.363) [-534.653] (-534.712) -- 0:00:12
799000 -- [-531.868] (-535.104) (-533.800) (-533.498) * (-536.903) (-533.648) [-533.407] (-532.068) -- 0:00:12
799500 -- (-535.027) (-533.641) (-532.498) [-534.900] * [-536.283] (-532.937) (-534.432) (-533.938) -- 0:00:12
800000 -- (-534.061) [-535.443] (-532.489) (-538.636) * (-537.632) (-533.947) (-532.394) [-534.647] -- 0:00:12
Average standard deviation of split frequencies: 0.007732
800500 -- (-536.704) (-540.883) (-532.192) [-533.355] * [-535.640] (-534.101) (-533.336) (-535.153) -- 0:00:12
801000 -- [-534.034] (-539.208) (-537.380) (-533.392) * [-532.153] (-533.484) (-537.812) (-532.248) -- 0:00:12
801500 -- (-534.430) (-535.439) [-534.627] (-532.428) * (-536.841) (-534.313) [-533.448] (-535.062) -- 0:00:12
802000 -- (-534.661) [-534.395] (-535.274) (-535.054) * (-536.994) [-532.168] (-537.414) (-533.163) -- 0:00:12
802500 -- (-535.789) (-534.874) [-533.650] (-535.081) * (-533.457) (-534.273) [-532.369] (-532.622) -- 0:00:12
803000 -- (-533.989) [-535.406] (-532.461) (-533.337) * [-534.042] (-533.229) (-532.887) (-532.279) -- 0:00:12
803500 -- [-532.844] (-534.619) (-535.303) (-537.951) * (-532.850) (-533.382) [-532.571] (-534.931) -- 0:00:12
804000 -- (-532.655) (-534.235) [-534.068] (-537.215) * (-533.222) (-532.576) (-533.979) [-535.760] -- 0:00:12
804500 -- (-532.728) (-533.970) [-536.291] (-534.863) * (-532.731) [-531.910] (-533.024) (-536.048) -- 0:00:12
805000 -- (-531.932) [-532.140] (-533.584) (-538.020) * [-533.343] (-538.236) (-532.116) (-533.394) -- 0:00:12
Average standard deviation of split frequencies: 0.007681
805500 -- (-531.776) [-533.607] (-534.360) (-534.559) * [-534.400] (-535.872) (-533.291) (-533.435) -- 0:00:12
806000 -- (-534.257) (-534.795) (-536.021) [-532.340] * (-534.005) (-533.698) (-536.547) [-533.494] -- 0:00:12
806500 -- (-533.390) [-534.848] (-539.097) (-533.674) * (-534.107) [-533.659] (-532.888) (-534.255) -- 0:00:12
807000 -- (-533.528) [-532.452] (-535.372) (-533.227) * (-532.379) [-538.262] (-534.269) (-532.296) -- 0:00:12
807500 -- (-536.156) (-531.945) (-533.846) [-537.362] * (-533.166) (-534.205) (-532.455) [-533.485] -- 0:00:12
808000 -- [-537.969] (-533.384) (-536.590) (-534.359) * (-534.482) (-534.342) [-534.780] (-535.371) -- 0:00:12
808500 -- [-538.304] (-532.037) (-532.259) (-534.077) * [-533.374] (-534.181) (-532.688) (-533.747) -- 0:00:12
809000 -- (-533.001) (-534.559) (-531.543) [-532.119] * (-532.646) (-534.400) [-533.937] (-532.917) -- 0:00:12
809500 -- [-532.468] (-535.501) (-531.419) (-532.899) * [-534.534] (-533.955) (-535.378) (-532.917) -- 0:00:12
810000 -- (-535.069) (-536.701) (-535.119) [-531.879] * (-535.962) [-534.515] (-535.172) (-536.602) -- 0:00:11
Average standard deviation of split frequencies: 0.007676
810500 -- [-533.495] (-535.218) (-538.304) (-532.560) * (-533.397) [-531.926] (-537.081) (-535.851) -- 0:00:11
811000 -- [-533.008] (-533.531) (-535.949) (-532.800) * (-533.025) (-532.637) [-531.793] (-534.936) -- 0:00:11
811500 -- [-532.153] (-533.885) (-535.184) (-534.001) * (-535.887) [-533.589] (-531.881) (-534.938) -- 0:00:11
812000 -- [-532.905] (-534.333) (-533.364) (-533.537) * (-533.912) (-533.601) (-531.493) [-533.170] -- 0:00:11
812500 -- [-532.702] (-534.712) (-534.328) (-532.272) * [-532.238] (-533.024) (-535.260) (-532.846) -- 0:00:11
813000 -- (-533.934) (-533.600) (-536.228) [-532.843] * (-533.852) (-532.183) (-534.514) [-533.675] -- 0:00:11
813500 -- (-533.157) (-532.173) [-534.403] (-533.948) * (-534.339) (-533.698) [-534.564] (-536.442) -- 0:00:11
814000 -- (-534.587) [-533.639] (-534.046) (-535.481) * (-532.984) (-537.364) (-533.870) [-534.345] -- 0:00:11
814500 -- (-532.193) (-532.843) [-536.329] (-535.714) * (-534.515) (-534.290) [-534.719] (-533.951) -- 0:00:11
815000 -- [-537.396] (-535.356) (-533.812) (-534.306) * [-534.012] (-532.332) (-537.412) (-533.349) -- 0:00:11
Average standard deviation of split frequencies: 0.007664
815500 -- (-540.573) (-539.043) (-535.858) [-533.750] * [-532.157] (-533.111) (-533.634) (-534.986) -- 0:00:11
816000 -- (-533.223) (-536.362) (-533.167) [-533.681] * (-534.657) (-537.037) (-533.869) [-532.615] -- 0:00:11
816500 -- (-537.327) (-536.225) (-532.690) [-537.245] * [-535.294] (-536.924) (-540.992) (-532.908) -- 0:00:11
817000 -- (-532.512) (-533.140) [-531.421] (-536.914) * [-534.986] (-534.876) (-532.496) (-533.446) -- 0:00:11
817500 -- (-538.215) (-534.487) (-532.040) [-534.970] * [-532.192] (-532.927) (-537.213) (-537.595) -- 0:00:11
818000 -- (-537.558) (-536.190) (-532.047) [-533.881] * (-533.001) (-538.271) (-534.643) [-534.875] -- 0:00:11
818500 -- (-535.868) (-536.412) (-531.846) [-533.700] * [-533.033] (-535.819) (-537.889) (-535.178) -- 0:00:11
819000 -- (-533.592) (-538.026) [-531.791] (-535.750) * (-534.627) [-533.607] (-540.139) (-533.631) -- 0:00:11
819500 -- (-539.570) (-540.569) (-531.862) [-535.702] * (-536.805) [-537.697] (-537.909) (-534.075) -- 0:00:11
820000 -- [-536.036] (-535.074) (-532.479) (-536.451) * (-532.616) (-540.051) [-536.479] (-539.291) -- 0:00:11
Average standard deviation of split frequencies: 0.007774
820500 -- (-532.791) (-534.421) [-532.915] (-533.506) * [-531.563] (-534.436) (-537.059) (-537.173) -- 0:00:11
821000 -- (-531.853) (-534.452) [-532.879] (-536.901) * (-535.651) (-533.854) [-533.927] (-535.250) -- 0:00:11
821500 -- [-534.798] (-534.372) (-534.342) (-538.202) * (-534.708) [-534.246] (-536.071) (-536.127) -- 0:00:11
822000 -- (-535.803) (-534.412) [-532.787] (-538.016) * [-532.761] (-532.906) (-535.815) (-534.284) -- 0:00:11
822500 -- [-533.709] (-532.717) (-534.104) (-537.387) * [-532.615] (-535.669) (-531.872) (-531.786) -- 0:00:11
823000 -- [-533.041] (-535.757) (-536.057) (-536.645) * (-536.865) (-534.039) [-531.851] (-534.325) -- 0:00:11
823500 -- (-533.507) [-536.303] (-536.763) (-531.743) * [-532.896] (-533.469) (-533.007) (-535.305) -- 0:00:11
824000 -- (-535.306) (-534.788) (-535.239) [-532.702] * (-538.752) [-536.867] (-534.678) (-534.231) -- 0:00:11
824500 -- [-533.091] (-532.941) (-536.952) (-535.246) * (-538.746) [-533.934] (-534.793) (-532.444) -- 0:00:11
825000 -- (-535.015) [-532.090] (-532.054) (-534.721) * (-535.197) (-533.706) [-534.531] (-533.726) -- 0:00:11
Average standard deviation of split frequencies: 0.008218
825500 -- (-538.710) (-534.657) (-532.988) [-534.118] * [-536.339] (-536.908) (-533.054) (-535.113) -- 0:00:10
826000 -- (-533.435) (-532.349) (-532.111) [-533.022] * (-533.079) [-535.455] (-534.816) (-534.493) -- 0:00:10
826500 -- (-535.798) (-532.811) [-532.353] (-536.379) * [-534.256] (-535.660) (-534.312) (-534.886) -- 0:00:10
827000 -- (-533.990) (-532.830) (-532.163) [-532.338] * (-535.013) (-534.079) [-533.980] (-534.545) -- 0:00:10
827500 -- (-531.575) [-534.909] (-531.900) (-532.363) * (-533.718) (-536.224) (-534.786) [-533.994] -- 0:00:10
828000 -- (-531.542) (-535.228) [-533.487] (-532.554) * (-535.474) (-534.345) [-532.392] (-533.965) -- 0:00:10
828500 -- (-535.909) (-534.939) (-535.445) [-532.224] * (-533.053) [-534.449] (-533.356) (-533.684) -- 0:00:10
829000 -- (-541.229) (-536.613) (-537.204) [-532.571] * (-535.522) (-535.224) (-532.509) [-532.013] -- 0:00:10
829500 -- (-542.275) [-534.108] (-533.429) (-533.329) * [-534.200] (-533.916) (-532.752) (-532.625) -- 0:00:10
830000 -- (-534.909) (-533.577) [-533.442] (-533.576) * (-532.902) (-534.203) [-532.811] (-531.948) -- 0:00:10
Average standard deviation of split frequencies: 0.008248
830500 -- (-532.057) [-531.748] (-533.308) (-533.244) * (-533.738) (-535.752) [-531.986] (-534.485) -- 0:00:10
831000 -- (-533.508) (-534.863) (-535.065) [-534.908] * [-533.265] (-535.833) (-535.095) (-539.689) -- 0:00:10
831500 -- (-532.450) [-533.070] (-532.328) (-533.739) * [-534.382] (-537.511) (-532.576) (-535.984) -- 0:00:10
832000 -- (-534.585) (-535.082) [-531.991] (-536.585) * (-535.039) (-537.080) [-532.080] (-534.474) -- 0:00:10
832500 -- (-534.530) (-533.648) [-537.440] (-536.677) * (-532.675) [-534.010] (-532.735) (-533.140) -- 0:00:10
833000 -- [-532.932] (-533.610) (-536.893) (-533.636) * (-536.297) [-532.922] (-533.512) (-537.037) -- 0:00:10
833500 -- (-531.611) (-532.473) (-534.037) [-533.669] * (-535.109) (-533.405) [-535.873] (-533.058) -- 0:00:10
834000 -- (-536.300) [-533.450] (-533.777) (-533.003) * (-533.750) (-534.939) (-533.860) [-532.728] -- 0:00:10
834500 -- (-535.889) (-535.276) (-532.393) [-533.912] * [-537.374] (-537.418) (-533.975) (-533.245) -- 0:00:10
835000 -- (-538.745) (-534.314) [-533.268] (-534.520) * (-534.672) [-534.808] (-533.807) (-532.511) -- 0:00:10
Average standard deviation of split frequencies: 0.008007
835500 -- [-533.526] (-535.396) (-532.838) (-533.019) * (-533.153) [-533.736] (-531.871) (-532.127) -- 0:00:10
836000 -- (-540.044) (-537.488) [-531.825] (-533.451) * (-533.069) (-535.765) [-532.633] (-532.145) -- 0:00:10
836500 -- (-532.254) (-532.403) (-533.892) [-532.355] * (-534.084) (-536.016) [-532.489] (-536.033) -- 0:00:10
837000 -- (-535.728) (-532.955) (-534.554) [-532.351] * (-534.779) (-533.282) (-533.386) [-533.798] -- 0:00:10
837500 -- (-533.163) (-535.837) [-534.595] (-532.724) * (-533.662) [-532.758] (-532.948) (-533.533) -- 0:00:10
838000 -- [-532.160] (-539.321) (-533.158) (-534.187) * [-533.792] (-533.542) (-538.811) (-533.500) -- 0:00:10
838500 -- (-534.342) (-537.718) (-534.271) [-533.847] * (-532.755) [-532.455] (-534.397) (-534.167) -- 0:00:10
839000 -- [-533.623] (-532.423) (-533.378) (-534.002) * [-535.445] (-531.894) (-534.295) (-532.258) -- 0:00:09
839500 -- (-533.179) [-533.764] (-531.840) (-532.316) * (-534.474) (-533.024) (-534.732) [-535.297] -- 0:00:10
840000 -- (-533.287) (-533.224) [-532.279] (-534.345) * (-532.508) (-533.298) (-535.721) [-535.236] -- 0:00:10
Average standard deviation of split frequencies: 0.008224
840500 -- (-533.392) (-534.755) [-532.073] (-542.114) * (-534.132) (-532.948) (-533.761) [-533.036] -- 0:00:10
841000 -- [-533.868] (-532.742) (-534.969) (-533.436) * (-534.933) (-531.554) [-532.394] (-531.454) -- 0:00:10
