--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:25:50 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2532/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -404.69 -408.39
2 -404.73 -407.70
--------------------------------------
TOTAL -404.71 -408.10
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897493 0.086567 0.379119 1.483864 0.875017 1501.00 1501.00 1.001
r(A<->C){all} 0.155185 0.018628 0.000107 0.441153 0.118870 105.13 195.16 1.000
r(A<->G){all} 0.154076 0.017788 0.000028 0.422187 0.119865 306.01 319.93 1.008
r(A<->T){all} 0.178374 0.021757 0.000127 0.468992 0.141893 207.03 245.14 1.005
r(C<->G){all} 0.160619 0.017722 0.000022 0.424132 0.129587 149.01 204.64 1.000
r(C<->T){all} 0.178724 0.022177 0.000149 0.485512 0.140349 247.84 270.82 1.011
r(G<->T){all} 0.173021 0.021971 0.000110 0.473227 0.133214 180.29 196.82 1.002
pi(A){all} 0.194281 0.000532 0.145992 0.234832 0.193589 1242.35 1371.67 1.000
pi(C){all} 0.271482 0.000639 0.218495 0.319639 0.270461 1315.84 1329.91 1.000
pi(G){all} 0.309079 0.000731 0.254783 0.357894 0.308441 1259.51 1287.48 1.000
pi(T){all} 0.225159 0.000581 0.180114 0.273871 0.223979 1062.96 1196.19 1.000
alpha{1,2} 0.418977 0.238859 0.000103 1.390746 0.252686 1102.44 1256.52 1.000
alpha{3} 0.441686 0.219337 0.000123 1.365005 0.280295 1313.54 1407.27 1.000
pinvar{all} 0.994494 0.000043 0.982160 0.999992 0.996684 1174.35 1256.24 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -373.789878
Model 2: PositiveSelection -373.789769
Model 0: one-ratio -373.789958
Model 7: beta -373.789967
Model 8: beta&w>1 -373.789761
Model 0 vs 1 1.6000000005078618E-4
Model 2 vs 1 2.180000000180371E-4
Model 8 vs 7 4.1199999998298154E-4
>C1
VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
>C2
VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
>C3
VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
>C4
VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
>C5
VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
>C6
VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=98
C1 VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
C2 VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
C3 VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
C4 VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
C5 VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
C6 VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
**************************************************
C1 FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
C2 FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
C3 FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
C4 FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
C5 FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
C6 FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
************************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 98 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 98 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2940]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2940]--->[2940]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.453 Mb, Max= 30.622 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
C2 VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
C3 VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
C4 VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
C5 VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
C6 VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
**************************************************
C1 FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
C2 FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
C3 FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
C4 FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
C5 FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
C6 FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
************************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC
C2 GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC
C3 GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC
C4 GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC
C5 GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC
C6 GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC
**************************************************
C1 GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT
C2 GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT
C3 GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT
C4 GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT
C5 GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT
C6 GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT
**************************************************
C1 GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA
C2 GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA
C3 GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA
C4 GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA
C5 GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA
C6 GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA
**************************************************
C1 TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC
C2 TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC
C3 TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC
C4 TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC
C5 TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC
C6 TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC
**************************************************
C1 TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG
C2 TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG
C3 TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG
C4 TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG
C5 TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG
C6 TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG
**************************************************
C1 TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG
C2 TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG
C3 TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG
C4 TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG
C5 TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG
C6 TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG
********************************************
>C1
GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC
GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT
GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA
TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC
TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG
TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG
>C2
GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC
GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT
GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA
TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC
TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG
TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG
>C3
GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC
GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT
GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA
TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC
TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG
TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG
>C4
GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC
GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT
GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA
TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC
TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG
TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG
>C5
GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC
GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT
GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA
TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC
TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG
TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG
>C6
GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC
GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT
GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA
TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC
TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG
TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG
>C1
VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
>C2
VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
>C3
VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
>C4
VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
>C5
VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
>C6
VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 294 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579857869
Setting output file names to "/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1719118634
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5610351917
Seed = 1651087126
Swapseed = 1579857869
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -657.986094 -- -24.965149
Chain 2 -- -657.986094 -- -24.965149
Chain 3 -- -657.986094 -- -24.965149
Chain 4 -- -657.986094 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -657.986094 -- -24.965149
Chain 2 -- -657.986094 -- -24.965149
Chain 3 -- -657.986094 -- -24.965149
Chain 4 -- -657.986094 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-657.986] (-657.986) (-657.986) (-657.986) * [-657.986] (-657.986) (-657.986) (-657.986)
500 -- (-415.968) (-420.152) (-418.112) [-412.081] * (-423.003) (-418.764) (-416.169) [-413.220] -- 0:00:00
1000 -- (-414.477) (-416.477) (-418.319) [-409.100] * [-415.598] (-416.567) (-409.121) (-413.065) -- 0:00:00
1500 -- [-409.074] (-415.709) (-415.746) (-418.322) * (-415.720) (-411.826) [-415.595] (-412.272) -- 0:00:00
2000 -- (-417.912) (-417.805) [-418.826] (-410.282) * (-414.524) (-416.674) (-420.311) [-418.090] -- 0:00:00
2500 -- (-410.392) [-413.306] (-417.653) (-411.890) * (-416.865) (-413.359) (-417.936) [-413.177] -- 0:00:00
3000 -- (-414.839) [-411.350] (-415.005) (-413.064) * (-408.840) [-410.515] (-410.771) (-416.072) -- 0:00:00
3500 -- (-419.586) (-418.146) [-411.316] (-410.990) * (-417.642) [-423.240] (-410.097) (-422.407) -- 0:00:00
4000 -- (-419.987) [-413.138] (-416.380) (-422.466) * (-412.005) (-409.384) (-418.841) [-410.634] -- 0:00:00
4500 -- (-421.280) (-417.044) [-412.258] (-418.021) * [-415.851] (-416.001) (-416.848) (-411.669) -- 0:00:00
5000 -- (-413.321) (-413.516) [-416.468] (-411.144) * [-418.087] (-414.750) (-419.981) (-414.105) -- 0:00:00
Average standard deviation of split frequencies: 0.114280
5500 -- [-410.500] (-412.017) (-417.894) (-418.365) * (-417.363) (-415.595) [-413.648] (-408.512) -- 0:00:00
6000 -- [-404.942] (-414.899) (-420.245) (-434.836) * (-413.801) [-411.614] (-420.516) (-418.828) -- 0:00:00
6500 -- (-405.869) (-416.049) (-424.965) [-413.874] * (-410.924) [-410.368] (-412.715) (-417.200) -- 0:02:32
7000 -- (-404.372) [-415.305] (-422.630) (-416.759) * (-420.436) [-418.057] (-415.243) (-414.851) -- 0:02:21
7500 -- [-405.392] (-417.928) (-423.215) (-420.210) * (-418.353) (-414.843) [-414.320] (-414.072) -- 0:02:12
8000 -- (-403.450) (-418.974) [-411.362] (-416.379) * (-411.433) (-419.022) [-414.480] (-418.030) -- 0:02:04
8500 -- (-405.556) [-405.169] (-413.618) (-411.636) * (-417.510) [-412.750] (-415.675) (-417.315) -- 0:01:56
9000 -- (-405.233) (-405.217) (-421.675) [-413.960] * [-408.842] (-410.257) (-412.999) (-414.691) -- 0:01:50
9500 -- (-404.334) (-404.479) [-415.816] (-416.646) * (-418.405) (-414.958) (-415.657) [-410.426] -- 0:01:44
10000 -- (-407.629) [-405.254] (-415.599) (-413.553) * (-415.956) (-415.738) [-417.044] (-413.592) -- 0:01:39
Average standard deviation of split frequencies: 0.068300
10500 -- [-405.567] (-405.603) (-416.920) (-411.605) * (-415.339) (-419.710) (-413.886) [-410.271] -- 0:01:34
11000 -- (-405.268) [-407.191] (-411.209) (-417.986) * (-420.501) (-413.645) [-411.113] (-415.995) -- 0:01:29
11500 -- (-405.152) [-405.065] (-414.138) (-413.358) * (-424.197) (-423.602) (-415.919) [-419.140] -- 0:01:25
12000 -- (-408.481) (-406.598) (-411.902) [-408.227] * (-420.386) (-418.200) (-419.598) [-417.718] -- 0:01:22
12500 -- [-408.370] (-405.335) (-411.776) (-419.148) * (-414.463) [-411.312] (-407.316) (-423.618) -- 0:01:19
13000 -- (-404.956) (-404.204) (-414.570) [-410.236] * (-415.622) (-411.894) [-407.262] (-405.889) -- 0:01:15
13500 -- (-404.454) [-405.708] (-412.389) (-424.597) * (-419.237) (-422.550) (-404.740) [-406.557] -- 0:01:13
14000 -- (-404.526) [-413.628] (-422.584) (-413.119) * (-414.484) (-403.571) (-406.095) [-403.722] -- 0:01:10
14500 -- (-404.742) (-412.335) (-413.923) [-412.149] * (-414.515) (-403.701) (-404.303) [-404.612] -- 0:01:07
15000 -- (-407.396) (-406.800) [-411.770] (-408.854) * (-411.609) [-403.757] (-404.463) (-407.727) -- 0:01:05
Average standard deviation of split frequencies: 0.058926
15500 -- (-404.328) [-406.500] (-416.432) (-412.542) * (-419.278) [-406.472] (-405.817) (-404.883) -- 0:01:03
16000 -- (-407.689) (-406.194) (-417.097) [-409.911] * (-425.576) (-406.031) (-407.039) [-404.013] -- 0:01:01
16500 -- (-405.580) [-406.168] (-411.918) (-419.479) * (-412.731) (-405.385) [-406.295] (-404.172) -- 0:00:59
17000 -- [-404.451] (-404.397) (-418.368) (-418.888) * (-405.754) [-403.884] (-408.901) (-408.814) -- 0:00:57
17500 -- (-407.974) (-405.310) (-413.532) [-414.816] * [-406.704] (-405.555) (-407.368) (-404.930) -- 0:00:56
18000 -- (-404.370) (-405.133) (-415.294) [-415.415] * (-408.255) (-405.895) [-404.942] (-405.301) -- 0:00:54
18500 -- (-405.088) (-404.417) (-412.260) [-406.503] * (-405.472) (-406.036) [-407.650] (-405.026) -- 0:00:53
19000 -- [-405.017] (-405.856) (-418.814) (-417.390) * [-404.252] (-405.787) (-404.528) (-405.614) -- 0:00:51
19500 -- (-407.894) [-405.780] (-415.083) (-412.880) * (-404.309) (-407.432) (-412.293) [-405.195] -- 0:00:50
20000 -- (-407.276) [-406.374] (-416.725) (-416.925) * [-404.090] (-404.153) (-407.658) (-406.827) -- 0:01:38
Average standard deviation of split frequencies: 0.051322
20500 -- (-405.440) [-406.356] (-413.435) (-417.770) * (-404.427) [-405.248] (-404.686) (-408.173) -- 0:01:35
21000 -- (-405.762) [-407.964] (-412.292) (-413.218) * (-405.400) [-405.976] (-403.875) (-407.428) -- 0:01:33
21500 -- (-407.430) [-407.351] (-404.218) (-421.841) * (-406.204) (-403.950) [-407.334] (-407.368) -- 0:01:31
22000 -- (-406.854) (-408.882) (-404.304) [-408.396] * [-404.100] (-404.654) (-404.523) (-405.437) -- 0:01:28
22500 -- (-405.268) (-407.066) [-405.614] (-416.601) * (-403.515) (-406.880) (-405.884) [-407.224] -- 0:01:26
23000 -- (-404.467) [-405.677] (-404.231) (-417.502) * (-404.829) (-409.611) (-405.169) [-406.553] -- 0:01:24
23500 -- (-403.234) [-406.072] (-406.358) (-422.232) * [-404.945] (-406.807) (-403.600) (-408.563) -- 0:01:23
24000 -- (-404.309) (-406.824) [-403.194] (-422.780) * (-406.971) [-405.182] (-403.817) (-405.056) -- 0:01:21
24500 -- (-404.629) (-405.808) (-403.545) [-404.313] * (-403.927) (-407.626) [-404.871] (-405.501) -- 0:01:19
25000 -- (-405.222) [-408.303] (-403.649) (-405.750) * (-406.658) (-410.242) [-404.535] (-404.027) -- 0:01:18
Average standard deviation of split frequencies: 0.038627
25500 -- (-409.783) (-408.577) (-403.111) [-405.408] * (-406.672) [-406.879] (-404.061) (-405.047) -- 0:01:16
26000 -- [-406.765] (-409.087) (-404.498) (-405.075) * (-408.117) (-404.945) (-408.293) [-404.415] -- 0:01:14
26500 -- [-406.450] (-406.137) (-407.916) (-408.023) * (-407.486) [-405.113] (-403.862) (-404.034) -- 0:01:13
27000 -- (-406.611) (-406.299) [-405.523] (-408.279) * (-406.944) (-404.901) (-407.243) [-406.486] -- 0:01:12
27500 -- (-404.588) (-404.143) [-407.244] (-405.915) * (-403.451) (-406.575) [-407.467] (-404.900) -- 0:01:10
28000 -- [-406.146] (-404.921) (-403.670) (-406.370) * [-403.157] (-408.364) (-404.622) (-406.306) -- 0:01:09
28500 -- (-406.799) (-403.716) (-405.303) [-404.270] * [-403.226] (-406.311) (-404.708) (-408.898) -- 0:01:08
29000 -- (-406.556) [-404.252] (-403.854) (-410.681) * [-405.005] (-403.786) (-403.691) (-405.229) -- 0:01:06
29500 -- (-408.357) [-405.381] (-406.356) (-406.643) * (-405.145) (-404.961) [-404.855] (-404.620) -- 0:01:05
30000 -- (-405.320) [-404.565] (-404.482) (-403.446) * (-404.774) (-407.506) [-403.746] (-406.297) -- 0:01:04