841500 -- (-534.331) (-535.111) [-538.715] (-533.042) * [-532.899] (-532.932) (-532.332) (-533.793) -- 0:00:09
842000 -- [-535.012] (-534.045) (-535.444) (-533.252) * (-539.909) [-535.500] (-532.768) (-534.804) -- 0:00:09
842500 -- (-543.965) (-533.930) [-531.749] (-531.917) * (-533.729) (-535.412) (-532.269) [-534.962] -- 0:00:09
843000 -- (-535.875) [-533.485] (-532.975) (-532.088) * (-535.971) (-532.986) [-532.256] (-533.135) -- 0:00:09
843500 -- (-533.922) (-535.164) (-539.686) [-532.791] * (-532.580) (-535.075) [-533.353] (-534.003) -- 0:00:09
844000 -- [-534.918] (-538.767) (-536.934) (-533.514) * (-534.509) (-533.885) [-534.004] (-533.533) -- 0:00:09
844500 -- [-534.167] (-536.625) (-532.738) (-531.805) * [-533.596] (-533.550) (-536.907) (-532.304) -- 0:00:09
845000 -- (-534.015) (-533.140) [-531.723] (-531.802) * (-532.610) (-535.564) (-534.882) [-532.066] -- 0:00:09
Average standard deviation of split frequencies: 0.008172
845500 -- (-536.317) [-535.270] (-537.785) (-533.191) * (-533.240) (-537.535) [-534.716] (-532.354) -- 0:00:09
846000 -- (-537.894) [-533.414] (-533.327) (-533.354) * (-532.242) [-535.215] (-533.420) (-532.227) -- 0:00:09
846500 -- (-532.433) [-534.772] (-534.058) (-533.573) * [-534.568] (-536.406) (-534.133) (-534.584) -- 0:00:09
847000 -- (-534.952) (-535.593) [-533.794] (-533.527) * (-531.660) (-533.976) [-532.587] (-534.908) -- 0:00:09
847500 -- (-531.805) [-532.965] (-534.391) (-532.878) * [-533.066] (-537.078) (-534.170) (-539.604) -- 0:00:09
848000 -- [-531.737] (-533.278) (-533.737) (-532.232) * (-534.575) [-535.228] (-532.559) (-533.145) -- 0:00:09
848500 -- (-532.081) [-532.035] (-532.632) (-533.969) * (-537.536) (-535.234) (-535.020) [-536.852] -- 0:00:09
849000 -- (-531.531) (-534.273) (-533.981) [-532.239] * (-540.835) [-534.752] (-533.107) (-532.006) -- 0:00:09
849500 -- (-533.097) (-534.042) [-533.811] (-531.517) * (-532.773) (-531.916) [-534.360] (-532.063) -- 0:00:09
850000 -- [-533.225] (-533.606) (-533.009) (-532.771) * (-532.632) (-533.009) (-533.156) [-534.984] -- 0:00:09
Average standard deviation of split frequencies: 0.007980
850500 -- (-533.219) (-534.194) [-532.567] (-532.580) * (-532.021) [-534.760] (-535.295) (-532.512) -- 0:00:09
851000 -- [-532.041] (-536.302) (-532.429) (-534.364) * (-537.087) (-534.739) (-537.184) [-531.862] -- 0:00:09
851500 -- (-533.652) [-533.462] (-535.183) (-531.419) * (-535.234) (-533.609) (-534.504) [-533.898] -- 0:00:09
852000 -- [-533.921] (-533.612) (-534.828) (-531.747) * (-534.025) (-532.258) (-534.206) [-532.702] -- 0:00:09
852500 -- (-534.395) (-534.319) (-535.324) [-532.791] * [-536.256] (-535.134) (-535.136) (-532.918) -- 0:00:09
853000 -- [-532.963] (-534.510) (-535.218) (-533.650) * (-533.590) (-534.959) [-532.910] (-535.110) -- 0:00:09
853500 -- [-535.311] (-535.106) (-532.780) (-537.230) * (-535.222) (-534.427) [-533.085] (-535.185) -- 0:00:09
854000 -- (-536.753) [-535.738] (-533.399) (-534.226) * (-534.526) (-533.097) [-533.514] (-533.612) -- 0:00:09
854500 -- (-535.096) [-534.666] (-532.937) (-532.905) * (-535.757) (-534.654) (-535.687) [-533.511] -- 0:00:09
855000 -- (-533.435) [-532.800] (-536.984) (-533.977) * (-534.225) (-535.510) (-534.175) [-535.308] -- 0:00:09
Average standard deviation of split frequencies: 0.008224
855500 -- (-534.392) (-532.141) [-533.717] (-532.128) * (-534.756) (-534.615) [-532.533] (-537.317) -- 0:00:09
856000 -- (-534.540) (-537.236) (-533.066) [-534.292] * [-533.616] (-535.288) (-534.768) (-535.286) -- 0:00:09
856500 -- (-534.270) [-532.441] (-533.835) (-533.985) * [-537.047] (-534.127) (-532.574) (-536.017) -- 0:00:09
857000 -- (-533.566) [-533.275] (-537.109) (-537.515) * (-533.160) [-532.895] (-532.474) (-533.849) -- 0:00:09
857500 -- (-535.406) [-534.335] (-535.306) (-533.676) * [-532.874] (-537.537) (-532.013) (-537.464) -- 0:00:08
858000 -- (-534.155) [-534.635] (-535.529) (-536.752) * (-533.051) (-534.691) [-534.142] (-537.020) -- 0:00:08
858500 -- [-531.573] (-534.406) (-531.760) (-535.073) * (-533.013) (-537.145) (-532.822) [-533.359] -- 0:00:08
859000 -- (-532.903) (-538.013) (-532.474) [-534.418] * (-533.002) [-537.783] (-534.037) (-532.357) -- 0:00:08
859500 -- (-535.744) [-531.932] (-532.828) (-535.558) * [-532.015] (-540.225) (-534.080) (-535.000) -- 0:00:08
860000 -- [-533.702] (-541.116) (-537.615) (-535.605) * (-532.755) (-537.029) (-535.188) [-535.144] -- 0:00:08
Average standard deviation of split frequencies: 0.008070
860500 -- [-534.598] (-535.910) (-535.548) (-533.813) * (-533.226) (-536.114) (-536.911) [-533.242] -- 0:00:08
861000 -- (-533.028) (-534.491) (-532.570) [-534.670] * (-532.600) (-534.803) (-535.196) [-535.477] -- 0:00:08
861500 -- (-533.099) (-532.097) (-532.587) [-535.158] * [-534.062] (-532.383) (-532.704) (-534.709) -- 0:00:08
862000 -- (-531.829) (-534.096) (-532.524) [-532.975] * (-534.131) (-534.850) [-534.966] (-539.225) -- 0:00:08
862500 -- (-533.812) (-533.679) (-534.024) [-532.668] * (-533.078) (-534.448) (-537.840) [-537.928] -- 0:00:08
863000 -- (-532.366) [-533.147] (-533.383) (-532.280) * [-533.556] (-533.121) (-533.917) (-536.694) -- 0:00:08
863500 -- (-532.574) (-531.761) [-537.127] (-532.585) * [-534.019] (-536.112) (-532.197) (-537.077) -- 0:00:08
864000 -- [-532.792] (-531.813) (-534.142) (-536.283) * [-532.499] (-532.739) (-533.992) (-532.185) -- 0:00:08
864500 -- [-532.754] (-533.430) (-533.288) (-534.350) * (-533.261) (-532.576) [-533.616] (-536.319) -- 0:00:08
865000 -- (-532.850) (-534.142) [-533.497] (-537.054) * (-535.353) [-531.909] (-533.850) (-537.184) -- 0:00:08
Average standard deviation of split frequencies: 0.007911
865500 -- [-532.799] (-532.309) (-534.750) (-534.758) * (-535.093) (-532.489) (-535.664) [-532.801] -- 0:00:08
866000 -- (-533.355) (-535.719) (-533.315) [-536.289] * (-532.996) (-535.511) [-532.402] (-532.635) -- 0:00:08
866500 -- (-536.258) [-534.667] (-532.708) (-537.326) * (-535.094) [-532.551] (-531.935) (-534.960) -- 0:00:08
867000 -- (-533.804) [-533.396] (-534.144) (-533.998) * (-533.696) [-534.022] (-536.266) (-536.079) -- 0:00:08
867500 -- [-532.272] (-535.476) (-532.648) (-539.801) * (-532.713) [-536.422] (-532.532) (-538.496) -- 0:00:08
868000 -- (-533.053) [-534.404] (-533.544) (-541.099) * (-532.350) (-535.886) (-533.443) [-532.664] -- 0:00:08
868500 -- (-538.511) (-533.682) [-533.546] (-534.381) * (-534.458) (-535.597) [-533.694] (-534.094) -- 0:00:08
869000 -- (-532.575) (-534.453) [-536.216] (-533.986) * (-533.260) (-531.755) [-531.719] (-537.869) -- 0:00:08
869500 -- (-532.747) (-533.530) (-535.062) [-534.426] * (-534.768) [-532.449] (-533.149) (-533.783) -- 0:00:08
870000 -- (-532.942) (-534.707) (-534.730) [-532.491] * (-534.199) (-536.168) [-533.232] (-534.660) -- 0:00:08
Average standard deviation of split frequencies: 0.007472
870500 -- (-533.949) (-534.410) (-534.939) [-532.619] * [-534.125] (-532.088) (-532.949) (-532.280) -- 0:00:08
871000 -- (-532.955) (-532.563) [-535.446] (-534.765) * (-532.199) (-535.239) [-534.222] (-538.888) -- 0:00:08
871500 -- (-532.787) [-532.318] (-535.786) (-534.510) * [-535.115] (-533.060) (-532.532) (-534.506) -- 0:00:08
872000 -- [-534.884] (-533.322) (-536.996) (-535.248) * (-534.919) (-533.695) (-536.159) [-533.537] -- 0:00:08
872500 -- (-537.829) [-534.142] (-535.681) (-533.715) * (-535.939) [-531.708] (-533.266) (-533.799) -- 0:00:08
873000 -- [-533.685] (-532.335) (-535.951) (-532.556) * (-534.313) (-531.788) (-533.545) [-532.143] -- 0:00:08
873500 -- (-532.587) [-532.935] (-534.933) (-534.464) * (-532.650) [-531.833] (-534.734) (-531.767) -- 0:00:07
874000 -- (-533.343) [-538.401] (-534.198) (-533.166) * [-534.026] (-535.515) (-532.641) (-534.276) -- 0:00:07
874500 -- (-532.581) (-534.512) [-532.569] (-533.133) * [-535.923] (-534.551) (-537.500) (-532.818) -- 0:00:07
875000 -- (-538.930) (-532.760) (-536.046) [-533.222] * (-538.028) [-532.831] (-537.754) (-532.690) -- 0:00:07
Average standard deviation of split frequencies: 0.007354
875500 -- (-533.456) (-532.545) (-534.096) [-532.943] * [-533.398] (-532.856) (-536.433) (-532.311) -- 0:00:07
876000 -- (-536.035) (-532.668) (-535.011) [-534.920] * [-536.620] (-537.042) (-534.223) (-532.417) -- 0:00:07
876500 -- (-533.470) (-532.460) (-534.935) [-532.309] * (-536.981) (-535.118) (-534.746) [-532.137] -- 0:00:07
877000 -- [-533.046] (-533.228) (-535.080) (-533.878) * [-532.777] (-535.725) (-532.257) (-533.699) -- 0:00:07
877500 -- (-531.922) (-537.437) (-534.376) [-534.441] * (-533.991) [-534.306] (-532.696) (-536.570) -- 0:00:07
878000 -- (-540.604) (-533.227) [-532.683] (-533.926) * [-532.102] (-535.521) (-531.761) (-533.107) -- 0:00:07
878500 -- (-533.186) (-534.458) (-532.036) [-533.077] * (-533.131) (-534.380) [-532.891] (-534.212) -- 0:00:07
879000 -- (-534.340) [-532.343] (-534.527) (-534.506) * (-534.103) [-532.288] (-533.861) (-533.922) -- 0:00:07
879500 -- (-532.283) (-533.781) [-533.734] (-533.407) * [-534.174] (-534.700) (-533.738) (-533.306) -- 0:00:07
880000 -- (-532.685) [-533.603] (-534.369) (-534.612) * (-533.561) (-534.366) (-532.829) [-532.975] -- 0:00:07
Average standard deviation of split frequencies: 0.007280
880500 -- (-532.825) [-532.604] (-538.596) (-534.112) * (-534.832) (-534.865) [-532.069] (-536.991) -- 0:00:07
881000 -- (-531.776) (-535.926) (-533.087) [-532.691] * (-536.285) [-535.068] (-534.398) (-533.916) -- 0:00:07
881500 -- [-533.657] (-537.253) (-536.774) (-534.603) * (-535.543) (-535.983) (-533.673) [-536.930] -- 0:00:07
882000 -- [-532.789] (-535.213) (-535.379) (-536.290) * (-534.422) (-533.519) (-532.357) [-532.730] -- 0:00:07
882500 -- (-532.357) [-534.885] (-534.904) (-533.155) * [-533.173] (-533.946) (-533.199) (-535.155) -- 0:00:07
883000 -- (-532.823) [-531.951] (-532.579) (-532.268) * [-531.745] (-533.698) (-537.045) (-533.711) -- 0:00:07
883500 -- (-535.488) (-534.006) (-534.427) [-533.567] * (-533.688) (-534.295) (-534.469) [-532.339] -- 0:00:07
884000 -- (-533.293) [-531.913] (-536.349) (-533.406) * [-534.995] (-532.042) (-533.747) (-534.088) -- 0:00:07
884500 -- (-539.726) [-532.535] (-534.399) (-532.929) * [-534.093] (-533.590) (-535.967) (-535.053) -- 0:00:07