Average standard deviation of split frequencies: 0.037332
30500 -- (-407.601) (-405.844) [-405.461] (-410.372) * (-404.812) (-409.134) [-408.904] (-406.515) -- 0:01:03
31000 -- (-407.011) (-405.384) (-404.508) [-406.012] * (-404.858) (-408.526) (-406.362) [-403.591] -- 0:01:02
31500 -- (-406.237) (-406.715) (-407.556) [-408.251] * [-403.831] (-407.129) (-409.896) (-403.801) -- 0:01:01
32000 -- (-403.998) (-406.524) [-407.887] (-406.256) * (-404.894) (-405.386) (-408.991) [-406.254] -- 0:01:00
32500 -- (-406.462) (-410.885) [-405.120] (-405.832) * (-405.171) (-405.700) (-406.862) [-407.387] -- 0:00:59
33000 -- (-406.536) (-410.137) (-405.112) [-403.520] * (-405.250) (-403.341) (-405.826) [-405.950] -- 0:00:58
33500 -- (-404.289) [-407.272] (-405.844) (-404.393) * (-404.405) [-405.232] (-404.779) (-406.059) -- 0:00:57
34000 -- [-404.245] (-406.580) (-404.041) (-405.145) * (-404.439) (-408.145) (-408.028) [-405.399] -- 0:01:25
34500 -- (-406.312) (-407.465) [-407.166] (-407.928) * [-404.173] (-406.285) (-411.274) (-404.320) -- 0:01:23
35000 -- (-405.407) [-404.278] (-405.148) (-406.299) * (-403.951) (-405.909) (-405.997) [-404.871] -- 0:01:22
Average standard deviation of split frequencies: 0.038660
35500 -- (-405.169) (-403.887) [-406.126] (-404.425) * [-403.466] (-407.465) (-403.673) (-408.218) -- 0:01:21
36000 -- (-406.530) (-408.172) [-405.682] (-404.430) * (-408.208) [-404.612] (-409.594) (-404.734) -- 0:01:20
36500 -- [-404.547] (-411.801) (-405.582) (-404.283) * (-410.074) (-404.733) [-403.039] (-407.025) -- 0:01:19
37000 -- (-405.575) (-404.364) (-405.382) [-404.494] * [-407.231] (-405.962) (-405.742) (-405.123) -- 0:01:18
37500 -- (-404.353) [-405.136] (-404.991) (-404.170) * (-404.923) (-404.818) [-405.721] (-405.808) -- 0:01:17
38000 -- (-404.215) (-405.291) (-405.095) [-404.462] * (-403.984) (-405.266) (-405.189) [-405.688] -- 0:01:15
38500 -- (-405.853) [-405.128] (-409.068) (-407.294) * (-406.523) (-404.490) (-406.069) [-403.941] -- 0:01:14
39000 -- (-404.202) [-405.355] (-409.216) (-407.531) * (-405.006) [-408.009] (-405.666) (-405.047) -- 0:01:13
39500 -- (-405.584) (-405.375) (-404.681) [-406.910] * [-403.529] (-406.717) (-408.608) (-404.222) -- 0:01:12
40000 -- (-404.151) (-404.596) [-405.707] (-405.598) * (-404.379) [-407.496] (-408.236) (-404.929) -- 0:01:12
Average standard deviation of split frequencies: 0.041216
40500 -- [-407.462] (-409.041) (-405.499) (-404.744) * (-405.753) (-407.134) [-404.283] (-408.517) -- 0:01:11
41000 -- (-403.647) (-405.224) [-405.805] (-405.003) * (-406.191) (-406.679) [-403.702] (-409.345) -- 0:01:10
41500 -- [-403.781] (-405.313) (-405.646) (-405.930) * (-406.834) (-406.765) (-407.035) [-405.781] -- 0:01:09
42000 -- (-407.694) (-406.102) [-405.716] (-406.672) * [-403.976] (-404.031) (-403.760) (-404.602) -- 0:01:08
42500 -- (-405.001) [-405.861] (-406.624) (-405.452) * (-404.851) (-404.145) (-407.718) [-404.049] -- 0:01:07
43000 -- (-404.267) (-403.517) (-407.465) [-404.112] * (-406.906) (-408.120) [-406.038] (-404.501) -- 0:01:06
43500 -- (-404.118) (-405.656) [-410.791] (-406.716) * [-404.252] (-407.725) (-411.565) (-407.552) -- 0:01:05
44000 -- (-404.916) [-404.790] (-404.327) (-408.178) * [-404.445] (-403.735) (-407.460) (-404.570) -- 0:01:05
44500 -- (-405.568) (-405.748) [-405.199] (-405.296) * [-405.571] (-406.845) (-404.269) (-405.109) -- 0:01:04
45000 -- (-403.801) (-403.276) [-404.121] (-406.093) * [-408.054] (-404.954) (-405.295) (-404.701) -- 0:01:03
Average standard deviation of split frequencies: 0.034843
45500 -- (-403.976) (-403.626) [-403.420] (-404.781) * [-406.009] (-404.790) (-404.821) (-403.810) -- 0:01:02
46000 -- (-403.951) [-405.328] (-404.451) (-404.107) * (-405.403) (-404.197) [-404.981] (-405.580) -- 0:01:02
46500 -- (-405.601) (-405.844) (-403.670) [-404.986] * (-404.274) (-408.770) [-405.003] (-405.219) -- 0:01:01
47000 -- (-403.928) [-403.813] (-404.893) (-407.192) * [-409.132] (-406.613) (-405.812) (-406.052) -- 0:01:00
47500 -- (-404.959) (-404.446) (-405.869) [-407.604] * (-405.960) [-406.039] (-405.622) (-404.166) -- 0:01:00
48000 -- (-408.398) [-404.941] (-406.176) (-408.078) * (-405.010) [-403.276] (-405.063) (-404.891) -- 0:00:59
48500 -- (-406.114) (-404.162) (-407.827) [-404.889] * [-404.720] (-403.824) (-404.401) (-407.757) -- 0:00:58
49000 -- [-406.604] (-406.149) (-405.220) (-406.771) * (-405.383) [-405.739] (-403.797) (-407.461) -- 0:00:58
49500 -- (-404.718) (-410.341) [-403.984] (-404.545) * (-404.995) [-405.161] (-406.592) (-404.630) -- 0:00:57
50000 -- (-403.878) (-405.164) [-406.411] (-404.931) * [-404.964] (-406.911) (-407.494) (-408.385) -- 0:01:16
Average standard deviation of split frequencies: 0.035149
50500 -- (-403.385) (-404.630) (-406.783) [-404.509] * (-408.648) [-403.607] (-409.682) (-404.613) -- 0:01:15
51000 -- (-406.420) (-406.312) (-405.469) [-405.335] * (-406.349) [-404.277] (-409.156) (-407.005) -- 0:01:14
51500 -- (-408.387) (-408.368) [-403.807] (-408.715) * (-406.707) (-407.279) [-405.426] (-404.619) -- 0:01:13
52000 -- (-405.960) (-403.899) [-403.866] (-405.245) * (-406.028) [-404.086] (-406.024) (-404.444) -- 0:01:12
52500 -- (-403.426) (-406.559) [-407.383] (-406.909) * (-404.328) [-406.835] (-408.541) (-404.864) -- 0:01:12
53000 -- (-404.839) [-407.085] (-404.357) (-407.370) * (-405.337) [-407.143] (-409.069) (-403.812) -- 0:01:11
53500 -- (-406.908) (-406.102) (-405.162) [-404.247] * (-405.244) (-406.405) [-409.263] (-403.756) -- 0:01:10
54000 -- (-405.019) [-404.181] (-409.421) (-405.330) * (-403.645) [-405.433] (-409.437) (-406.775) -- 0:01:10
54500 -- (-406.426) [-404.448] (-406.761) (-405.608) * [-403.513] (-411.243) (-409.379) (-406.888) -- 0:01:09
55000 -- (-408.566) (-406.691) [-406.894] (-405.978) * [-406.660] (-407.200) (-404.883) (-407.327) -- 0:01:08
Average standard deviation of split frequencies: 0.035887
55500 -- (-405.504) (-404.022) [-405.198] (-408.327) * (-404.212) [-405.817] (-406.076) (-406.322) -- 0:01:08
56000 -- (-405.204) (-404.843) [-405.727] (-404.464) * (-405.277) (-404.442) (-404.732) [-404.711] -- 0:01:07
56500 -- (-405.137) (-403.712) (-406.232) [-405.371] * (-407.305) (-406.642) (-406.177) [-405.224] -- 0:01:06
57000 -- (-403.549) (-407.950) [-407.021] (-408.296) * (-405.156) [-407.798] (-404.844) (-406.402) -- 0:01:06
57500 -- (-404.642) (-404.450) [-406.694] (-404.844) * (-403.748) [-403.477] (-405.922) (-404.982) -- 0:01:05
58000 -- (-405.307) (-405.174) [-406.430] (-406.100) * (-409.038) (-404.385) (-407.188) [-407.974] -- 0:01:04
58500 -- [-405.482] (-407.932) (-405.455) (-405.115) * [-404.786] (-405.493) (-407.865) (-405.561) -- 0:01:04
59000 -- (-403.953) (-405.414) [-404.741] (-404.618) * (-405.326) (-406.215) (-408.157) [-405.090] -- 0:01:03
59500 -- [-404.672] (-411.339) (-404.568) (-416.585) * (-403.689) [-406.317] (-411.719) (-404.113) -- 0:01:03
60000 -- [-404.010] (-406.917) (-407.546) (-412.623) * (-404.040) (-406.754) [-407.482] (-404.071) -- 0:01:02
Average standard deviation of split frequencies: 0.027810
60500 -- [-406.427] (-404.890) (-404.122) (-406.235) * [-407.306] (-403.903) (-404.200) (-404.139) -- 0:01:02
61000 -- [-406.625] (-405.630) (-403.810) (-407.880) * [-404.463] (-406.684) (-405.775) (-405.776) -- 0:01:01
61500 -- (-405.131) (-404.501) (-407.377) [-404.490] * (-413.262) [-405.857] (-406.315) (-409.745) -- 0:01:01
62000 -- (-408.923) [-406.809] (-407.127) (-404.079) * (-403.904) [-404.963] (-404.780) (-405.044) -- 0:01:00
62500 -- (-405.466) [-403.833] (-404.372) (-406.860) * (-405.276) [-404.666] (-410.355) (-406.575) -- 0:01:00
63000 -- (-407.717) (-404.145) [-404.513] (-404.175) * (-405.138) (-407.405) (-406.856) [-404.749] -- 0:00:59
63500 -- (-403.847) [-405.660] (-409.429) (-409.074) * (-405.314) (-405.504) (-408.939) [-404.475] -- 0:00:58
64000 -- (-404.208) [-407.857] (-408.312) (-404.216) * [-405.854] (-404.842) (-414.587) (-405.506) -- 0:00:58
64500 -- (-404.765) (-406.656) [-404.361] (-406.558) * [-403.709] (-405.370) (-410.293) (-406.203) -- 0:00:58
65000 -- [-405.704] (-405.176) (-406.164) (-405.079) * (-405.260) [-404.706] (-406.346) (-406.331) -- 0:00:57
Average standard deviation of split frequencies: 0.025849
65500 -- [-405.208] (-412.145) (-405.403) (-406.260) * (-404.048) (-406.831) [-403.767] (-409.902) -- 0:00:57
66000 -- [-404.124] (-405.993) (-406.904) (-409.793) * (-406.100) (-405.251) (-405.803) [-405.917] -- 0:00:56
66500 -- (-404.520) [-406.076] (-409.966) (-412.289) * [-405.193] (-404.808) (-403.815) (-404.058) -- 0:01:10
67000 -- (-408.852) (-407.062) [-407.613] (-406.127) * (-404.945) [-406.795] (-406.152) (-405.096) -- 0:01:09
67500 -- [-403.835] (-406.558) (-404.848) (-405.385) * (-404.379) (-410.335) [-404.665] (-405.260) -- 0:01:09
68000 -- (-404.928) (-405.932) (-403.709) [-405.360] * [-405.854] (-406.636) (-414.915) (-406.151) -- 0:01:08
68500 -- (-405.108) (-405.514) [-403.682] (-404.903) * (-405.322) (-405.516) (-404.430) [-405.709] -- 0:01:07
69000 -- (-404.647) [-404.475] (-405.819) (-403.924) * (-405.441) (-405.487) (-407.210) [-407.283] -- 0:01:07
69500 -- (-405.559) [-407.068] (-406.294) (-404.234) * (-404.671) [-405.020] (-407.223) (-406.501) -- 0:01:06
70000 -- (-403.446) (-406.147) [-406.246] (-405.572) * (-405.909) [-405.270] (-407.317) (-404.676) -- 0:01:06
Average standard deviation of split frequencies: 0.023348
70500 -- [-404.951] (-404.120) (-405.330) (-404.021) * [-404.996] (-410.278) (-408.475) (-405.049) -- 0:01:05
71000 -- (-405.538) (-404.728) [-407.548] (-404.700) * [-405.542] (-412.628) (-408.556) (-409.073) -- 0:01:05
71500 -- (-404.126) (-403.639) [-407.497] (-405.350) * [-404.648] (-407.120) (-404.336) (-408.077) -- 0:01:04
72000 -- (-403.610) (-404.893) (-404.742) [-407.318] * [-407.331] (-404.891) (-405.388) (-407.735) -- 0:01:04
72500 -- (-407.757) (-408.004) [-404.816] (-406.131) * (-404.913) (-403.656) (-404.808) [-406.520] -- 0:01:03
73000 -- (-405.619) (-408.680) (-404.136) [-403.947] * (-406.454) (-404.065) (-405.736) [-405.910] -- 0:01:03
73500 -- (-404.606) (-404.276) (-407.438) [-404.993] * (-406.827) [-404.353] (-403.590) (-405.798) -- 0:01:03
74000 -- (-404.642) (-405.659) (-403.996) [-406.289] * (-406.133) (-406.126) (-403.416) [-405.119] -- 0:01:02
74500 -- [-404.689] (-406.124) (-404.090) (-404.322) * (-406.997) (-407.180) [-403.500] (-405.121) -- 0:01:02
75000 -- (-405.338) [-407.378] (-404.880) (-406.466) * (-405.509) (-406.933) [-403.782] (-404.820) -- 0:01:01
Average standard deviation of split frequencies: 0.022448
75500 -- (-406.594) (-404.165) [-404.600] (-405.478) * (-407.290) (-407.419) (-404.398) [-405.160] -- 0:01:01
76000 -- (-404.584) (-405.299) (-405.010) [-404.329] * (-408.374) [-403.640] (-403.715) (-404.945) -- 0:01:00
76500 -- (-404.487) [-405.799] (-407.991) (-405.345) * (-406.154) [-404.466] (-405.209) (-406.199) -- 0:01:00
77000 -- (-403.236) [-405.120] (-405.841) (-406.956) * [-404.348] (-406.459) (-404.856) (-405.030) -- 0:00:59
77500 -- (-405.015) (-405.042) [-406.429] (-405.223) * (-404.038) (-403.525) (-408.929) [-404.434] -- 0:00:59
78000 -- (-403.681) (-409.527) [-406.312] (-406.457) * (-405.015) (-404.912) (-410.755) [-405.144] -- 0:00:59
78500 -- (-405.338) (-412.538) [-408.760] (-405.891) * [-406.237] (-406.557) (-410.082) (-404.821) -- 0:00:58
79000 -- [-404.877] (-406.637) (-404.287) (-405.625) * (-409.965) (-407.847) (-404.410) [-406.796] -- 0:00:58
79500 -- [-407.103] (-409.894) (-403.364) (-404.931) * (-406.526) [-405.821] (-409.205) (-404.819) -- 0:00:57
80000 -- (-406.753) (-406.184) (-405.348) [-403.717] * (-405.806) [-404.187] (-404.137) (-407.251) -- 0:00:57
Average standard deviation of split frequencies: 0.024298
80500 -- (-405.356) [-405.869] (-405.178) (-403.926) * (-408.258) (-403.255) [-403.582] (-403.987) -- 0:00:57
81000 -- [-404.463] (-409.821) (-406.130) (-406.204) * (-405.798) (-403.898) (-403.643) [-407.138] -- 0:00:56
81500 -- (-405.613) (-407.378) (-403.643) [-406.463] * (-405.134) (-407.387) (-407.778) [-406.081] -- 0:00:56
82000 -- (-407.175) (-405.037) (-405.022) [-406.376] * (-404.595) [-406.221] (-408.380) (-403.696) -- 0:00:55
82500 -- (-407.201) [-407.841] (-411.396) (-406.291) * [-404.185] (-403.821) (-407.439) (-407.107) -- 0:00:55
83000 -- (-407.773) (-404.633) (-404.174) [-405.896] * (-404.094) (-406.009) [-409.679] (-406.797) -- 0:00:55
83500 -- (-406.644) (-404.098) [-403.792] (-405.081) * (-409.440) [-406.946] (-404.331) (-404.774) -- 0:01:05
84000 -- (-404.938) [-405.668] (-404.050) (-404.699) * (-411.521) (-406.043) (-405.205) [-403.749] -- 0:01:05
84500 -- (-405.180) [-404.826] (-405.199) (-409.752) * (-405.183) (-408.435) (-406.738) [-404.025] -- 0:01:05
85000 -- (-413.130) (-404.251) [-409.381] (-404.539) * (-403.287) (-407.508) (-405.946) [-403.985] -- 0:01:04
Average standard deviation of split frequencies: 0.027407
85500 -- (-410.907) [-403.855] (-408.088) (-404.455) * [-403.997] (-407.630) (-404.274) (-404.618) -- 0:01:04
86000 -- (-406.264) (-405.642) (-404.961) [-405.280] * (-409.873) [-406.280] (-408.365) (-413.268) -- 0:01:03
86500 -- (-407.720) (-406.560) (-407.287) [-404.083] * (-410.181) (-404.275) [-403.507] (-409.341) -- 0:01:03
87000 -- (-405.364) (-405.020) [-407.766] (-409.766) * (-407.610) (-403.223) [-405.366] (-404.120) -- 0:01:02
87500 -- (-405.758) [-405.211] (-407.143) (-403.491) * (-410.776) (-407.929) [-405.137] (-403.883) -- 0:01:02
88000 -- (-407.852) (-405.388) [-406.638] (-404.654) * (-406.347) (-406.128) [-404.331] (-407.707) -- 0:01:02
88500 -- [-404.274] (-407.798) (-404.562) (-404.662) * (-407.339) (-407.115) [-405.604] (-406.964) -- 0:01:01
89000 -- (-408.125) (-405.092) (-404.194) [-406.385] * (-404.503) [-405.579] (-405.390) (-405.917) -- 0:01:01
89500 -- (-407.954) (-407.339) [-404.686] (-404.523) * (-406.654) (-404.848) [-406.280] (-406.831) -- 0:01:01
90000 -- [-405.332] (-405.929) (-408.174) (-404.546) * (-409.014) [-403.885] (-409.009) (-406.773) -- 0:01:00
Average standard deviation of split frequencies: 0.026517
90500 -- (-404.835) [-404.602] (-405.796) (-404.575) * (-406.944) (-403.474) [-403.982] (-405.436) -- 0:01:00
91000 -- (-403.863) (-406.010) (-406.314) [-404.170] * (-408.139) [-405.156] (-404.582) (-404.431) -- 0:00:59
91500 -- (-405.967) (-408.204) [-404.774] (-404.008) * (-406.151) (-406.184) [-406.505] (-406.436) -- 0:00:59
92000 -- [-406.519] (-405.056) (-405.784) (-405.608) * (-405.445) (-406.926) [-409.342] (-406.672) -- 0:00:59
92500 -- (-413.427) (-404.315) (-406.684) [-405.464] * (-405.180) (-405.357) [-404.898] (-405.190) -- 0:00:58
93000 -- (-409.934) (-407.858) [-404.652] (-404.325) * (-406.757) (-403.476) (-403.409) [-404.978] -- 0:00:58
93500 -- [-406.555] (-405.828) (-407.635) (-407.135) * (-405.721) (-404.622) [-403.714] (-404.499) -- 0:00:58
94000 -- (-409.597) [-407.685] (-405.319) (-404.883) * [-403.519] (-405.074) (-403.918) (-404.197) -- 0:00:57
94500 -- (-406.051) [-406.076] (-404.388) (-409.208) * (-405.650) [-406.509] (-405.987) (-404.743) -- 0:00:57
95000 -- (-405.825) [-404.670] (-404.158) (-404.234) * (-405.246) [-406.367] (-405.048) (-404.154) -- 0:00:57
Average standard deviation of split frequencies: 0.025043
95500 -- (-408.156) (-407.895) (-406.720) [-406.252] * (-405.391) [-404.720] (-406.625) (-405.172) -- 0:00:56
96000 -- [-404.991] (-406.949) (-406.917) (-410.767) * (-407.854) (-407.552) (-407.729) [-405.397] -- 0:00:56
96500 -- (-407.356) (-404.103) (-409.191) [-404.978] * [-406.173] (-406.791) (-408.744) (-406.701) -- 0:00:56
97000 -- [-407.056] (-404.078) (-407.930) (-405.255) * (-404.257) (-405.254) (-403.695) [-403.552] -- 0:00:55
97500 -- (-403.888) (-403.857) (-406.425) [-404.023] * (-406.066) (-409.035) [-403.657] (-406.138) -- 0:00:55
98000 -- (-406.773) (-404.815) (-406.356) [-403.597] * (-406.087) [-404.601] (-406.819) (-406.408) -- 0:00:55
98500 -- [-403.693] (-405.158) (-405.563) (-408.463) * (-406.971) (-406.677) [-411.679] (-408.224) -- 0:00:54
99000 -- (-405.876) (-404.178) (-405.251) [-406.041] * (-406.885) [-406.029] (-408.984) (-410.404) -- 0:00:54
99500 -- [-405.579] (-404.283) (-405.690) (-410.345) * (-405.040) (-403.404) [-408.132] (-407.168) -- 0:00:54
100000 -- (-404.922) (-405.780) [-404.697] (-406.462) * (-404.491) [-405.272] (-406.512) (-406.794) -- 0:01:02
Average standard deviation of split frequencies: 0.022921
100500 -- (-408.132) [-404.032] (-405.450) (-405.233) * (-404.988) (-403.881) (-410.398) [-405.628] -- 0:01:02