885000 -- (-532.859) (-532.772) [-533.558] (-532.648) * (-535.270) (-535.703) [-532.277] (-533.144) -- 0:00:07
Average standard deviation of split frequencies: 0.006881
885500 -- (-534.623) [-533.957] (-533.790) (-534.528) * (-534.181) [-534.575] (-534.095) (-534.686) -- 0:00:07
886000 -- (-534.330) (-532.259) (-533.890) [-532.042] * [-533.402] (-534.433) (-531.811) (-533.401) -- 0:00:07
886500 -- (-535.899) (-535.255) (-532.515) [-534.403] * (-537.501) (-533.449) (-534.154) [-534.204] -- 0:00:07
887000 -- (-537.082) (-535.920) (-538.043) [-534.543] * (-538.771) (-533.601) [-533.056] (-539.729) -- 0:00:07
887500 -- (-535.100) [-531.783] (-535.460) (-534.076) * (-534.626) (-533.205) [-535.684] (-533.461) -- 0:00:07
888000 -- (-534.726) [-533.234] (-539.621) (-535.225) * (-532.654) (-532.637) (-533.777) [-536.587] -- 0:00:07
888500 -- [-532.508] (-537.575) (-538.249) (-538.577) * (-533.131) [-533.450] (-534.208) (-533.937) -- 0:00:07
889000 -- [-534.201] (-536.596) (-531.776) (-533.568) * (-532.654) (-532.620) (-534.154) [-535.394] -- 0:00:06
889500 -- [-533.046] (-534.728) (-534.769) (-533.070) * (-532.389) (-533.389) [-536.452] (-533.463) -- 0:00:06
890000 -- (-533.054) (-532.824) (-536.082) [-536.693] * (-532.716) (-534.017) (-536.768) [-535.158] -- 0:00:06
Average standard deviation of split frequencies: 0.006669
890500 -- (-535.703) (-534.429) [-534.363] (-533.285) * (-532.885) (-533.717) (-533.064) [-534.405] -- 0:00:06
891000 -- (-532.651) [-537.188] (-533.512) (-535.036) * (-532.104) (-535.032) [-533.336] (-536.768) -- 0:00:06
891500 -- (-533.427) (-532.906) (-533.526) [-532.295] * (-535.851) (-535.057) [-533.843] (-534.666) -- 0:00:06
892000 -- [-532.051] (-532.528) (-534.169) (-532.773) * (-533.827) (-535.502) (-532.364) [-537.359] -- 0:00:06
892500 -- [-532.702] (-533.563) (-536.687) (-533.566) * (-534.923) (-534.664) [-532.448] (-534.810) -- 0:00:06
893000 -- (-536.555) (-533.578) (-535.572) [-532.701] * (-533.254) (-534.101) (-535.844) [-534.659] -- 0:00:06
893500 -- (-534.752) (-534.047) (-533.743) [-533.633] * [-540.181] (-535.267) (-533.710) (-534.346) -- 0:00:06
894000 -- [-532.750] (-532.375) (-531.964) (-532.229) * (-539.584) [-534.082] (-533.644) (-532.436) -- 0:00:06
894500 -- (-533.705) (-532.245) (-533.054) [-532.396] * (-532.889) (-533.295) [-531.933] (-532.572) -- 0:00:06
895000 -- (-532.567) (-532.298) (-533.313) [-531.906] * (-533.040) [-534.429] (-533.855) (-533.352) -- 0:00:06
Average standard deviation of split frequencies: 0.006629
895500 -- (-534.550) [-535.264] (-532.945) (-533.032) * (-538.342) (-534.660) (-532.894) [-534.060] -- 0:00:06
896000 -- (-532.255) (-534.973) (-531.806) [-531.984] * (-533.877) (-535.116) (-535.442) [-532.612] -- 0:00:06
896500 -- [-534.004] (-538.234) (-532.246) (-532.684) * [-535.111] (-534.846) (-535.672) (-531.963) -- 0:00:06
897000 -- (-535.850) (-533.927) (-537.573) [-532.236] * (-537.690) (-534.875) (-534.655) [-533.282] -- 0:00:06
897500 -- [-532.579] (-534.011) (-534.289) (-531.922) * (-538.895) (-534.278) (-535.267) [-532.692] -- 0:00:06
898000 -- [-532.442] (-534.055) (-533.641) (-532.275) * (-533.635) [-533.187] (-534.289) (-532.828) -- 0:00:06
898500 -- (-532.965) (-534.495) [-532.452] (-532.350) * (-544.293) [-533.095] (-533.199) (-531.991) -- 0:00:06
899000 -- [-531.737] (-532.879) (-532.001) (-532.386) * (-534.376) [-538.972] (-534.712) (-533.785) -- 0:00:06
899500 -- (-535.800) (-533.425) (-536.110) [-532.630] * (-532.240) (-538.499) (-533.999) [-533.242] -- 0:00:06
900000 -- [-536.341] (-534.253) (-535.267) (-532.083) * [-534.238] (-532.439) (-537.004) (-534.520) -- 0:00:06
Average standard deviation of split frequencies: 0.006490
900500 -- (-535.176) (-533.861) [-533.388] (-534.615) * (-532.752) (-532.569) (-537.487) [-533.232] -- 0:00:06
901000 -- (-532.990) (-535.073) [-535.482] (-533.564) * [-531.744] (-535.934) (-535.223) (-535.301) -- 0:00:06
901500 -- (-543.497) (-533.809) [-532.871] (-533.698) * [-531.822] (-542.761) (-536.981) (-539.433) -- 0:00:06
902000 -- (-532.817) (-535.238) [-533.892] (-532.082) * (-533.840) (-542.452) (-533.897) [-540.161] -- 0:00:06
902500 -- (-532.441) (-539.359) (-533.733) [-532.205] * (-531.484) (-534.952) (-533.356) [-540.747] -- 0:00:06
903000 -- (-534.272) (-536.830) [-534.566] (-536.984) * (-532.057) (-533.258) [-533.236] (-533.264) -- 0:00:06
903500 -- (-538.018) (-537.847) [-532.778] (-532.914) * (-537.681) [-532.687] (-531.989) (-532.820) -- 0:00:06
904000 -- [-535.230] (-533.215) (-532.904) (-535.894) * [-534.124] (-534.568) (-534.778) (-537.716) -- 0:00:06
904500 -- (-535.872) [-533.705] (-533.714) (-537.332) * (-535.582) (-533.106) (-533.609) [-533.560] -- 0:00:06
905000 -- (-533.142) (-533.426) (-533.813) [-538.595] * (-534.867) (-538.899) (-534.172) [-532.598] -- 0:00:05
Average standard deviation of split frequencies: 0.006140
905500 -- (-533.356) [-534.404] (-537.498) (-534.148) * (-533.333) [-534.947] (-532.618) (-533.180) -- 0:00:05
906000 -- (-536.255) (-534.602) (-535.958) [-532.376] * (-533.190) (-532.998) (-532.158) [-532.981] -- 0:00:05
906500 -- (-535.036) [-532.138] (-535.339) (-534.752) * (-534.436) [-536.114] (-532.141) (-534.607) -- 0:00:05
907000 -- [-532.138] (-535.059) (-533.056) (-532.714) * [-533.299] (-533.241) (-531.750) (-535.266) -- 0:00:05
907500 -- (-532.347) [-534.142] (-534.186) (-532.744) * [-533.705] (-532.986) (-531.850) (-534.141) -- 0:00:05
908000 -- (-533.867) (-531.925) [-533.988] (-532.106) * (-535.084) (-535.990) (-533.100) [-535.394] -- 0:00:05
908500 -- (-534.332) (-532.989) [-537.108] (-532.554) * (-536.929) [-531.521] (-533.562) (-532.352) -- 0:00:05
909000 -- [-536.957] (-533.295) (-534.945) (-532.657) * (-534.593) (-531.892) (-532.327) [-535.554] -- 0:00:05
909500 -- (-536.494) (-534.428) (-533.527) [-532.535] * (-536.446) (-535.562) (-534.035) [-533.814] -- 0:00:05
910000 -- [-534.787] (-532.202) (-534.205) (-534.335) * (-535.221) (-533.028) [-534.185] (-533.134) -- 0:00:05
Average standard deviation of split frequencies: 0.005798
910500 -- [-532.160] (-532.155) (-532.386) (-534.457) * (-534.926) (-532.626) (-533.482) [-534.218] -- 0:00:05
911000 -- (-532.420) (-532.644) [-532.730] (-532.872) * (-536.715) [-534.087] (-534.052) (-537.822) -- 0:00:05
911500 -- [-536.811] (-531.992) (-533.624) (-532.657) * [-534.356] (-535.028) (-533.422) (-532.048) -- 0:00:05
912000 -- (-536.084) [-534.365] (-540.189) (-534.649) * (-537.270) [-534.089] (-533.447) (-534.834) -- 0:00:05
912500 -- (-538.457) (-535.972) (-533.529) [-533.636] * (-533.343) (-537.525) [-532.675] (-535.113) -- 0:00:05
913000 -- [-533.959] (-533.916) (-532.861) (-531.731) * (-532.167) (-534.507) (-533.725) [-532.083] -- 0:00:05
913500 -- (-533.302) (-533.725) (-533.310) [-532.823] * (-533.848) [-532.247] (-532.513) (-533.064) -- 0:00:05
914000 -- (-534.334) (-533.186) [-535.294] (-534.262) * (-533.017) (-533.339) [-532.912] (-534.139) -- 0:00:05
914500 -- [-536.360] (-533.936) (-541.756) (-533.541) * [-533.026] (-535.086) (-532.017) (-534.095) -- 0:00:05
915000 -- (-533.609) [-534.154] (-532.542) (-535.057) * [-534.451] (-538.457) (-535.225) (-535.682) -- 0:00:05
Average standard deviation of split frequencies: 0.006107
915500 -- (-532.570) [-535.435] (-532.752) (-534.046) * (-533.805) [-533.646] (-535.424) (-534.302) -- 0:00:05
916000 -- (-533.106) (-535.430) [-533.734] (-534.127) * (-534.514) (-533.720) [-534.349] (-533.560) -- 0:00:05
916500 -- (-536.195) (-542.157) (-534.473) [-533.048] * (-533.119) [-536.605] (-537.904) (-534.408) -- 0:00:05
917000 -- (-534.357) (-533.525) (-536.200) [-533.726] * (-533.119) (-534.301) (-536.432) [-534.651] -- 0:00:05
917500 -- (-534.787) (-543.005) (-538.904) [-539.921] * (-535.052) (-536.186) [-537.054] (-534.299) -- 0:00:05
918000 -- [-537.439] (-534.298) (-538.765) (-533.331) * (-535.578) (-534.412) (-534.091) [-536.051] -- 0:00:05
918500 -- (-532.259) [-534.409] (-532.712) (-534.432) * [-534.314] (-535.430) (-533.891) (-536.353) -- 0:00:05
919000 -- (-535.317) (-532.507) [-532.261] (-535.359) * (-535.548) (-534.337) (-537.571) [-531.956] -- 0:00:05
919500 -- (-533.481) [-533.813] (-532.604) (-537.982) * [-533.237] (-532.409) (-536.044) (-533.972) -- 0:00:05
920000 -- (-533.281) (-532.766) [-531.723] (-534.035) * [-535.169] (-532.257) (-535.627) (-534.023) -- 0:00:05
Average standard deviation of split frequencies: 0.006144
920500 -- [-535.493] (-532.724) (-532.104) (-534.228) * [-534.691] (-533.905) (-532.258) (-535.334) -- 0:00:05
921000 -- (-533.995) (-536.478) [-533.713] (-532.215) * (-536.903) (-532.763) (-534.631) [-532.907] -- 0:00:04
921500 -- (-533.294) (-533.876) [-532.177] (-534.813) * [-536.071] (-533.947) (-534.416) (-533.351) -- 0:00:04
922000 -- (-533.238) [-534.053] (-540.026) (-533.691) * (-536.824) (-532.328) [-535.088] (-533.097) -- 0:00:04
922500 -- (-533.407) (-533.448) [-534.067] (-535.538) * [-534.615] (-533.183) (-534.305) (-532.156) -- 0:00:04
923000 -- (-536.369) (-533.577) (-532.530) [-534.169] * (-541.489) (-532.763) [-533.877] (-534.597) -- 0:00:04
923500 -- (-535.321) (-536.680) [-534.396] (-536.084) * (-541.536) [-536.847] (-531.718) (-534.891) -- 0:00:04
924000 -- (-531.975) (-532.980) [-533.811] (-533.843) * (-539.829) (-535.053) (-531.992) [-532.093] -- 0:00:04
924500 -- (-532.107) (-534.356) [-538.358] (-533.066) * [-534.465] (-536.585) (-532.907) (-534.703) -- 0:00:04
925000 -- [-532.425] (-534.209) (-534.578) (-537.579) * (-537.207) [-532.101] (-533.828) (-532.204) -- 0:00:04
Average standard deviation of split frequencies: 0.006109
925500 -- (-532.043) (-533.486) (-533.200) [-538.105] * (-538.660) (-536.250) (-533.502) [-532.258] -- 0:00:04
926000 -- (-535.063) [-532.939] (-532.812) (-534.168) * (-535.911) (-535.638) (-533.805) [-532.202] -- 0:00:04
926500 -- (-531.652) [-532.664] (-532.295) (-534.133) * [-532.212] (-537.289) (-532.926) (-532.123) -- 0:00:04
927000 -- [-533.943] (-531.923) (-534.976) (-535.113) * [-532.988] (-535.884) (-537.463) (-532.626) -- 0:00:04
927500 -- (-532.482) (-532.441) (-536.786) [-537.570] * (-535.555) [-533.426] (-537.738) (-532.446) -- 0:00:04