101000 -- (-406.759) (-404.632) (-403.660) [-405.295] * [-407.495] (-403.976) (-406.411) (-410.437) -- 0:01:02
101500 -- (-405.757) [-405.895] (-408.490) (-404.859) * (-407.408) (-406.546) (-404.202) [-407.391] -- 0:01:01
102000 -- [-405.192] (-406.749) (-405.656) (-406.811) * (-406.678) (-405.716) [-404.200] (-410.295) -- 0:01:01
102500 -- (-406.041) (-403.634) (-405.495) [-408.460] * (-405.401) (-404.872) [-403.272] (-408.639) -- 0:01:01
103000 -- [-403.692] (-406.192) (-404.215) (-406.774) * (-405.072) (-404.566) [-403.389] (-405.939) -- 0:01:00
103500 -- (-403.822) (-404.680) [-405.252] (-407.090) * (-411.863) (-407.252) (-403.802) [-407.734] -- 0:01:00
104000 -- (-405.156) [-405.057] (-408.872) (-405.950) * (-405.293) (-403.892) [-405.385] (-407.495) -- 0:01:00
104500 -- (-405.008) (-408.193) [-404.713] (-405.004) * (-408.420) [-407.601] (-408.554) (-404.613) -- 0:00:59
105000 -- (-407.558) (-410.935) (-403.983) [-406.311] * [-404.566] (-404.683) (-409.189) (-403.754) -- 0:00:59
Average standard deviation of split frequencies: 0.024904
105500 -- [-405.914] (-408.442) (-405.455) (-406.588) * (-406.775) (-404.699) (-409.104) [-404.547] -- 0:00:59
106000 -- (-404.891) [-405.886] (-405.398) (-406.494) * (-405.967) (-404.991) (-406.224) [-405.357] -- 0:00:59
106500 -- [-404.229] (-406.037) (-404.798) (-405.171) * (-405.326) [-406.494] (-404.746) (-408.148) -- 0:00:58
107000 -- (-403.782) (-406.306) (-404.375) [-405.433] * (-404.760) (-409.839) (-404.209) [-403.577] -- 0:00:58
107500 -- (-404.459) (-407.921) [-404.587] (-407.657) * (-404.898) (-404.909) (-407.401) [-403.707] -- 0:00:58
108000 -- (-406.976) [-404.162] (-403.719) (-404.646) * (-409.285) [-406.617] (-406.650) (-404.202) -- 0:00:57
108500 -- (-403.960) (-403.756) (-403.370) [-404.005] * (-406.662) (-408.005) (-404.265) [-403.818] -- 0:00:57
109000 -- (-406.933) [-408.691] (-405.004) (-405.395) * (-407.565) (-407.571) [-405.077] (-405.001) -- 0:00:57
109500 -- [-404.242] (-405.904) (-404.949) (-408.501) * (-403.809) (-407.430) (-404.854) [-405.718] -- 0:00:56
110000 -- (-405.402) (-404.864) [-404.303] (-408.439) * (-405.678) [-404.322] (-408.091) (-404.573) -- 0:00:56
Average standard deviation of split frequencies: 0.023215
110500 -- (-403.952) [-405.633] (-406.606) (-403.444) * [-405.317] (-403.750) (-404.734) (-410.530) -- 0:00:56
111000 -- (-409.840) (-409.456) (-403.670) [-403.981] * (-403.606) [-404.967] (-405.894) (-409.806) -- 0:00:56
111500 -- (-407.355) (-405.688) [-405.453] (-404.388) * (-406.081) (-404.089) [-408.298] (-404.191) -- 0:00:55
112000 -- (-406.360) (-404.225) [-405.202] (-404.313) * [-406.008] (-405.304) (-410.515) (-407.272) -- 0:00:55
112500 -- [-406.089] (-407.862) (-405.087) (-406.068) * (-403.512) (-408.183) [-404.876] (-405.259) -- 0:00:55
113000 -- (-406.412) (-404.227) [-406.268] (-403.626) * [-408.260] (-407.211) (-407.168) (-407.659) -- 0:00:54
113500 -- (-405.755) [-404.394] (-403.717) (-404.484) * (-407.765) (-405.520) [-404.095] (-407.585) -- 0:00:54
114000 -- (-405.599) (-406.225) (-407.215) [-405.800] * (-407.553) (-403.955) [-405.469] (-406.518) -- 0:00:54
114500 -- [-403.955] (-406.480) (-406.672) (-404.067) * (-407.679) (-408.428) [-405.601] (-407.368) -- 0:00:54
115000 -- (-407.640) (-406.021) (-403.407) [-407.968] * (-405.510) [-403.149] (-406.504) (-405.934) -- 0:00:53
Average standard deviation of split frequencies: 0.021816
115500 -- (-404.893) (-405.644) [-408.454] (-407.732) * [-405.468] (-404.596) (-405.384) (-403.677) -- 0:01:01
116000 -- (-404.733) (-409.916) (-407.966) [-405.689] * (-405.041) [-407.846] (-406.993) (-406.227) -- 0:01:00
116500 -- (-404.604) (-404.628) [-406.431] (-405.396) * (-405.931) [-405.730] (-410.297) (-404.502) -- 0:01:00
117000 -- (-405.269) (-405.999) [-406.066] (-404.640) * (-407.337) (-404.122) (-406.225) [-405.539] -- 0:01:00
117500 -- (-404.470) [-405.526] (-406.129) (-405.110) * (-405.199) [-404.781] (-410.236) (-406.824) -- 0:01:00
118000 -- (-405.403) (-404.056) [-404.945] (-405.412) * (-406.227) (-404.798) [-404.317] (-406.916) -- 0:00:59
118500 -- (-405.919) [-404.443] (-406.688) (-405.057) * (-406.096) [-406.459] (-405.298) (-407.520) -- 0:00:59
119000 -- (-405.135) (-404.747) (-404.275) [-404.240] * (-403.909) (-406.327) [-406.323] (-405.046) -- 0:00:59
119500 -- [-405.687] (-406.030) (-404.146) (-405.297) * (-406.351) (-407.440) [-405.102] (-407.262) -- 0:00:58
120000 -- (-406.550) [-403.503] (-403.871) (-404.453) * (-405.188) [-407.117] (-405.436) (-404.446) -- 0:00:58
Average standard deviation of split frequencies: 0.023029
120500 -- [-407.666] (-403.923) (-404.231) (-405.471) * [-404.678] (-404.532) (-409.794) (-405.758) -- 0:00:58
121000 -- (-406.206) (-404.012) [-406.262] (-407.665) * [-405.196] (-403.810) (-406.350) (-407.388) -- 0:00:58
121500 -- (-413.605) [-405.148] (-405.051) (-405.146) * [-404.530] (-407.161) (-413.070) (-406.240) -- 0:00:57
122000 -- (-406.562) [-405.396] (-403.575) (-403.841) * (-405.999) (-407.427) (-405.732) [-404.240] -- 0:00:57
122500 -- (-407.266) (-408.523) (-406.828) [-404.589] * [-404.654] (-408.095) (-405.028) (-405.252) -- 0:00:57
123000 -- (-405.407) (-409.249) (-404.258) [-403.693] * (-403.712) (-405.259) (-404.907) [-404.575] -- 0:00:57
123500 -- (-404.945) [-405.235] (-404.911) (-403.940) * [-404.205] (-406.791) (-404.282) (-404.229) -- 0:00:56
124000 -- (-406.480) (-408.789) [-405.169] (-405.298) * (-408.260) (-405.877) (-403.909) [-405.499] -- 0:00:56
124500 -- (-405.472) (-405.694) [-405.098] (-405.007) * [-409.170] (-408.075) (-403.845) (-406.829) -- 0:00:56
125000 -- [-408.622] (-404.366) (-404.291) (-409.474) * (-410.790) (-410.019) (-407.876) [-405.254] -- 0:00:56
Average standard deviation of split frequencies: 0.023039
125500 -- (-404.953) (-405.452) (-404.279) [-409.710] * (-404.681) (-404.877) (-407.785) [-403.671] -- 0:00:55
126000 -- (-403.734) (-406.988) [-406.639] (-406.687) * (-404.731) (-407.522) [-406.136] (-404.257) -- 0:00:55
126500 -- (-407.367) [-405.154] (-408.503) (-404.971) * (-405.916) (-405.264) [-403.267] (-405.994) -- 0:00:55
127000 -- [-406.113] (-404.616) (-404.641) (-406.704) * (-408.334) [-408.176] (-406.603) (-406.205) -- 0:00:54
127500 -- (-403.412) (-405.761) [-405.385] (-405.256) * (-405.090) (-408.276) (-406.755) [-404.954] -- 0:00:54
128000 -- (-405.433) (-404.324) [-405.315] (-407.831) * (-403.989) (-406.237) [-406.055] (-404.246) -- 0:00:54
128500 -- (-404.915) [-405.040] (-405.851) (-405.778) * (-405.788) (-405.206) (-406.763) [-406.199] -- 0:01:01
129000 -- (-405.560) (-404.481) (-403.763) [-404.633] * (-405.055) (-404.968) [-409.355] (-403.648) -- 0:01:00
129500 -- (-404.323) (-404.282) [-407.019] (-406.542) * [-405.839] (-403.938) (-409.787) (-403.810) -- 0:01:00
130000 -- (-403.784) [-406.743] (-404.108) (-405.803) * (-406.116) (-404.737) [-409.194] (-403.563) -- 0:01:00
Average standard deviation of split frequencies: 0.023250
130500 -- (-408.166) (-406.011) [-403.877] (-406.888) * (-413.824) (-404.330) [-405.200] (-403.882) -- 0:00:59
131000 -- (-407.236) [-410.990] (-407.942) (-409.243) * (-404.839) (-403.060) [-406.585] (-404.129) -- 0:00:59
131500 -- (-404.463) (-404.674) (-404.579) [-405.711] * (-404.877) (-404.163) (-405.028) [-405.310] -- 0:00:59
132000 -- (-404.602) (-405.163) (-404.932) [-405.625] * [-403.574] (-406.110) (-407.490) (-406.806) -- 0:00:59
132500 -- [-409.081] (-405.279) (-405.097) (-403.393) * (-407.777) [-404.994] (-405.580) (-404.547) -- 0:00:58
133000 -- (-404.640) (-406.505) [-404.724] (-404.451) * (-406.497) (-405.247) [-414.017] (-404.592) -- 0:00:58
133500 -- (-404.555) [-404.348] (-406.846) (-405.213) * (-407.673) [-404.251] (-405.325) (-404.977) -- 0:00:58
134000 -- [-405.941] (-407.820) (-405.202) (-406.901) * (-403.823) (-404.339) (-408.713) [-404.055] -- 0:00:58
134500 -- (-405.952) [-404.776] (-404.308) (-405.833) * [-405.290] (-403.877) (-407.386) (-408.898) -- 0:00:57
135000 -- (-404.813) (-404.158) (-406.406) [-408.498] * [-403.209] (-403.755) (-408.925) (-404.118) -- 0:00:57
Average standard deviation of split frequencies: 0.024263