928000 -- (-531.978) (-536.093) [-532.274] (-533.058) * (-534.485) [-533.638] (-536.006) (-535.453) -- 0:00:04
928500 -- [-532.577] (-532.768) (-533.033) (-533.418) * [-533.186] (-532.888) (-533.625) (-538.253) -- 0:00:04
929000 -- (-534.342) (-534.251) [-533.535] (-533.130) * (-533.796) (-534.798) [-534.656] (-535.996) -- 0:00:04
929500 -- (-532.427) (-532.128) (-534.800) [-536.413] * (-533.757) (-535.186) [-536.228] (-532.344) -- 0:00:04
930000 -- (-532.155) [-533.636] (-531.922) (-535.113) * (-535.493) (-531.897) (-533.902) [-532.375] -- 0:00:04
Average standard deviation of split frequencies: 0.006450
930500 -- (-534.650) (-533.853) (-534.307) [-532.500] * (-534.628) (-531.638) (-533.659) [-533.016] -- 0:00:04
931000 -- (-535.596) (-534.998) [-533.058] (-534.862) * (-535.968) (-532.464) (-533.584) [-535.322] -- 0:00:04
931500 -- (-533.313) (-535.711) [-533.902] (-534.303) * (-534.351) (-531.543) (-533.942) [-533.833] -- 0:00:04
932000 -- (-532.937) [-532.902] (-535.419) (-534.190) * (-532.834) [-532.333] (-533.340) (-532.337) -- 0:00:04
932500 -- [-532.093] (-531.904) (-541.709) (-532.026) * [-533.794] (-532.964) (-532.747) (-535.199) -- 0:00:04
933000 -- (-532.335) (-534.060) [-534.447] (-532.578) * (-533.739) [-535.188] (-532.417) (-534.569) -- 0:00:04
933500 -- (-531.816) (-537.887) (-535.482) [-533.657] * (-533.658) (-535.253) (-533.544) [-532.907] -- 0:00:04
934000 -- (-533.585) (-534.316) (-534.950) [-532.212] * (-538.364) [-533.018] (-533.322) (-534.709) -- 0:00:04
934500 -- (-531.395) (-533.890) (-532.073) [-531.867] * (-532.398) [-532.338] (-533.489) (-533.495) -- 0:00:04
935000 -- [-533.170] (-532.304) (-533.025) (-532.807) * (-534.692) (-532.767) (-536.385) [-533.909] -- 0:00:04
Average standard deviation of split frequencies: 0.006950
935500 -- (-531.493) [-535.359] (-535.508) (-534.168) * (-534.052) (-534.028) [-534.484] (-532.611) -- 0:00:04
936000 -- (-534.057) [-533.862] (-540.976) (-533.164) * (-534.627) (-533.935) (-532.605) [-534.640] -- 0:00:04
936500 -- (-539.376) (-534.142) [-537.705] (-534.277) * (-532.721) [-536.691] (-535.446) (-536.591) -- 0:00:04
937000 -- [-536.884] (-532.807) (-536.125) (-533.472) * (-539.808) (-534.045) (-534.751) [-539.877] -- 0:00:03
937500 -- [-532.620] (-534.282) (-534.900) (-532.072) * (-537.957) [-532.038] (-531.818) (-538.431) -- 0:00:03
938000 -- (-531.729) (-536.427) [-534.989] (-532.203) * (-536.994) [-532.809] (-536.644) (-538.862) -- 0:00:03
938500 -- [-532.409] (-534.969) (-532.842) (-536.042) * [-533.439] (-533.004) (-537.320) (-534.845) -- 0:00:03
939000 -- (-533.772) (-534.451) [-533.153] (-539.611) * (-539.382) (-537.951) [-532.497] (-533.983) -- 0:00:03
939500 -- [-535.739] (-533.183) (-534.547) (-535.316) * [-537.662] (-539.437) (-533.691) (-532.770) -- 0:00:03
940000 -- (-534.670) (-536.202) (-533.381) [-534.051] * (-536.934) [-536.132] (-533.839) (-532.461) -- 0:00:03
Average standard deviation of split frequencies: 0.006715
940500 -- (-533.636) [-534.734] (-535.138) (-534.817) * (-536.006) [-536.295] (-534.096) (-533.076) -- 0:00:03
941000 -- (-533.625) (-536.041) (-532.994) [-534.876] * (-535.099) (-532.983) [-533.797] (-533.420) -- 0:00:03
941500 -- (-531.520) [-534.323] (-534.117) (-534.141) * [-535.993] (-532.872) (-534.347) (-536.889) -- 0:00:03
942000 -- [-535.105] (-539.535) (-537.562) (-533.531) * [-534.745] (-533.764) (-533.078) (-535.629) -- 0:00:03
942500 -- (-532.500) (-539.584) (-531.794) [-534.545] * [-533.067] (-534.276) (-539.974) (-532.209) -- 0:00:03
943000 -- (-532.750) (-536.161) [-531.556] (-535.183) * [-532.939] (-533.663) (-534.036) (-533.369) -- 0:00:03
943500 -- [-531.832] (-533.118) (-532.694) (-533.668) * (-531.887) (-535.813) (-534.598) [-532.946] -- 0:00:03
944000 -- (-537.005) (-535.283) [-532.790] (-539.351) * [-532.907] (-533.236) (-536.307) (-536.786) -- 0:00:03
944500 -- (-534.239) [-534.405] (-535.047) (-532.511) * [-532.381] (-532.286) (-532.651) (-532.896) -- 0:00:03
945000 -- (-532.720) (-533.703) (-533.455) [-531.594] * [-531.900] (-536.647) (-533.347) (-532.919) -- 0:00:03
Average standard deviation of split frequencies: 0.006777
945500 -- (-532.658) (-533.058) [-535.752] (-533.090) * [-532.948] (-538.228) (-534.525) (-534.235) -- 0:00:03
946000 -- (-535.866) [-531.658] (-533.293) (-533.438) * [-531.917] (-538.214) (-534.023) (-537.244) -- 0:00:03
946500 -- (-535.538) (-532.470) (-535.890) [-534.568] * (-531.844) (-535.955) (-533.210) [-537.056] -- 0:00:03
947000 -- (-532.680) [-532.311] (-533.205) (-535.558) * (-533.764) (-534.810) [-534.654] (-533.226) -- 0:00:03
947500 -- (-534.685) (-532.944) (-532.458) [-537.011] * [-531.960] (-535.944) (-532.701) (-533.768) -- 0:00:03
948000 -- (-535.498) (-534.167) (-532.858) [-537.172] * (-533.362) [-535.050] (-533.100) (-533.475) -- 0:00:03
948500 -- [-536.446] (-533.451) (-534.001) (-539.277) * (-533.730) [-533.938] (-537.244) (-534.804) -- 0:00:03
949000 -- [-533.515] (-535.875) (-533.452) (-536.251) * [-533.496] (-535.043) (-534.867) (-534.633) -- 0:00:03
949500 -- (-535.697) (-534.597) (-533.671) [-534.824] * [-536.984] (-536.850) (-532.817) (-532.939) -- 0:00:03
950000 -- (-535.132) (-534.342) (-532.926) [-532.176] * [-536.360] (-535.597) (-535.799) (-533.267) -- 0:00:03
Average standard deviation of split frequencies: 0.006314
950500 -- (-537.804) (-532.913) [-532.039] (-534.816) * (-532.975) (-534.486) (-537.036) [-532.837] -- 0:00:03
951000 -- (-533.043) (-535.588) [-536.192] (-534.141) * (-533.474) [-533.365] (-533.105) (-533.096) -- 0:00:03
951500 -- (-532.195) (-533.470) (-536.260) [-532.588] * [-535.002] (-532.172) (-533.683) (-532.796) -- 0:00:03
952000 -- (-532.660) (-531.803) (-534.052) [-534.151] * (-535.461) (-532.663) [-535.833] (-537.816) -- 0:00:03
952500 -- (-532.324) (-532.081) [-535.317] (-535.432) * (-532.674) (-532.801) (-535.316) [-534.569] -- 0:00:02
953000 -- (-535.506) (-532.717) (-536.171) [-537.516] * (-534.044) (-534.494) [-532.727] (-533.006) -- 0:00:02
953500 -- (-534.602) (-535.281) (-532.878) [-538.772] * (-535.828) (-535.373) (-539.071) [-532.034] -- 0:00:02
954000 -- (-533.283) (-537.524) (-533.113) [-536.429] * [-534.951] (-533.942) (-532.904) (-533.484) -- 0:00:02
954500 -- (-534.543) (-536.222) (-534.242) [-533.197] * (-534.215) (-533.382) [-532.151] (-534.217) -- 0:00:02
955000 -- (-536.287) (-532.104) (-532.850) [-531.677] * (-537.301) (-533.938) (-532.982) [-534.767] -- 0:00:02
Average standard deviation of split frequencies: 0.006016
955500 -- (-531.495) [-531.918] (-535.979) (-531.621) * [-533.254] (-532.217) (-534.591) (-532.844) -- 0:00:02
956000 -- [-536.786] (-533.886) (-534.534) (-531.630) * (-534.454) (-535.389) (-534.267) [-532.285] -- 0:00:02
956500 -- (-534.031) [-532.734] (-532.822) (-535.758) * [-535.967] (-533.396) (-532.231) (-532.854) -- 0:00:02
957000 -- (-533.088) (-532.360) (-532.907) [-531.708] * (-534.009) [-533.766] (-532.137) (-532.481) -- 0:00:02
957500 -- (-535.638) (-535.426) [-534.420] (-537.385) * [-535.595] (-532.357) (-541.324) (-535.963) -- 0:00:02
958000 -- (-533.414) (-533.588) (-533.033) [-534.145] * [-532.126] (-532.141) (-539.170) (-534.842) -- 0:00:02
958500 -- (-532.413) (-533.245) (-532.923) [-539.368] * (-532.259) (-535.272) (-541.439) [-533.629] -- 0:00:02
959000 -- (-532.089) (-536.857) [-535.357] (-543.379) * [-532.627] (-534.117) (-535.114) (-532.873) -- 0:00:02
959500 -- (-532.906) [-533.145] (-534.218) (-536.070) * (-532.471) [-532.592] (-533.663) (-534.887) -- 0:00:02
960000 -- [-536.192] (-535.418) (-532.746) (-533.626) * [-532.642] (-533.794) (-534.635) (-533.771) -- 0:00:02
Average standard deviation of split frequencies: 0.006085
960500 -- (-540.316) (-534.167) (-533.500) [-532.101] * (-533.643) (-537.710) (-534.364) [-533.016] -- 0:00:02
961000 -- (-537.849) (-534.180) (-540.526) [-533.252] * (-534.163) (-534.175) (-534.900) [-532.226] -- 0:00:02
961500 -- (-540.356) (-533.547) [-536.826] (-533.911) * (-533.270) (-536.011) [-532.373] (-531.926) -- 0:00:02
962000 -- [-536.884] (-532.500) (-533.485) (-533.633) * (-535.714) (-533.574) [-533.068] (-533.017) -- 0:00:02
962500 -- (-535.210) (-532.317) [-534.972] (-532.412) * [-533.749] (-532.130) (-533.511) (-531.565) -- 0:00:02
963000 -- (-533.988) [-532.042] (-536.606) (-538.564) * (-533.748) (-532.452) [-534.160] (-534.963) -- 0:00:02
963500 -- (-534.586) [-532.460] (-532.695) (-534.393) * [-536.125] (-534.596) (-541.620) (-533.066) -- 0:00:02
964000 -- (-537.132) [-532.165] (-533.989) (-532.899) * (-533.263) (-533.335) [-534.533] (-534.119) -- 0:00:02
964500 -- [-532.667] (-539.440) (-534.846) (-534.725) * (-537.609) (-532.993) (-533.747) [-532.198] -- 0:00:02
965000 -- (-533.684) [-535.733] (-534.433) (-533.215) * (-534.703) [-532.714] (-532.301) (-531.755) -- 0:00:02
Average standard deviation of split frequencies: 0.006214
965500 -- (-534.068) (-535.654) (-534.276) [-532.562] * (-537.534) (-531.927) (-534.246) [-532.535] -- 0:00:02
966000 -- [-533.792] (-532.752) (-531.648) (-534.373) * (-537.087) (-532.069) [-533.921] (-535.398) -- 0:00:02
966500 -- [-532.590] (-533.764) (-532.977) (-533.634) * (-537.793) (-536.330) [-533.920] (-534.099) -- 0:00:02
967000 -- (-535.693) (-534.320) [-532.667] (-532.481) * (-537.485) [-535.706] (-534.027) (-532.727) -- 0:00:02
967500 -- (-532.168) (-537.182) [-533.643] (-533.707) * (-537.999) (-535.292) [-533.666] (-533.803) -- 0:00:02
968000 -- (-532.351) (-536.399) [-537.571] (-533.586) * (-532.108) [-534.756] (-535.183) (-535.544) -- 0:00:02
968500 -- (-532.360) [-532.482] (-539.164) (-531.700) * (-534.594) (-533.960) [-533.025] (-533.389) -- 0:00:01
969000 -- (-532.273) [-535.136] (-538.881) (-533.876) * [-540.770] (-533.126) (-535.812) (-533.201) -- 0:00:01
969500 -- (-533.229) (-531.917) (-537.360) [-534.546] * (-532.853) [-534.782] (-532.366) (-537.575) -- 0:00:01
970000 -- (-532.124) [-531.712] (-538.020) (-532.342) * (-532.668) [-533.564] (-534.344) (-537.280) -- 0:00:01
Average standard deviation of split frequencies: 0.006346
970500 -- (-532.173) [-532.097] (-533.129) (-532.941) * (-534.943) [-533.258] (-533.615) (-534.608) -- 0:00:01