135500 -- (-404.329) [-408.107] (-405.999) (-405.810) * [-403.702] (-404.565) (-407.904) (-406.793) -- 0:00:57
136000 -- (-409.720) (-414.118) (-403.775) [-404.347] * [-404.052] (-406.094) (-404.469) (-405.234) -- 0:00:57
136500 -- [-405.977] (-404.987) (-403.745) (-403.990) * (-408.468) (-406.917) (-403.583) [-404.829] -- 0:00:56
137000 -- (-405.309) (-403.595) (-404.808) [-406.015] * [-407.228] (-403.674) (-404.277) (-405.233) -- 0:00:56
137500 -- (-406.604) (-403.731) [-403.829] (-409.046) * [-404.865] (-403.579) (-411.776) (-404.130) -- 0:00:56
138000 -- (-406.577) (-410.763) (-403.668) [-405.832] * (-403.563) (-406.996) (-404.881) [-403.201] -- 0:00:56
138500 -- (-410.082) (-405.635) (-405.187) [-404.790] * [-405.391] (-403.851) (-405.150) (-403.816) -- 0:00:55
139000 -- [-406.746] (-404.970) (-404.068) (-410.099) * (-405.779) [-404.370] (-406.466) (-406.500) -- 0:00:55
139500 -- (-404.679) [-405.231] (-403.909) (-404.462) * [-406.483] (-405.074) (-404.574) (-410.541) -- 0:00:55
140000 -- (-404.395) [-404.516] (-405.793) (-407.092) * (-404.852) [-403.972] (-408.144) (-403.804) -- 0:00:55
Average standard deviation of split frequencies: 0.023272
140500 -- (-407.303) [-406.416] (-404.799) (-407.759) * (-404.220) [-405.072] (-406.213) (-403.788) -- 0:00:55
141000 -- [-407.388] (-404.567) (-405.768) (-405.646) * (-404.296) (-404.204) [-405.324] (-406.204) -- 0:00:54
141500 -- (-408.963) (-404.712) [-407.521] (-406.206) * [-405.147] (-407.641) (-408.404) (-406.983) -- 0:00:54
142000 -- (-406.055) (-406.252) (-405.307) [-404.760] * (-405.695) (-405.918) [-404.469] (-407.739) -- 0:00:54
142500 -- (-406.036) (-404.899) (-407.369) [-404.713] * (-406.542) [-405.638] (-404.184) (-411.674) -- 0:00:54
143000 -- (-404.021) (-410.826) (-410.482) [-408.711] * (-405.134) (-403.392) (-406.682) [-407.876] -- 0:00:59
143500 -- (-403.348) (-415.027) [-407.757] (-404.608) * (-404.013) [-407.050] (-407.121) (-404.718) -- 0:00:59
144000 -- [-403.354] (-404.927) (-406.033) (-404.358) * (-403.549) [-405.614] (-406.355) (-409.482) -- 0:00:59
144500 -- (-403.189) (-406.746) [-404.960] (-405.810) * (-403.318) (-409.310) (-404.870) [-406.747] -- 0:00:59
145000 -- (-405.165) [-406.568] (-414.101) (-409.952) * (-406.392) (-404.295) [-408.391] (-407.194) -- 0:00:58
Average standard deviation of split frequencies: 0.022781
145500 -- [-405.227] (-405.723) (-416.642) (-403.120) * (-405.553) [-405.436] (-407.700) (-404.865) -- 0:00:58
146000 -- (-406.427) (-404.369) [-409.366] (-412.379) * [-404.998] (-407.028) (-407.659) (-404.986) -- 0:00:58
146500 -- (-406.444) (-410.610) (-409.096) [-406.109] * (-403.826) (-407.073) [-404.793] (-405.623) -- 0:00:58
147000 -- (-405.617) (-406.303) (-405.189) [-405.694] * (-403.510) (-405.503) (-405.948) [-406.083] -- 0:00:58
147500 -- (-405.600) (-403.626) [-403.225] (-403.343) * [-407.687] (-405.280) (-405.116) (-405.450) -- 0:00:57
148000 -- (-405.727) (-404.700) (-403.302) [-405.694] * (-406.534) [-404.111] (-404.302) (-404.106) -- 0:00:57
148500 -- (-407.094) (-403.900) (-404.840) [-404.390] * [-408.484] (-405.934) (-404.082) (-404.542) -- 0:00:57
149000 -- (-403.941) (-404.157) (-408.470) [-404.998] * (-405.254) (-406.898) [-404.368] (-406.080) -- 0:00:57
149500 -- (-404.522) [-404.902] (-403.610) (-405.975) * (-403.964) (-405.539) (-406.086) [-407.287] -- 0:00:56
150000 -- [-403.986] (-405.369) (-403.802) (-405.475) * (-406.867) (-405.117) (-414.279) [-404.506] -- 0:00:56
Average standard deviation of split frequencies: 0.023118
150500 -- (-407.484) (-404.089) (-405.210) [-404.191] * (-405.825) [-406.940] (-406.887) (-405.551) -- 0:00:56
151000 -- (-407.226) (-406.403) [-403.421] (-404.642) * (-407.655) (-404.752) (-405.264) [-406.033] -- 0:00:56
151500 -- (-407.518) (-404.788) (-405.831) [-403.322] * (-406.684) (-405.171) [-405.055] (-412.880) -- 0:00:56
152000 -- (-405.972) (-405.366) [-408.794] (-405.827) * (-410.152) (-404.724) [-403.560] (-408.442) -- 0:00:55
152500 -- (-407.373) [-404.272] (-404.226) (-409.810) * (-404.059) (-405.911) (-405.065) [-406.869] -- 0:00:55
153000 -- [-404.411] (-405.390) (-407.382) (-411.153) * (-404.359) [-404.786] (-403.699) (-404.448) -- 0:00:55
153500 -- (-406.011) (-409.969) [-409.316] (-410.438) * (-405.536) [-403.758] (-403.277) (-404.324) -- 0:00:55
154000 -- (-404.121) [-405.134] (-408.205) (-406.881) * (-405.068) (-404.421) [-403.521] (-404.938) -- 0:00:54
154500 -- (-405.599) [-407.240] (-406.434) (-405.806) * (-405.164) [-404.588] (-404.465) (-404.406) -- 0:00:54
155000 -- [-404.324] (-404.838) (-403.398) (-406.254) * (-413.824) [-403.208] (-406.842) (-408.149) -- 0:00:54
Average standard deviation of split frequencies: 0.021992
155500 -- [-403.716] (-405.619) (-403.913) (-405.568) * (-410.108) (-408.542) [-406.019] (-405.918) -- 0:00:54
156000 -- (-405.215) (-405.604) (-404.913) [-404.161] * (-406.997) [-405.449] (-404.487) (-409.156) -- 0:00:54
156500 -- (-405.773) [-406.067] (-404.568) (-406.094) * (-405.415) [-407.557] (-404.093) (-405.568) -- 0:00:53
157000 -- (-404.553) (-405.591) [-404.285] (-404.058) * (-405.719) (-411.855) [-404.704] (-404.886) -- 0:00:53
157500 -- [-407.089] (-403.534) (-405.349) (-405.374) * (-404.788) (-404.013) (-404.018) [-403.501] -- 0:00:53
158000 -- [-409.616] (-405.658) (-405.386) (-404.058) * (-406.019) (-406.771) [-403.893] (-403.591) -- 0:00:53
158500 -- (-406.596) [-404.674] (-410.166) (-404.749) * (-406.516) (-406.001) (-405.074) [-405.926] -- 0:00:53
159000 -- (-403.701) [-406.144] (-403.592) (-408.863) * (-407.046) (-405.325) (-405.199) [-405.783] -- 0:00:52
159500 -- [-403.035] (-403.854) (-403.788) (-405.801) * (-405.542) (-407.613) (-404.049) [-404.775] -- 0:00:57
160000 -- (-403.301) (-405.910) [-404.732] (-404.708) * (-404.721) (-408.495) (-405.456) [-406.106] -- 0:00:57
Average standard deviation of split frequencies: 0.021353
160500 -- [-405.750] (-408.563) (-404.946) (-405.529) * (-407.809) [-404.139] (-405.556) (-408.586) -- 0:00:57
161000 -- (-403.552) (-404.463) (-404.424) [-404.547] * (-408.925) [-404.176] (-404.481) (-405.424) -- 0:00:57
161500 -- (-406.117) (-408.007) (-405.311) [-405.629] * (-404.339) [-410.660] (-406.472) (-405.240) -- 0:00:57
162000 -- (-405.117) (-405.946) [-405.822] (-404.427) * [-408.027] (-404.904) (-406.263) (-408.128) -- 0:00:56
162500 -- (-407.236) (-405.294) [-403.783] (-404.177) * (-403.554) [-404.248] (-405.683) (-409.224) -- 0:00:56
163000 -- (-404.222) (-405.427) (-404.304) [-406.281] * (-404.843) [-405.072] (-404.609) (-405.487) -- 0:00:56
163500 -- (-405.104) [-407.947] (-406.797) (-406.366) * (-403.471) (-403.690) [-403.234] (-406.587) -- 0:00:56
164000 -- (-406.094) (-407.679) (-407.340) [-406.568] * (-405.247) [-405.625] (-403.660) (-405.864) -- 0:00:56
164500 -- (-406.059) [-404.693] (-407.068) (-405.942) * (-409.490) (-407.104) [-405.314] (-405.426) -- 0:00:55
165000 -- (-406.994) (-407.420) (-405.504) [-404.177] * (-405.461) [-404.429] (-404.553) (-405.058) -- 0:00:55
Average standard deviation of split frequencies: 0.020825
165500 -- (-406.242) (-409.345) [-405.228] (-403.240) * (-408.596) (-406.152) [-404.888] (-406.952) -- 0:00:55
166000 -- (-405.953) (-404.857) [-404.471] (-404.915) * (-408.908) [-405.620] (-404.241) (-407.201) -- 0:00:55
166500 -- [-408.946] (-407.273) (-407.283) (-406.942) * (-405.506) (-406.533) [-404.412] (-405.639) -- 0:00:55
167000 -- (-405.490) (-404.830) (-405.479) [-404.814] * (-408.392) (-403.999) [-405.344] (-404.899) -- 0:00:54
167500 -- (-406.529) [-404.182] (-405.096) (-406.890) * [-406.382] (-407.213) (-406.494) (-405.723) -- 0:00:54
168000 -- [-405.085] (-403.597) (-404.408) (-409.108) * (-404.302) (-403.967) (-405.632) [-405.175] -- 0:00:54
168500 -- (-405.694) (-405.605) (-407.467) [-408.598] * (-405.947) (-404.254) [-405.449] (-406.033) -- 0:00:54
169000 -- (-404.935) (-404.524) [-404.027] (-407.552) * [-406.123] (-404.644) (-405.094) (-408.182) -- 0:00:54
169500 -- (-405.813) [-404.458] (-405.059) (-405.211) * [-407.162] (-406.589) (-405.685) (-404.720) -- 0:00:53
170000 -- (-406.594) (-405.296) (-407.281) [-405.153] * [-408.624] (-404.181) (-405.309) (-403.975) -- 0:00:53
Average standard deviation of split frequencies: 0.020409