971000 -- [-532.859] (-532.257) (-533.716) (-535.620) * (-540.636) [-532.440] (-533.425) (-537.811) -- 0:00:01
971500 -- (-532.597) (-532.528) (-535.157) [-537.335] * (-536.965) (-533.346) [-533.251] (-535.340) -- 0:00:01
972000 -- (-535.972) [-533.871] (-535.673) (-537.513) * (-537.508) (-533.314) [-532.171] (-533.465) -- 0:00:01
972500 -- (-532.608) (-533.865) (-534.080) [-534.887] * (-535.466) [-534.174] (-531.515) (-532.817) -- 0:00:01
973000 -- [-533.736] (-535.376) (-532.378) (-534.612) * (-540.096) [-533.176] (-531.511) (-531.808) -- 0:00:01
973500 -- (-533.107) [-532.865] (-535.432) (-537.172) * [-533.214] (-533.451) (-533.234) (-532.455) -- 0:00:01
974000 -- (-533.478) [-536.312] (-534.775) (-533.323) * (-533.672) (-537.597) [-531.988] (-532.930) -- 0:00:01
974500 -- (-533.770) [-533.004] (-534.435) (-534.658) * (-536.227) (-536.273) (-533.243) [-532.364] -- 0:00:01
975000 -- (-535.441) (-532.216) (-534.295) [-536.221] * [-537.154] (-536.367) (-536.312) (-531.808) -- 0:00:01
Average standard deviation of split frequencies: 0.006376
975500 -- (-533.866) [-532.353] (-533.886) (-536.479) * (-533.612) [-535.931] (-534.173) (-532.166) -- 0:00:01
976000 -- (-533.222) (-532.824) [-533.319] (-533.847) * (-533.992) [-535.461] (-534.210) (-535.500) -- 0:00:01
976500 -- (-538.814) [-535.507] (-532.925) (-534.297) * (-532.258) (-533.992) [-536.076] (-536.088) -- 0:00:01
977000 -- (-535.451) (-539.757) (-532.250) [-532.598] * (-532.701) (-531.966) [-534.204] (-534.422) -- 0:00:01
977500 -- (-533.556) (-532.818) [-532.216] (-531.625) * (-535.171) [-532.108] (-535.085) (-537.476) -- 0:00:01
978000 -- (-534.396) [-532.852] (-532.515) (-532.419) * (-537.827) (-532.190) (-531.941) [-533.729] -- 0:00:01
978500 -- (-533.482) [-533.817] (-533.735) (-535.544) * (-534.806) [-531.901] (-533.404) (-533.868) -- 0:00:01
979000 -- (-535.140) (-534.341) [-534.905] (-537.434) * (-534.663) (-533.259) [-532.886] (-534.102) -- 0:00:01
979500 -- (-534.422) (-534.698) (-532.802) [-532.015] * (-533.638) (-532.968) [-532.969] (-533.196) -- 0:00:01
980000 -- (-532.506) (-532.987) [-534.124] (-532.552) * (-535.562) [-534.293] (-532.402) (-533.977) -- 0:00:01
Average standard deviation of split frequencies: 0.006121
980500 -- (-534.549) (-535.138) (-532.976) [-533.842] * (-532.892) (-533.150) [-535.136] (-534.813) -- 0:00:01
981000 -- (-534.753) (-534.435) (-534.646) [-534.836] * (-531.957) (-533.067) [-533.674] (-534.321) -- 0:00:01
981500 -- (-533.777) (-535.427) [-535.360] (-532.760) * (-532.568) (-532.052) [-534.748] (-533.159) -- 0:00:01
982000 -- [-532.704] (-532.129) (-535.442) (-536.876) * (-536.812) (-533.641) (-537.826) [-533.384] -- 0:00:01
982500 -- (-533.342) (-532.139) (-532.444) [-535.339] * [-533.827] (-534.770) (-535.179) (-535.659) -- 0:00:01
983000 -- (-532.819) [-532.241] (-531.742) (-532.485) * (-533.368) (-536.241) [-532.613] (-532.010) -- 0:00:01
983500 -- [-535.136] (-532.690) (-532.748) (-532.674) * (-533.655) (-534.460) (-534.982) [-534.358] -- 0:00:01
984000 -- (-535.400) [-534.943] (-534.013) (-533.937) * (-532.711) (-534.009) (-532.950) [-532.506] -- 0:00:01
984500 -- (-535.199) [-532.354] (-538.971) (-537.775) * (-532.533) (-536.104) (-532.243) [-535.058] -- 0:00:00
985000 -- (-534.821) (-533.261) [-532.887] (-533.904) * (-534.414) (-533.832) (-534.953) [-534.593] -- 0:00:00
Average standard deviation of split frequencies: 0.006407
985500 -- [-534.178] (-532.618) (-535.293) (-536.316) * (-533.118) (-532.646) [-534.783] (-535.887) -- 0:00:00
986000 -- (-534.504) (-534.800) (-536.441) [-532.933] * [-532.258] (-533.942) (-535.350) (-533.583) -- 0:00:00
986500 -- (-538.082) (-533.957) (-532.951) [-533.132] * (-531.872) (-534.362) (-534.450) [-533.585] -- 0:00:00
987000 -- (-534.922) [-534.447] (-532.085) (-532.851) * (-531.974) (-533.753) [-534.157] (-535.532) -- 0:00:00
987500 -- (-535.545) (-532.568) (-533.893) [-533.671] * [-531.974] (-533.154) (-534.795) (-534.471) -- 0:00:00
988000 -- [-538.631] (-536.074) (-534.163) (-534.907) * (-532.140) (-532.801) [-533.341] (-533.486) -- 0:00:00
988500 -- (-539.737) (-532.637) [-536.038] (-533.513) * (-532.889) (-533.711) [-532.698] (-535.795) -- 0:00:00
989000 -- (-532.258) [-534.401] (-532.472) (-532.601) * [-532.498] (-535.875) (-531.893) (-533.516) -- 0:00:00
989500 -- [-533.446] (-537.397) (-533.175) (-533.825) * (-534.426) [-532.913] (-533.117) (-532.967) -- 0:00:00
990000 -- (-533.993) (-532.765) [-534.704] (-534.684) * (-534.762) (-535.923) [-532.624] (-535.556) -- 0:00:00
Average standard deviation of split frequencies: 0.006662
990500 -- [-531.448] (-533.586) (-535.567) (-533.262) * [-533.302] (-534.972) (-533.119) (-534.288) -- 0:00:00
991000 -- (-534.249) [-535.083] (-536.942) (-533.359) * (-537.163) (-540.652) [-535.013] (-533.087) -- 0:00:00
991500 -- (-535.254) (-532.715) [-535.728] (-533.359) * (-539.797) (-534.993) (-534.135) [-533.307] -- 0:00:00
992000 -- (-535.777) (-533.756) (-533.389) [-533.198] * [-538.095] (-539.028) (-540.971) (-538.453) -- 0:00:00
992500 -- [-532.061] (-533.957) (-535.962) (-535.841) * (-534.853) [-536.559] (-537.377) (-532.660) -- 0:00:00
993000 -- (-533.187) (-535.468) [-534.897] (-535.673) * (-534.273) (-532.769) [-533.561] (-536.681) -- 0:00:00
993500 -- (-534.356) [-534.489] (-535.030) (-536.715) * (-534.095) (-535.370) [-534.253] (-535.653) -- 0:00:00
994000 -- (-535.716) [-533.376] (-535.911) (-537.609) * (-535.056) (-534.773) [-533.551] (-534.114) -- 0:00:00
994500 -- (-533.017) (-533.371) (-537.622) [-533.904] * [-536.314] (-534.715) (-534.309) (-534.950) -- 0:00:00
995000 -- (-534.315) (-534.746) [-531.630] (-539.290) * [-533.190] (-535.739) (-531.921) (-534.237) -- 0:00:00
Average standard deviation of split frequencies: 0.006784
995500 -- (-533.125) (-537.765) [-533.725] (-532.610) * [-533.079] (-532.044) (-534.067) (-533.850) -- 0:00:00
996000 -- (-532.146) (-532.530) (-533.680) [-533.024] * (-534.184) (-533.029) (-533.473) [-532.784] -- 0:00:00
996500 -- [-532.334] (-532.711) (-535.020) (-533.900) * (-537.014) [-532.342] (-533.361) (-532.082) -- 0:00:00
997000 -- (-533.156) (-534.140) [-532.153] (-531.622) * [-533.010] (-534.870) (-535.912) (-532.316) -- 0:00:00
997500 -- [-534.890] (-532.654) (-533.074) (-532.530) * [-535.791] (-538.696) (-533.260) (-532.785) -- 0:00:00
998000 -- (-531.711) (-536.149) (-540.347) [-532.271] * (-532.894) [-533.497] (-533.696) (-533.467) -- 0:00:00
998500 -- (-533.202) [-532.848] (-532.786) (-532.771) * (-534.299) (-533.845) (-536.653) [-534.382] -- 0:00:00
999000 -- (-532.833) [-534.909] (-533.066) (-534.983) * (-534.023) (-532.156) (-534.053) [-533.310] -- 0:00:00
999500 -- (-537.001) (-541.140) [-532.703] (-533.556) * [-533.955] (-535.714) (-533.481) (-533.066) -- 0:00:00
1000000 -- (-536.485) (-532.962) [-535.001] (-534.386) * [-532.672] (-535.670) (-537.526) (-534.329) -- 0:00:00
Average standard deviation of split frequencies: 0.006847
Analysis completed in 1 mins 3 seconds
Analysis used 61.96 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -531.37
Likelihood of best state for "cold" chain of run 2 was -531.38
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.8 % ( 63 %) Dirichlet(Revmat{all})
99.9 % ( 99 %) Slider(Revmat{all})
34.1 % ( 40 %) Dirichlet(Pi{all})
34.7 % ( 22 %) Slider(Pi{all})
78.7 % ( 49 %) Multiplier(Alpha{1,2})
77.9 % ( 52 %) Multiplier(Alpha{3})
24.7 % ( 22 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.6 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 91 %) ParsSPR(Tau{all},V{all})
28.2 % ( 22 %) Multiplier(V{all})
97.5 % ( 98 %) Nodeslider(V{all})
30.4 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.0 % ( 72 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
35.0 % ( 26 %) Dirichlet(Pi{all})
34.8 % ( 32 %) Slider(Pi{all})
78.7 % ( 65 %) Multiplier(Alpha{1,2})
77.9 % ( 48 %) Multiplier(Alpha{3})
25.9 % ( 24 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.1 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 87 %) ParsSPR(Tau{all},V{all})
28.2 % ( 30 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
30.2 % ( 29 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167029 0.82 0.67
3 | 166880 167407 0.84
4 | 165955 166407 166322
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166556 0.82 0.67
3 | 166456 165605 0.84
4 | 167082 166921 167380
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -533.15
| 1 1 |
| 2 1 |
| 1 1 2 1 1 |
| 2 2 * 1 22 |
|1 1 11 * 2 11 2 |
| 1* 2 * 2 1 11 1 2 1 |
| 2 21 1 2 1* 2 2 1 11 221 212|
| 21 2 1 1 2 22 1 2 22 2 1|
| 2 2 2 1 1 1 2 12 2 1 2 1 12 |
| * 2 12 1 1 2 1 2 |
| 2 2 1 2 2 12 |
| 11 1 2 2 2 |
|2 1 2 1 |
| 1 1 |
| 2 2 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -534.65
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -533.08 -537.23
2 -533.14 -536.21
--------------------------------------
TOTAL -533.11 -536.84
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890637 0.087046 0.346414 1.456484 0.857326 1330.55 1415.78 1.002
r(A<->C){all} 0.160190 0.021631 0.000015 0.455892 0.118878 158.98 172.83 1.005
r(A<->G){all} 0.174044 0.021294 0.000104 0.464696 0.138300 134.69 233.13 1.002
r(A<->T){all} 0.164650 0.019856 0.000068 0.453064 0.127073 125.82 139.23 1.000
r(C<->G){all} 0.169999 0.022380 0.000108 0.470889 0.124624 202.31 222.61 1.000
r(C<->T){all} 0.170193 0.020121 0.000015 0.457106 0.136268 86.98 96.64 1.001
r(G<->T){all} 0.160924 0.018495 0.000076 0.430477 0.125231 238.56 289.59 1.002
pi(A){all} 0.200522 0.000395 0.162896 0.239556 0.200186 981.98 1181.36 1.000
pi(C){all} 0.266610 0.000483 0.225301 0.311423 0.266179 1289.01 1296.62 1.000
pi(G){all} 0.332670 0.000557 0.286995 0.377635 0.332160 1326.63 1365.20 1.000
pi(T){all} 0.200198 0.000401 0.162755 0.241033 0.200020 940.06 1188.10 1.000
alpha{1,2} 0.408215 0.220875 0.000126 1.359506 0.242012 754.30 822.74 1.000
alpha{3} 0.463612 0.236763 0.000128 1.404857 0.300600 1387.67 1444.33 1.000
pinvar{all} 0.995865 0.000026 0.986891 0.999998 0.997475 1267.84 1354.03 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*.*.