170500 -- (-409.717) [-404.281] (-407.580) (-403.884) * (-405.242) (-405.686) (-407.996) [-404.949] -- 0:00:53
171000 -- (-407.251) (-405.535) [-410.131] (-404.511) * (-405.013) (-406.337) (-408.756) [-405.650] -- 0:00:53
171500 -- [-405.235] (-404.893) (-408.212) (-409.892) * (-405.104) (-407.380) (-404.585) [-404.098] -- 0:00:53
172000 -- (-404.798) (-404.775) [-404.960] (-404.389) * (-404.301) [-405.369] (-404.993) (-408.437) -- 0:00:52
172500 -- (-407.213) (-405.260) (-406.145) [-404.825] * (-405.827) (-404.161) (-405.497) [-403.691] -- 0:00:52
173000 -- (-406.465) [-407.696] (-404.868) (-406.960) * (-405.721) (-404.433) (-407.126) [-406.148] -- 0:00:52
173500 -- (-405.110) (-405.506) [-405.538] (-406.163) * (-407.958) [-405.123] (-406.783) (-406.845) -- 0:00:52
174000 -- (-403.863) (-406.019) [-403.828] (-405.267) * [-405.333] (-404.350) (-405.627) (-403.740) -- 0:00:52
174500 -- (-403.629) (-405.154) [-403.507] (-408.544) * [-405.850] (-405.184) (-408.467) (-405.313) -- 0:00:52
175000 -- [-405.407] (-406.202) (-406.062) (-406.379) * (-410.343) (-407.134) (-407.114) [-404.445] -- 0:00:51
Average standard deviation of split frequencies: 0.020088
175500 -- (-408.710) (-405.225) [-403.844] (-406.703) * (-407.929) (-405.763) (-413.047) [-414.774] -- 0:00:51
176000 -- [-405.509] (-405.797) (-406.493) (-407.395) * [-406.031] (-403.241) (-406.429) (-406.414) -- 0:00:51
176500 -- (-405.380) [-407.506] (-405.809) (-404.530) * [-407.905] (-409.507) (-406.249) (-405.702) -- 0:00:55
177000 -- (-405.014) (-404.380) (-410.884) [-404.427] * (-406.683) [-409.598] (-404.246) (-408.025) -- 0:00:55
177500 -- [-405.834] (-403.692) (-405.687) (-405.207) * (-403.853) (-404.462) (-404.922) [-404.912] -- 0:00:55
178000 -- (-405.460) (-405.634) (-407.316) [-403.150] * [-405.972] (-404.601) (-409.350) (-403.730) -- 0:00:55
178500 -- [-409.894] (-411.860) (-405.951) (-407.409) * (-405.264) (-404.564) [-405.353] (-409.401) -- 0:00:55
179000 -- [-405.588] (-407.710) (-407.439) (-408.739) * [-406.415] (-407.094) (-405.595) (-406.199) -- 0:00:55
179500 -- (-403.396) (-403.820) (-408.912) [-405.803] * (-406.243) (-408.274) [-404.687] (-403.314) -- 0:00:54
180000 -- (-406.613) (-405.454) [-405.866] (-403.804) * [-403.405] (-406.778) (-403.751) (-406.796) -- 0:00:54
Average standard deviation of split frequencies: 0.018700
180500 -- (-408.443) (-408.038) (-411.821) [-404.380] * (-405.398) [-406.957] (-405.938) (-406.459) -- 0:00:54
181000 -- (-405.807) [-406.309] (-405.144) (-406.154) * [-409.216] (-404.834) (-412.636) (-405.054) -- 0:00:54
181500 -- [-404.043] (-406.266) (-406.004) (-403.868) * (-408.414) (-404.830) (-411.127) [-404.493] -- 0:00:54
182000 -- (-408.414) [-404.563] (-403.602) (-405.456) * [-404.242] (-403.535) (-409.185) (-403.976) -- 0:00:53
182500 -- [-406.355] (-408.976) (-406.186) (-405.708) * [-404.372] (-405.391) (-406.247) (-405.802) -- 0:00:53
183000 -- [-404.298] (-406.880) (-406.433) (-405.721) * (-406.803) (-411.289) [-406.871] (-407.485) -- 0:00:53
183500 -- [-406.384] (-405.622) (-403.930) (-405.621) * [-406.909] (-411.463) (-408.860) (-409.425) -- 0:00:53
184000 -- [-405.443] (-410.226) (-406.052) (-404.446) * (-406.588) (-406.257) (-405.900) [-407.018] -- 0:00:53
184500 -- [-403.857] (-405.905) (-405.933) (-407.029) * [-403.863] (-410.859) (-404.740) (-408.740) -- 0:00:53
185000 -- (-404.315) (-403.845) [-408.533] (-407.844) * (-405.278) (-406.346) (-404.989) [-404.532] -- 0:00:52
Average standard deviation of split frequencies: 0.019149
185500 -- [-408.929] (-403.480) (-405.836) (-404.251) * (-412.382) [-408.908] (-406.175) (-405.086) -- 0:00:52
186000 -- (-409.718) (-405.670) [-403.672] (-409.246) * (-405.132) (-403.594) [-403.623] (-405.859) -- 0:00:52
186500 -- [-404.902] (-406.295) (-404.828) (-407.878) * (-407.456) (-406.502) (-405.529) [-406.581] -- 0:00:52
187000 -- [-408.165] (-404.002) (-404.407) (-404.448) * (-403.328) (-404.846) [-404.045] (-406.830) -- 0:00:52
187500 -- [-405.213] (-403.936) (-405.937) (-407.114) * [-405.451] (-404.778) (-406.730) (-406.770) -- 0:00:52
188000 -- [-408.256] (-404.031) (-406.323) (-406.537) * (-405.270) [-404.003] (-407.885) (-403.410) -- 0:00:51
188500 -- (-404.330) [-406.335] (-405.420) (-407.603) * (-409.228) (-407.261) (-408.588) [-404.387] -- 0:00:51
189000 -- (-404.049) [-405.557] (-404.512) (-405.669) * (-407.326) [-403.588] (-408.844) (-404.367) -- 0:00:51
189500 -- [-407.998] (-405.300) (-405.403) (-419.331) * (-404.547) [-403.954] (-408.455) (-406.966) -- 0:00:51
190000 -- (-406.274) (-405.701) [-405.091] (-404.683) * (-409.355) [-404.338] (-405.578) (-406.329) -- 0:00:51
Average standard deviation of split frequencies: 0.018608
190500 -- (-405.321) (-408.895) [-407.732] (-404.867) * [-404.298] (-410.131) (-406.759) (-407.653) -- 0:00:50
191000 -- [-409.042] (-403.435) (-405.059) (-404.869) * (-404.756) (-414.431) [-407.374] (-403.303) -- 0:00:50
191500 -- [-410.192] (-403.601) (-407.133) (-405.440) * (-403.602) [-409.696] (-406.766) (-404.201) -- 0:00:50
192000 -- (-406.984) (-405.918) (-406.628) [-406.522] * (-403.640) (-405.809) [-403.666] (-404.077) -- 0:00:50
192500 -- (-404.990) [-405.016] (-404.909) (-403.520) * (-403.520) (-403.244) (-405.740) [-409.931] -- 0:00:50
193000 -- [-404.444] (-408.066) (-407.420) (-409.098) * (-403.888) [-404.119] (-404.932) (-405.151) -- 0:00:50
193500 -- (-404.131) (-405.237) [-405.930] (-409.085) * (-408.287) (-405.863) [-408.739] (-404.175) -- 0:00:50
194000 -- (-403.494) (-404.725) [-404.490] (-409.898) * (-406.184) (-406.695) (-404.585) [-405.693] -- 0:00:54
194500 -- (-406.916) (-406.023) [-404.833] (-406.138) * (-404.455) (-403.406) (-405.644) [-405.649] -- 0:00:53
195000 -- (-409.750) (-408.961) (-404.057) [-405.536] * (-403.615) (-404.560) (-411.445) [-404.153] -- 0:00:53
Average standard deviation of split frequencies: 0.018439
195500 -- (-404.982) (-406.296) [-403.632] (-406.368) * (-407.891) (-405.659) (-408.059) [-404.086] -- 0:00:53
196000 -- (-404.472) (-405.153) [-403.307] (-405.480) * (-406.205) (-407.946) (-405.976) [-403.968] -- 0:00:53
196500 -- (-403.694) (-408.036) (-404.238) [-403.771] * (-408.022) (-407.068) [-404.137] (-406.276) -- 0:00:53
197000 -- (-405.893) (-407.754) [-404.894] (-404.536) * (-408.232) [-403.668] (-406.623) (-404.510) -- 0:00:52
197500 -- (-406.506) (-406.147) (-406.819) [-405.669] * (-405.747) [-404.633] (-404.324) (-405.406) -- 0:00:52
198000 -- (-408.929) [-406.170] (-406.653) (-404.325) * (-404.609) [-404.572] (-414.017) (-404.610) -- 0:00:52
198500 -- (-406.631) (-408.246) [-406.692] (-404.973) * (-409.657) (-409.355) [-405.886] (-407.001) -- 0:00:52
199000 -- (-405.904) [-407.274] (-404.579) (-407.870) * (-404.809) [-406.602] (-406.980) (-408.120) -- 0:00:52
199500 -- (-404.889) (-409.932) [-407.904] (-405.796) * (-409.806) [-406.491] (-405.163) (-406.413) -- 0:00:52
200000 -- [-405.046] (-404.496) (-404.901) (-404.987) * (-407.179) (-407.755) [-405.285] (-407.645) -- 0:00:51
Average standard deviation of split frequencies: 0.017488
200500 -- (-405.822) (-404.988) (-405.840) [-408.103] * (-403.918) [-404.534] (-405.311) (-406.262) -- 0:00:51
201000 -- (-404.355) [-406.441] (-406.666) (-407.590) * [-404.428] (-404.096) (-405.790) (-404.710) -- 0:00:51
201500 -- [-405.063] (-404.509) (-405.715) (-409.656) * (-404.122) (-404.025) (-405.356) [-404.997] -- 0:00:51
202000 -- (-404.979) (-404.498) [-403.696] (-409.555) * (-405.856) (-406.193) (-405.951) [-403.190] -- 0:00:51
202500 -- (-404.896) [-408.091] (-403.711) (-410.989) * (-405.667) [-404.989] (-405.516) (-404.779) -- 0:00:51
203000 -- [-404.162] (-405.256) (-403.525) (-411.645) * [-405.977] (-407.337) (-405.559) (-404.402) -- 0:00:51
203500 -- (-406.972) (-405.107) [-403.727] (-405.288) * (-406.392) (-407.388) (-408.250) [-406.705] -- 0:00:50
204000 -- [-405.353] (-405.496) (-406.493) (-408.376) * (-404.839) (-406.961) (-404.925) [-403.597] -- 0:00:50
204500 -- [-405.009] (-404.444) (-405.856) (-404.710) * [-407.299] (-405.173) (-403.853) (-405.535) -- 0:00:50
205000 -- (-407.043) (-405.160) (-407.000) [-404.097] * [-405.000] (-413.561) (-408.097) (-404.414) -- 0:00:50
Average standard deviation of split frequencies: 0.016934