8 -- .*...*
9 -- .****.
10 -- .*.*..
11 -- .***.*
12 -- ...*.*
13 -- ..*..*
14 -- ..****
15 -- .**...
16 -- .*..*.
17 -- ...**.
18 -- .*.***
19 -- .**.**
20 -- ..**..
21 -- ....**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 456 0.151899 0.009422 0.145237 0.158561 2
8 449 0.149567 0.008951 0.143238 0.155896 2
9 445 0.148235 0.005182 0.144570 0.151899 2
10 437 0.145570 0.008009 0.139907 0.151233 2
11 435 0.144903 0.000471 0.144570 0.145237 2
12 433 0.144237 0.008009 0.138574 0.149900 2
13 428 0.142572 0.000942 0.141905 0.143238 2
14 427 0.142239 0.017430 0.129913 0.154564 2
15 425 0.141572 0.008951 0.135243 0.147901 2
16 424 0.141239 0.000000 0.141239 0.141239 2
17 423 0.140906 0.008951 0.134577 0.147235 2
18 423 0.140906 0.007066 0.135909 0.145903 2
19 411 0.136909 0.016488 0.125250 0.148568 2
20 408 0.135909 0.002827 0.133911 0.137908 2
21 390 0.129913 0.000000 0.129913 0.129913 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100722 0.009750 0.000043 0.293532 0.072249 1.001 2
length{all}[2] 0.094450 0.009021 0.000014 0.284937 0.066157 1.000 2
length{all}[3] 0.100757 0.010008 0.000004 0.302396 0.069592 1.000 2
length{all}[4] 0.096875 0.009336 0.000001 0.284591 0.067122 1.000 2
length{all}[5] 0.099440 0.009449 0.000004 0.296229 0.070280 1.000 2
length{all}[6] 0.099571 0.010438 0.000036 0.307517 0.065595 1.000 2
length{all}[7] 0.103366 0.009633 0.000384 0.288881 0.072082 1.000 2
length{all}[8] 0.103782 0.010358 0.000080 0.295066 0.076595 1.000 2
length{all}[9] 0.101180 0.010353 0.000026 0.302197 0.075056 1.000 2
length{all}[10] 0.092892 0.007708 0.000436 0.261870 0.067792 0.998 2
length{all}[11] 0.092297 0.008177 0.000377 0.254487 0.065234 1.001 2
length{all}[12] 0.099960 0.009688 0.000234 0.288827 0.068635 1.003 2
length{all}[13] 0.099335 0.009058 0.000751 0.286808 0.073986 1.002 2
length{all}[14] 0.099555 0.009139 0.000189 0.288639 0.070398 0.998 2
length{all}[15] 0.100729 0.010014 0.000825 0.308428 0.067035 1.004 2
length{all}[16] 0.110105 0.011112 0.000143 0.332524 0.076608 0.998 2
length{all}[17] 0.100221 0.009275 0.000618 0.278548 0.071356 0.998 2
length{all}[18] 0.096088 0.010116 0.000531 0.285825 0.063621 0.999 2
length{all}[19] 0.104953 0.009912 0.000032 0.322724 0.077615 1.006 2
length{all}[20] 0.098299 0.010406 0.000432 0.303694 0.062287 1.000 2
length{all}[21] 0.101186 0.010904 0.000236 0.314526 0.068618 1.003 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006847
Maximum standard deviation of split frequencies = 0.017430
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.006
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------ C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------- C4 (4)
|
|---------------------------------------------------------------------- C5 (5)
|
\----------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 390
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 44 patterns at 130 / 130 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 44 patterns at 130 / 130 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
42944 bytes for conP
3872 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.049806 0.072184 0.082242 0.058281 0.107542 0.030908 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -565.032181
Iterating by ming2
Initial: fx= 565.032181
x= 0.04981 0.07218 0.08224 0.05828 0.10754 0.03091 0.30000 1.30000
1 h-m-p 0.0000 0.0002 310.3561 +++ 541.628867 m 0.0002 14 | 1/8
2 h-m-p 0.0021 0.0119 32.6145 ------------.. | 1/8
3 h-m-p 0.0000 0.0001 284.5638 ++ 529.567879 m 0.0001 46 | 2/8
4 h-m-p 0.0016 0.0200 24.1501 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 255.1291 ++ 525.217672 m 0.0001 77 | 3/8
6 h-m-p 0.0008 0.0303 18.7578 -----------.. | 3/8
7 h-m-p 0.0000 0.0001 220.9967 ++ 519.846042 m 0.0001 108 | 4/8
8 h-m-p 0.0014 0.0455 14.1133 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 180.6552 ++ 517.245312 m 0.0001 139 | 5/8
10 h-m-p 0.0011 0.0797 9.3876 -----------.. | 5/8
11 h-m-p 0.0000 0.0002 127.6793 +++ 513.957046 m 0.0002 171 | 6/8
12 h-m-p 0.9327 8.0000 0.0000 ++ 513.957046 m 8.0000 182 | 6/8
13 h-m-p 0.0160 8.0000 0.0035 -----Y 513.957046 0 0.0000 200 | 6/8
14 h-m-p 0.0160 8.0000 0.0000 ----N 513.957046 0 0.0000 217 | 6/8
15 h-m-p 0.0160 8.0000 0.0000 --N 513.957046 0 0.0001 232
Out..
lnL = -513.957046
233 lfun, 233 eigenQcodon, 1398 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.070914 0.011887 0.042772 0.054410 0.052755 0.026040 0.299946 0.800275 0.235158
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 14.239655
np = 9
lnL0 = -545.624249
Iterating by ming2
Initial: fx= 545.624249
x= 0.07091 0.01189 0.04277 0.05441 0.05275 0.02604 0.29995 0.80028 0.23516
1 h-m-p 0.0000 0.0001 290.5331 ++ 537.160269 m 0.0001 14 | 1/9
2 h-m-p 0.0001 0.0004 171.9241 ++ 528.365006 m 0.0004 26 | 2/9
3 h-m-p 0.0000 0.0001 375.9722 ++ 520.567291 m 0.0001 38 | 3/9
4 h-m-p 0.0001 0.0005 127.4234 ++ 516.506230 m 0.0005 50 | 4/9
5 h-m-p 0.0000 0.0000 57317.1329 ++ 516.064978 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 6205.6037 ++ 514.236151 m 0.0000 74 | 6/9
7 h-m-p 0.0024 0.0311 7.6598 ------------.. | 6/9
8 h-m-p 0.0000 0.0000 125.3929 ++ 513.956986 m 0.0000 108 | 7/9
9 h-m-p 1.6000 8.0000 0.0000 ++ 513.956986 m 8.0000 120 | 7/9
10 h-m-p 0.0428 8.0000 0.0000 -Y 513.956986 0 0.0020 135 | 7/9
11 h-m-p 0.0160 8.0000 0.0000 +++++ 513.956986 m 8.0000 152 | 7/9
12 h-m-p 0.0006 0.2772 1.0745 -------C 513.956986 0 0.0000 173 | 7/9
13 h-m-p 0.0661 8.0000 0.0000 ++++ 513.956986 m 8.0000 187 | 7/9
14 h-m-p 0.0160 8.0000 0.0007 +++++ 513.956985 m 8.0000 204 | 7/9
15 h-m-p 0.0185 4.0625 0.2877 -----------Y 513.956985 0 0.0000 229 | 7/9
16 h-m-p 0.0160 8.0000 0.0002 +++++ 513.956984 m 8.0000 246 | 7/9
17 h-m-p 0.0085 4.2633 0.3019 -----------Y 513.956984 0 0.0000 271 | 7/9
18 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/9
19 h-m-p 0.0160 8.0000 0.0002 +++++ 513.956984 m 8.0000 313 | 7/9
20 h-m-p 0.0073 3.6304 0.2397 -----------C 513.956984 0 0.0000 338 | 7/9
21 h-m-p 0.0160 8.0000 0.0020 +++++ 513.956981 m 8.0000 355 | 7/9
22 h-m-p 0.0675 3.3977 0.2415 -----------Y 513.956981 0 0.0000 380 | 7/9
23 h-m-p 0.0160 8.0000 0.0005 +++++ 513.956980 m 8.0000 397 | 7/9
24 h-m-p 0.0164 3.5650 0.2309 ----------C 513.956980 0 0.0000 421 | 7/9
25 h-m-p 0.0160 8.0000 0.0004 +++++ 513.956979 m 8.0000 438 | 7/9
26 h-m-p 0.0140 3.6169 0.2286 ----------Y 513.956979 0 0.0000 462 | 7/9
27 h-m-p 0.0160 8.0000 0.0001 ------N 513.956979 0 0.0000 482 | 7/9
28 h-m-p 0.0160 8.0000 0.0000 +++++ 513.956979 m 8.0000 499 | 7/9
29 h-m-p 0.0072 3.6220 0.2277 ---------Y 513.956979 0 0.0000 522 | 7/9
30 h-m-p 0.0160 8.0000 0.0003 +++++ 513.956979 m 8.0000 539 | 7/9
31 h-m-p 0.0102 3.5605 0.2326 ---------Y 513.956979 0 0.0000 562 | 7/9
32 h-m-p 0.0160 8.0000 0.0009 +++++ 513.956977 m 8.0000 579 | 7/9
33 h-m-p 0.0318 3.6008 0.2319 ------------Y 513.956977 0 0.0000 605 | 7/9
34 h-m-p 0.0160 8.0000 0.0001 --------N 513.956977 0 0.0000 627 | 7/9
35 h-m-p 0.0160 8.0000 0.0000 ---------N 513.956977 0 0.0000 650
Out..
lnL = -513.956977
651 lfun, 1953 eigenQcodon, 7812 P(t)
Time used: 0:03
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.057503 0.080300 0.081754 0.059457 0.039727 0.043705 0.263541 1.479464 0.534546 0.215601 1.342713
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.491247
np = 11
lnL0 = -557.129252
Iterating by ming2
Initial: fx= 557.129252
x= 0.05750 0.08030 0.08175 0.05946 0.03973 0.04370 0.26354 1.47946 0.53455 0.21560 1.34271
1 h-m-p 0.0000 0.0004 273.9394 +++ 529.502129 m 0.0004 17 | 1/11
2 h-m-p 0.0000 0.0002 122.6191 ++ 526.988871 m 0.0002 31 | 2/11
3 h-m-p 0.0000 0.0000 20891.9294 ++ 519.974254 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0000 4275.2776 ++ 519.223791 m 0.0000 59 | 4/11
5 h-m-p 0.0000 0.0000 89486.1200 ++ 516.369087 m 0.0000 73 | 5/11
6 h-m-p 0.0048 0.0578 5.3184 ------------.. | 5/11
7 h-m-p 0.0000 0.0001 176.2355 ++ 514.129432 m 0.0001 111 | 6/11
8 h-m-p 0.0028 0.0979 3.1443 ------------.. | 6/11
9 h-m-p 0.0000 0.0000 126.6500 ++ 513.957012 m 0.0000 149 | 7/11
10 h-m-p 0.0326 8.0000 0.0000 -----Y 513.957012 0 0.0000 168 | 7/11
11 h-m-p 0.0160 8.0000 0.0000 -----Y 513.957012 0 0.0000 191
Out..
lnL = -513.957012
192 lfun, 768 eigenQcodon, 3456 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -513.966047 S = -513.955352 -0.004092
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 44 patterns 0:04
did 20 / 44 patterns 0:04
did 30 / 44 patterns 0:04
did 40 / 44 patterns 0:04
did 44 / 44 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.082843 0.079596 0.024924 0.023790 0.089410 0.078834 0.238007 0.937951 1.526442
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 14.862960
np = 9
lnL0 = -559.994759
Iterating by ming2
Initial: fx= 559.994759
x= 0.08284 0.07960 0.02492 0.02379 0.08941 0.07883 0.23801 0.93795 1.52644
1 h-m-p 0.0000 0.0002 285.7190 +++ 543.260154 m 0.0002 15 | 1/9
2 h-m-p 0.0002 0.0008 39.2243 ++ 542.437843 m 0.0008 27 | 2/9
3 h-m-p 0.0001 0.0011 305.5348 ++ 538.203949 m 0.0011 39 | 3/9
4 h-m-p 0.0000 0.0000 18514.0831 ++ 526.831723 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0001 704.9104 ++ 525.709775 m 0.0001 63 | 5/9
6 h-m-p 0.0000 0.0001 48.9623 ++ 524.767377 m 0.0001 75 | 6/9
7 h-m-p 0.0002 0.0041 18.0932 +++ 519.889484 m 0.0041 88 | 7/9
8 h-m-p 0.0296 8.0000 0.9318 --------------.. | 7/9
9 h-m-p 0.0000 0.0004 114.5455 +++ 513.956866 m 0.0004 127 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 C 513.956866 0 1.6000 139 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 N 513.956866 0 1.6000 152
Out..
lnL = -513.956866
153 lfun, 1683 eigenQcodon, 9180 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.089689 0.067297 0.073088 0.037594 0.102889 0.076825 0.000100 0.900000 0.619578 1.864657 1.299890
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 17.596885
np = 11
lnL0 = -564.676831
Iterating by ming2
Initial: fx= 564.676831
x= 0.08969 0.06730 0.07309 0.03759 0.10289 0.07683 0.00011 0.90000 0.61958 1.86466 1.29989
1 h-m-p 0.0000 0.0000 252.9869 ++ 564.590371 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0012 172.2834 ++++ 540.025444 m 0.0012 32 | 2/11
3 h-m-p 0.0000 0.0001 1270.4033 ++ 522.871573 m 0.0001 46 | 3/11
4 h-m-p 0.0010 0.0050 26.4709 ++ 520.231542 m 0.0050 60 | 4/11
5 h-m-p 0.0000 0.0000 3940.6612 ++ 519.027631 m 0.0000 74 | 5/11
6 h-m-p 0.0000 0.0000 174891981.9986 ++ 515.949508 m 0.0000 88 | 6/11
7 h-m-p 0.0000 0.0000 4537.1469 ++ 513.956980 m 0.0000 102 | 7/11
8 h-m-p 1.6000 8.0000 0.0002 ++ 513.956980 m 8.0000 116 | 7/11
9 h-m-p 0.0131 6.5733 0.2383 -----------Y 513.956980 0 0.0000 145 | 7/11
10 h-m-p 0.0160 8.0000 0.0008 +++++ 513.956979 m 8.0000 166 | 7/11
11 h-m-p 0.0340 6.1948 0.1844 -----------C 513.956979 0 0.0000 195 | 7/11
12 h-m-p 0.0160 8.0000 0.0005 +++++ 513.956977 m 8.0000 216 | 7/11
13 h-m-p 0.0194 3.1679 0.1896 -------------.. | 7/11
14 h-m-p 0.0160 8.0000 0.0003 +++++ 513.956977 m 8.0000 266 | 7/11
15 h-m-p 0.0171 5.6263 0.1558 -------------.. | 7/11
16 h-m-p 0.0160 8.0000 0.0003 +++++ 513.956976 m 8.0000 316 | 7/11
17 h-m-p 0.0175 5.6891 0.1545 -------------.. | 7/11
18 h-m-p 0.0160 8.0000 0.0003 +++++ 513.956975 m 8.0000 366 | 7/11
19 h-m-p 0.0180 5.7594 0.1531 -------------.. | 7/11
20 h-m-p 0.0160 8.0000 0.0004 +++++ 513.956974 m 8.0000 416 | 7/11
21 h-m-p 0.0185 5.8325 0.1517 ------------Y 513.956974 0 0.0000 446 | 7/11
22 h-m-p 0.0160 8.0000 0.0006 +++++ 513.956973 m 8.0000 467 | 7/11
23 h-m-p 0.0191 6.0648 0.2345 -----------N 513.956973 0 0.0000 496 | 7/11
24 h-m-p 0.0160 8.0000 0.0012 +++++ 513.956970 m 8.0000 517 | 7/11
25 h-m-p 0.0395 7.4506 0.2507 ------------C 513.956970 0 0.0000 547 | 7/11
26 h-m-p 0.0160 8.0000 0.0002 +++++ 513.956970 m 8.0000 568 | 7/11
27 h-m-p 0.0035 1.3640 0.4344 ------------.. | 7/11
28 h-m-p 0.0160 8.0000 0.0004 +++++ 513.956969 m 8.0000 617 | 7/11
29 h-m-p 0.0209 6.1292 0.1462 ------------C 513.956969 0 0.0000 647 | 7/11
30 h-m-p 0.0160 8.0000 0.0014 +++++ 513.956965 m 8.0000 668 | 7/11
31 h-m-p 0.0595 0.8549 0.1831 --------------.. | 7/11
32 h-m-p 0.0160 8.0000 0.0004 +++++ 513.956964 m 8.0000 719 | 7/11
33 h-m-p 0.0238 6.5072 0.1399 -----------Y 513.956964 0 0.0000 748 | 7/11
34 h-m-p 0.0160 8.0000 0.0063 +++++ 513.956938 m 8.0000 769 | 7/11
35 h-m-p 0.3019 6.2508 0.1676 -------------C 513.956938 0 0.0000 800 | 7/11
36 h-m-p 0.0037 1.8523 0.0132 +++++ 513.956924 m 1.8523 821 | 8/11
37 h-m-p 0.1790 8.0000 0.1154 -------------C 513.956924 0 0.0000 852 | 8/11
38 h-m-p 0.0025 1.2311 0.0463 +++++ 513.956866 m 1.2311 872 | 9/11
39 h-m-p 1.6000 8.0000 0.0000 Y 513.956866 0 1.6000 889 | 9/11
40 h-m-p 0.0583 8.0000 0.0000 Y 513.956866 0 0.0146 905 | 9/11
41 h-m-p 0.0160 8.0000 3.9571 -------C 513.956866 0 0.0000 928 | 9/11
42 h-m-p 0.9046 8.0000 0.0000 N 513.956866 0 0.4523 942 | 9/11
43 h-m-p 1.6000 8.0000 0.0000 N 513.956866 0 0.4000 958
Out..
lnL = -513.956866
959 lfun, 11508 eigenQcodon, 63294 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -513.995494 S = -513.957466 -0.016803
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 44 patterns 0:22
did 20 / 44 patterns 0:22
did 30 / 44 patterns 0:23
did 40 / 44 patterns 0:23
did 44 / 44 patterns 0:23
Time used: 0:23
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=130
NC_011896_1_WP_010908939_1_2693_MLBR_RS12800 VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
NC_002677_1_NP_302620_1_1492_ML2518 VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
NZ_LVXE01000003_1_WP_010908939_1_1353_A3216_RS02445 VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
NZ_LYPH01000044_1_WP_010908939_1_1709_A8144_RS08145 VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
NZ_CP029543_1_WP_010908939_1_2723_DIJ64_RS13870 VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
NZ_AP014567_1_WP_010908939_1_2789_JK2ML_RS14200 VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE
**************************************************
NC_011896_1_WP_010908939_1_2693_MLBR_RS12800 DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
NC_002677_1_NP_302620_1_1492_ML2518 DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
NZ_LVXE01000003_1_WP_010908939_1_1353_A3216_RS02445 DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
NZ_LYPH01000044_1_WP_010908939_1_1709_A8144_RS08145 DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
NZ_CP029543_1_WP_010908939_1_2723_DIJ64_RS13870 DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
NZ_AP014567_1_WP_010908939_1_2789_JK2ML_RS14200 DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN
**************************************************
NC_011896_1_WP_010908939_1_2693_MLBR_RS12800 NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
NC_002677_1_NP_302620_1_1492_ML2518 NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
NZ_LVXE01000003_1_WP_010908939_1_1353_A3216_RS02445 NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
NZ_LYPH01000044_1_WP_010908939_1_1709_A8144_RS08145 NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
NZ_CP029543_1_WP_010908939_1_2723_DIJ64_RS13870 NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
NZ_AP014567_1_WP_010908939_1_2789_JK2ML_RS14200 NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
******************************
>NC_011896_1_WP_010908939_1_2693_MLBR_RS12800 GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG >NC_002677_1_NP_302620_1_1492_ML2518 GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG >NZ_LVXE01000003_1_WP_010908939_1_1353_A3216_RS02445 GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG >NZ_LYPH01000044_1_WP_010908939_1_1709_A8144_RS08145 GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG >NZ_CP029543_1_WP_010908939_1_2723_DIJ64_RS13870 GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG >NZ_AP014567_1_WP_010908939_1_2789_JK2ML_RS14200 GTGGGCGAGTACAGTGCATTCGGATTTGATCCCGACGATTTCGATCGACT GATCAAGGAGGGTAGTGAGGGACTGCGCGACGCCTTTGAGCGGATCAGCC GATTTGTCGGTGGCCCAGGTGTTCGGACAGCATGGTCGGCGATCTTCGAG GACTTGTCACGGCGTGCACGTCCCGCGCAGGAAACCGCCGATGAGGCCGG TGACGGTGTGTGGGCCATCTACACCGTGACCGGCGACGGCGCCGCTCGGG TCGAACAGGTTTATGCAACCGAACTCGATGCTCTGCGGGCGAACAAGAAC AACGTTGATCCGAAGCGCAAAGTGCGCTTTTTGCCGTACGGCATCGCGGT CAGTGTGCTCGACTCTCACCAAGAGTCGACGCAACAGTTG
>NC_011896_1_WP_010908939_1_2693_MLBR_RS12800 VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN NVDPKRKVRFLPYGIAVSVLDSHQESTQQL >NC_002677_1_NP_302620_1_1492_ML2518 VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN NVDPKRKVRFLPYGIAVSVLDSHQESTQQL >NZ_LVXE01000003_1_WP_010908939_1_1353_A3216_RS02445 VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN NVDPKRKVRFLPYGIAVSVLDSHQESTQQL >NZ_LYPH01000044_1_WP_010908939_1_1709_A8144_RS08145 VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN NVDPKRKVRFLPYGIAVSVLDSHQESTQQL >NZ_CP029543_1_WP_010908939_1_2723_DIJ64_RS13870 VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN NVDPKRKVRFLPYGIAVSVLDSHQESTQQL >NZ_AP014567_1_WP_010908939_1_2789_JK2ML_RS14200 VGEYSAFGFDPDDFDRLIKEGSEGLRDAFERISRFVGGPGVRTAWSAIFE DLSRRARPAQETADEAGDGVWAIYTVTGDGAARVEQVYATELDALRANKN NVDPKRKVRFLPYGIAVSVLDSHQESTQQL
#NEXUS
[ID: 5137492014]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908939_1_2693_MLBR_RS12800
NC_002677_1_NP_302620_1_1492_ML2518
NZ_LVXE01000003_1_WP_010908939_1_1353_A3216_RS02445
NZ_LYPH01000044_1_WP_010908939_1_1709_A8144_RS08145
NZ_CP029543_1_WP_010908939_1_2723_DIJ64_RS13870
NZ_AP014567_1_WP_010908939_1_2789_JK2ML_RS14200
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908939_1_2693_MLBR_RS12800,
2 NC_002677_1_NP_302620_1_1492_ML2518,
3 NZ_LVXE01000003_1_WP_010908939_1_1353_A3216_RS02445,
4 NZ_LYPH01000044_1_WP_010908939_1_1709_A8144_RS08145,
5 NZ_CP029543_1_WP_010908939_1_2723_DIJ64_RS13870,
6 NZ_AP014567_1_WP_010908939_1_2789_JK2ML_RS14200
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07224911,2:0.06615651,3:0.0695923,4:0.06712193,5:0.0702803,6:0.06559467);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07224911,2:0.06615651,3:0.0695923,4:0.06712193,5:0.0702803,6:0.06559467);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -533.08 -537.23
2 -533.14 -536.21
--------------------------------------
TOTAL -533.11 -536.84
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2518/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890637 0.087046 0.346414 1.456484 0.857326 1330.55 1415.78 1.002
r(A<->C){all} 0.160190 0.021631 0.000015 0.455892 0.118878 158.98 172.83 1.005
r(A<->G){all} 0.174044 0.021294 0.000104 0.464696 0.138300 134.69 233.13 1.002
r(A<->T){all} 0.164650 0.019856 0.000068 0.453064 0.127073 125.82 139.23 1.000
r(C<->G){all} 0.169999 0.022380 0.000108 0.470889 0.124624 202.31 222.61 1.000
r(C<->T){all} 0.170193 0.020121 0.000015 0.457106 0.136268 86.98 96.64 1.001
r(G<->T){all} 0.160924 0.018495 0.000076 0.430477 0.125231 238.56 289.59 1.002
pi(A){all} 0.200522 0.000395 0.162896 0.239556 0.200186 981.98 1181.36 1.000
pi(C){all} 0.266610 0.000483 0.225301 0.311423 0.266179 1289.01 1296.62 1.000
pi(G){all} 0.332670 0.000557 0.286995 0.377635 0.332160 1326.63 1365.20 1.000
pi(T){all} 0.200198 0.000401 0.162755 0.241033 0.200020 940.06 1188.10 1.000
alpha{1,2} 0.408215 0.220875 0.000126 1.359506 0.242012 754.30 822.74 1.000
alpha{3} 0.463612 0.236763 0.000128 1.404857 0.300600 1387.67 1444.33 1.000
pinvar{all} 0.995865 0.000026 0.986891 0.999998 0.997475 1267.84 1354.03 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2518/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 130
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 4 4 4 4 4 4 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 0 0 0 0 0 0 | TAC 3 3 3 3 3 3 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 2 2 2 2 2 2
CTC 2 2 2 2 2 2 | CCC 2 2 2 2 2 2 | CAC 1 1 1 1 1 1 | CGC 3 3 3 3 3 3
CTA 0 0 0 0 0 0 | CCA 1 1 1 1 1 1 | Gln CAA 2 2 2 2 2 2 | CGA 2 2 2 2 2 2
CTG 3 3 3 3 3 3 | CCG 2 2 2 2 2 2 | CAG 3 3 3 3 3 3 | CGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 0 0 0 0 0 0 | Asn AAT 0 0 0 0 0 0 | Ser AGT 3 3 3 3 3 3
ATC 5 5 5 5 5 5 | ACC 4 4 4 4 4 4 | AAC 3 3 3 3 3 3 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 0 0 0 0 0 0 | ACG 1 1 1 1 1 1 | AAG 3 3 3 3 3 3 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 2 2 2 2 2 2 | Asp GAT 6 6 6 6 6 6 | Gly GGT 5 5 5 5 5 5
GTC 3 3 3 3 3 3 | GCC 5 5 5 5 5 5 | GAC 6 6 6 6 6 6 | GGC 5 5 5 5 5 5
GTA 0 0 0 0 0 0 | GCA 4 4 4 4 4 4 | Glu GAA 3 3 3 3 3 3 | GGA 2 2 2 2 2 2
GTG 5 5 5 5 5 5 | GCG 4 4 4 4 4 4 | GAG 7 7 7 7 7 7 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908939_1_2693_MLBR_RS12800
position 1: T:0.15385 C:0.21538 A:0.16923 G:0.46154
position 2: T:0.23846 C:0.23077 A:0.30000 G:0.23077
position 3: T:0.20769 C:0.35385 A:0.13077 G:0.30769
Average T:0.20000 C:0.26667 A:0.20000 G:0.33333
#2: NC_002677_1_NP_302620_1_1492_ML2518
position 1: T:0.15385 C:0.21538 A:0.16923 G:0.46154
position 2: T:0.23846 C:0.23077 A:0.30000 G:0.23077
position 3: T:0.20769 C:0.35385 A:0.13077 G:0.30769
Average T:0.20000 C:0.26667 A:0.20000 G:0.33333
#3: NZ_LVXE01000003_1_WP_010908939_1_1353_A3216_RS02445
position 1: T:0.15385 C:0.21538 A:0.16923 G:0.46154
position 2: T:0.23846 C:0.23077 A:0.30000 G:0.23077
position 3: T:0.20769 C:0.35385 A:0.13077 G:0.30769
Average T:0.20000 C:0.26667 A:0.20000 G:0.33333
#4: NZ_LYPH01000044_1_WP_010908939_1_1709_A8144_RS08145
position 1: T:0.15385 C:0.21538 A:0.16923 G:0.46154
position 2: T:0.23846 C:0.23077 A:0.30000 G:0.23077
position 3: T:0.20769 C:0.35385 A:0.13077 G:0.30769
Average T:0.20000 C:0.26667 A:0.20000 G:0.33333
#5: NZ_CP029543_1_WP_010908939_1_2723_DIJ64_RS13870
position 1: T:0.15385 C:0.21538 A:0.16923 G:0.46154
position 2: T:0.23846 C:0.23077 A:0.30000 G:0.23077
position 3: T:0.20769 C:0.35385 A:0.13077 G:0.30769
Average T:0.20000 C:0.26667 A:0.20000 G:0.33333
#6: NZ_AP014567_1_WP_010908939_1_2789_JK2ML_RS14200
position 1: T:0.15385 C:0.21538 A:0.16923 G:0.46154
position 2: T:0.23846 C:0.23077 A:0.30000 G:0.23077
position 3: T:0.20769 C:0.35385 A:0.13077 G:0.30769
Average T:0.20000 C:0.26667 A:0.20000 G:0.33333
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 24 | Ser S TCT 6 | Tyr Y TAT 6 | Cys C TGT 0
TTC 18 | TCC 0 | TAC 18 | TGC 0
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 12 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 0 | His H CAT 0 | Arg R CGT 12
CTC 12 | CCC 12 | CAC 6 | CGC 18
CTA 0 | CCA 6 | Gln Q CAA 12 | CGA 12
CTG 18 | CCG 12 | CAG 18 | CGG 30
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 0 | Asn N AAT 0 | Ser S AGT 18
ATC 30 | ACC 24 | AAC 18 | AGC 6
ATA 0 | ACA 6 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 0 | ACG 6 | AAG 18 | AGG 0
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 12 | Asp D GAT 36 | Gly G GGT 30
GTC 18 | GCC 30 | GAC 36 | GGC 30
GTA 0 | GCA 24 | Glu E GAA 18 | GGA 12
GTG 30 | GCG 24 | GAG 42 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15385 C:0.21538 A:0.16923 G:0.46154
position 2: T:0.23846 C:0.23077 A:0.30000 G:0.23077
position 3: T:0.20769 C:0.35385 A:0.13077 G:0.30769
Average T:0.20000 C:0.26667 A:0.20000 G:0.33333
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -513.957046 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299946 1.299890
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908939_1_2693_MLBR_RS12800: 0.000004, NC_002677_1_NP_302620_1_1492_ML2518: 0.000004, NZ_LVXE01000003_1_WP_010908939_1_1353_A3216_RS02445: 0.000004, NZ_LYPH01000044_1_WP_010908939_1_1709_A8144_RS08145: 0.000004, NZ_CP029543_1_WP_010908939_1_2723_DIJ64_RS13870: 0.000004, NZ_AP014567_1_WP_010908939_1_2789_JK2ML_RS14200: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29995
omega (dN/dS) = 1.29989
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 303.4 86.6 1.2999 0.0000 0.0000 0.0 0.0
7..2 0.000 303.4 86.6 1.2999 0.0000 0.0000 0.0 0.0
7..3 0.000 303.4 86.6 1.2999 0.0000 0.0000 0.0 0.0
7..4 0.000 303.4 86.6 1.2999 0.0000 0.0000 0.0 0.0
7..5 0.000 303.4 86.6 1.2999 0.0000 0.0000 0.0 0.0
7..6 0.000 303.4 86.6 1.2999 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -513.956977 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.263541 0.834354 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908939_1_2693_MLBR_RS12800: 0.000004, NC_002677_1_NP_302620_1_1492_ML2518: 0.000004, NZ_LVXE01000003_1_WP_010908939_1_1353_A3216_RS02445: 0.000004, NZ_LYPH01000044_1_WP_010908939_1_1709_A8144_RS08145: 0.000004, NZ_CP029543_1_WP_010908939_1_2723_DIJ64_RS13870: 0.000004, NZ_AP014567_1_WP_010908939_1_2789_JK2ML_RS14200: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.26354
MLEs of dN/dS (w) for site classes (K=2)
p: 0.83435 0.16565
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 304.1 85.9 0.1656 0.0000 0.0000 0.0 0.0
7..2 0.000 304.1 85.9 0.1656 0.0000 0.0000 0.0 0.0
7..3 0.000 304.1 85.9 0.1656 0.0000 0.0000 0.0 0.0
7..4 0.000 304.1 85.9 0.1656 0.0000 0.0000 0.0 0.0
7..5 0.000 304.1 85.9 0.1656 0.0000 0.0000 0.0 0.0
7..6 0.000 304.1 85.9 0.1656 0.0000 0.0000 0.0 0.0
Time used: 0:03
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -513.957012 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.238007 0.623779 0.236006 0.000001 1.378114
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908939_1_2693_MLBR_RS12800: 0.000004, NC_002677_1_NP_302620_1_1492_ML2518: 0.000004, NZ_LVXE01000003_1_WP_010908939_1_1353_A3216_RS02445: 0.000004, NZ_LYPH01000044_1_WP_010908939_1_1709_A8144_RS08145: 0.000004, NZ_CP029543_1_WP_010908939_1_2723_DIJ64_RS13870: 0.000004, NZ_AP014567_1_WP_010908939_1_2789_JK2ML_RS14200: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.23801
MLEs of dN/dS (w) for site classes (K=3)
p: 0.62378 0.23601 0.14021
w: 0.00000 1.00000 1.37811
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 304.6 85.4 0.4292 0.0000 0.0000 0.0 0.0
7..2 0.000 304.6 85.4 0.4292 0.0000 0.0000 0.0 0.0
7..3 0.000 304.6 85.4 0.4292 0.0000 0.0000 0.0 0.0
7..4 0.000 304.6 85.4 0.4292 0.0000 0.0000 0.0 0.0
7..5 0.000 304.6 85.4 0.4292 0.0000 0.0000 0.0 0.0
7..6 0.000 304.6 85.4 0.4292 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908939_1_2693_MLBR_RS12800)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908939_1_2693_MLBR_RS12800)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -513.956866 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.566102
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908939_1_2693_MLBR_RS12800: 0.000004, NC_002677_1_NP_302620_1_1492_ML2518: 0.000004, NZ_LVXE01000003_1_WP_010908939_1_1353_A3216_RS02445: 0.000004, NZ_LYPH01000044_1_WP_010908939_1_1709_A8144_RS08145: 0.000004, NZ_CP029543_1_WP_010908939_1_2723_DIJ64_RS13870: 0.000004, NZ_AP014567_1_WP_010908939_1_2789_JK2ML_RS14200: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.56610
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 309.7 80.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 309.7 80.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 309.7 80.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 309.7 80.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 309.7 80.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 309.7 80.3 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -513.956866 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 2.009352 1.660711
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908939_1_2693_MLBR_RS12800: 0.000004, NC_002677_1_NP_302620_1_1492_ML2518: 0.000004, NZ_LVXE01000003_1_WP_010908939_1_1353_A3216_RS02445: 0.000004, NZ_LYPH01000044_1_WP_010908939_1_1709_A8144_RS08145: 0.000004, NZ_CP029543_1_WP_010908939_1_2723_DIJ64_RS13870: 0.000004, NZ_AP014567_1_WP_010908939_1_2789_JK2ML_RS14200: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 2.00935
(p1 = 0.00001) w = 1.66071
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.66071
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 309.7 80.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 309.7 80.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 309.7 80.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 309.7 80.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 309.7 80.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 309.7 80.3 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908939_1_2693_MLBR_RS12800)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.097 0.098 0.098 0.099 0.100 0.100 0.101 0.102 0.102 0.103
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.103 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.097
Time used: 0:23
Model 1: NearlyNeutral -513.956977 Model 2: PositiveSelection -513.957012 Model 0: one-ratio -513.957046 Model 7: beta -513.956866 Model 8: beta&w>1 -513.956866 Model 0 vs 1 1.3799999987895717E-4 Model 2 vs 1 6.999999982326699E-5 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