205500 -- (-405.234) [-406.296] (-407.416) (-405.206) * (-407.678) (-404.775) (-405.730) [-409.798] -- 0:00:50
206000 -- [-403.752] (-403.904) (-405.706) (-406.469) * (-407.098) [-404.273] (-406.606) (-411.545) -- 0:00:50
206500 -- (-407.489) (-404.400) (-406.593) [-404.309] * (-406.644) (-411.599) (-408.182) [-405.819] -- 0:00:49
207000 -- [-405.530] (-407.303) (-404.356) (-403.811) * (-406.171) [-406.141] (-408.630) (-407.402) -- 0:00:49
207500 -- (-405.144) (-404.247) [-405.515] (-407.581) * (-408.942) (-407.164) (-409.000) [-404.539] -- 0:00:49
208000 -- [-405.679] (-407.563) (-408.406) (-409.500) * (-407.425) (-404.221) (-407.261) [-404.636] -- 0:00:49
208500 -- [-404.934] (-404.463) (-404.010) (-407.986) * (-404.780) [-407.137] (-404.425) (-405.336) -- 0:00:49
209000 -- [-407.102] (-403.437) (-405.666) (-408.065) * (-404.515) (-405.706) (-405.578) [-405.447] -- 0:00:49
209500 -- (-408.265) (-406.099) [-403.764] (-406.933) * (-407.509) [-403.615] (-403.726) (-405.177) -- 0:00:49
210000 -- (-404.767) (-407.822) (-404.798) [-407.092] * (-405.121) [-410.443] (-404.194) (-405.921) -- 0:00:48
Average standard deviation of split frequencies: 0.018399
210500 -- (-403.853) (-409.504) (-408.627) [-408.720] * (-403.973) [-407.939] (-406.800) (-405.060) -- 0:00:52
211000 -- (-405.835) [-409.675] (-404.190) (-404.687) * (-403.373) [-404.272] (-405.421) (-405.027) -- 0:00:52
211500 -- (-404.020) (-406.046) (-404.296) [-403.913] * (-403.367) (-407.749) [-404.089] (-408.045) -- 0:00:52
212000 -- (-404.947) [-407.218] (-404.250) (-411.054) * [-403.858] (-406.757) (-404.732) (-404.514) -- 0:00:52
212500 -- [-406.001] (-403.899) (-403.309) (-405.209) * (-403.162) (-406.743) [-407.022] (-406.244) -- 0:00:51
213000 -- [-404.306] (-407.828) (-404.492) (-405.127) * (-407.717) [-405.898] (-405.271) (-404.729) -- 0:00:51
213500 -- (-409.830) (-406.761) [-404.355] (-406.010) * (-404.373) [-405.099] (-405.515) (-406.075) -- 0:00:51
214000 -- (-408.280) (-405.345) [-403.211] (-405.222) * [-404.982] (-404.685) (-406.938) (-403.455) -- 0:00:51
214500 -- [-409.609] (-405.746) (-406.867) (-404.730) * [-404.867] (-407.770) (-406.391) (-405.365) -- 0:00:51
215000 -- (-409.716) (-405.199) (-404.736) [-404.420] * (-404.641) (-404.517) (-407.914) [-406.762] -- 0:00:51
Average standard deviation of split frequencies: 0.018672
215500 -- (-407.793) (-405.104) [-405.733] (-404.747) * (-407.069) [-404.064] (-403.825) (-404.203) -- 0:00:50
216000 -- [-406.508] (-405.347) (-405.147) (-408.789) * (-410.589) (-404.780) (-405.544) [-404.273] -- 0:00:50
216500 -- [-405.268] (-405.690) (-405.952) (-406.783) * (-409.457) (-405.036) (-405.310) [-406.678] -- 0:00:50
217000 -- (-405.850) (-405.120) [-406.672] (-405.217) * [-405.672] (-404.783) (-406.418) (-404.687) -- 0:00:50
217500 -- (-404.989) [-404.991] (-404.656) (-406.632) * [-405.972] (-407.237) (-408.821) (-404.850) -- 0:00:50
218000 -- (-404.051) (-404.438) (-407.891) [-404.496] * (-403.316) (-404.205) [-404.943] (-404.602) -- 0:00:50
218500 -- (-404.019) [-405.875] (-412.130) (-404.595) * (-405.068) (-404.681) (-405.397) [-406.899] -- 0:00:50
219000 -- (-408.106) (-406.970) (-413.652) [-404.166] * (-406.097) (-405.830) (-404.653) [-404.101] -- 0:00:49
219500 -- (-408.152) (-406.310) (-413.301) [-405.816] * (-405.632) (-408.892) (-405.097) [-408.799] -- 0:00:49
220000 -- (-407.001) (-405.099) (-414.001) [-404.944] * [-404.512] (-404.967) (-404.676) (-407.114) -- 0:00:49
Average standard deviation of split frequencies: 0.017203
220500 -- (-403.523) (-406.710) (-417.744) [-405.503] * (-405.474) [-405.407] (-409.691) (-407.632) -- 0:00:49
221000 -- (-404.009) [-404.309] (-407.114) (-408.286) * (-405.510) (-405.476) [-404.233] (-406.844) -- 0:00:49
221500 -- (-406.556) [-403.732] (-407.547) (-408.953) * (-407.677) (-404.780) [-405.679] (-404.347) -- 0:00:49
222000 -- (-407.496) [-404.898] (-404.477) (-406.138) * (-406.712) (-405.200) (-407.062) [-403.245] -- 0:00:49
222500 -- (-404.832) (-410.790) [-405.223] (-407.252) * [-403.525] (-404.212) (-410.677) (-405.141) -- 0:00:48
223000 -- [-404.451] (-406.382) (-403.442) (-407.676) * (-404.593) [-408.195] (-407.795) (-405.509) -- 0:00:48
223500 -- (-408.494) (-404.965) [-405.188] (-406.807) * (-406.562) [-405.494] (-403.920) (-406.356) -- 0:00:48
224000 -- [-406.415] (-404.733) (-405.903) (-404.031) * (-406.217) [-406.180] (-406.485) (-405.498) -- 0:00:48
224500 -- (-405.146) [-404.360] (-407.227) (-404.506) * (-407.695) (-407.371) [-404.338] (-404.442) -- 0:00:48
225000 -- (-404.791) (-405.527) (-405.350) [-403.820] * [-405.349] (-406.680) (-406.231) (-404.853) -- 0:00:48
Average standard deviation of split frequencies: 0.016467
225500 -- (-404.534) [-407.124] (-404.711) (-409.032) * (-405.516) [-403.933] (-403.901) (-404.106) -- 0:00:48
226000 -- (-408.592) [-405.558] (-404.616) (-406.990) * [-403.767] (-403.549) (-404.965) (-405.972) -- 0:00:47
226500 -- (-407.935) (-406.179) [-410.323] (-407.713) * (-404.788) (-405.843) (-405.279) [-403.282] -- 0:00:47
227000 -- (-406.771) (-405.772) [-409.948] (-407.112) * [-404.374] (-404.729) (-408.275) (-403.504) -- 0:00:47
227500 -- (-407.522) (-404.744) (-406.920) [-403.653] * [-405.530] (-404.827) (-407.429) (-409.357) -- 0:00:50
228000 -- (-404.509) (-403.434) [-405.145] (-407.196) * [-406.443] (-405.498) (-405.272) (-409.325) -- 0:00:50
228500 -- (-403.926) [-405.555] (-405.444) (-405.954) * (-405.074) (-406.801) (-405.129) [-404.751] -- 0:00:50
229000 -- [-404.238] (-403.241) (-406.902) (-404.025) * (-403.526) (-404.725) (-407.187) [-406.824] -- 0:00:50
229500 -- (-405.040) (-404.781) [-405.327] (-405.428) * [-405.551] (-407.058) (-408.919) (-406.206) -- 0:00:50
230000 -- (-406.509) (-405.742) [-404.090] (-403.230) * (-403.596) (-405.573) (-405.936) [-406.252] -- 0:00:50
Average standard deviation of split frequencies: 0.016247
230500 -- [-405.713] (-408.408) (-404.473) (-403.695) * [-407.206] (-404.199) (-406.414) (-403.196) -- 0:00:50
231000 -- [-404.169] (-406.746) (-404.516) (-405.992) * (-407.780) (-404.137) [-404.534] (-405.753) -- 0:00:49
231500 -- (-403.971) (-407.081) (-407.860) [-406.990] * (-406.547) [-403.467] (-404.800) (-403.799) -- 0:00:49
232000 -- (-404.064) (-405.657) [-405.985] (-407.322) * (-403.209) (-406.639) [-403.508] (-406.222) -- 0:00:49
232500 -- (-404.960) (-406.705) [-406.373] (-404.295) * [-405.516] (-403.669) (-404.804) (-404.510) -- 0:00:49
233000 -- [-406.261] (-404.897) (-405.400) (-407.192) * [-403.955] (-404.123) (-403.262) (-410.612) -- 0:00:49
233500 -- (-406.324) (-405.726) (-404.077) [-405.357] * (-405.124) (-405.392) [-404.489] (-408.239) -- 0:00:49
234000 -- (-407.412) [-403.993] (-406.637) (-406.165) * [-407.055] (-405.420) (-403.790) (-405.616) -- 0:00:49
234500 -- [-404.941] (-403.962) (-407.016) (-407.125) * (-405.111) (-405.255) (-403.865) [-404.808] -- 0:00:48
235000 -- (-405.398) (-404.571) (-406.037) [-404.723] * (-404.467) [-404.265] (-407.199) (-405.202) -- 0:00:48
Average standard deviation of split frequencies: 0.015029
235500 -- (-410.403) (-405.430) (-406.191) [-404.912] * (-405.189) [-405.450] (-403.409) (-407.707) -- 0:00:48
236000 -- [-405.940] (-405.015) (-406.240) (-404.002) * [-405.184] (-412.350) (-410.299) (-409.955) -- 0:00:48
236500 -- (-405.819) [-406.862] (-404.014) (-404.328) * [-403.350] (-409.638) (-408.324) (-405.431) -- 0:00:48
237000 -- (-408.152) [-403.730] (-405.210) (-405.618) * [-403.863] (-407.919) (-404.595) (-406.454) -- 0:00:48
237500 -- (-410.235) [-404.296] (-411.362) (-404.336) * [-404.188] (-404.991) (-404.324) (-406.410) -- 0:00:48
238000 -- (-409.244) (-404.362) (-408.031) [-405.227] * [-404.544] (-405.240) (-407.336) (-405.575) -- 0:00:48
238500 -- (-406.372) (-407.220) (-403.672) [-405.748] * (-410.302) (-403.847) [-409.080] (-408.583) -- 0:00:47
239000 -- (-405.772) [-405.566] (-403.658) (-405.101) * (-405.516) (-404.051) [-405.803] (-404.231) -- 0:00:47
239500 -- (-407.270) (-403.963) [-405.699] (-404.563) * [-406.418] (-404.368) (-404.545) (-404.816) -- 0:00:47
240000 -- (-406.504) [-404.511] (-405.697) (-408.583) * (-407.131) (-405.651) (-407.239) [-407.285] -- 0:00:47
Average standard deviation of split frequencies: 0.015763
240500 -- (-404.215) [-404.511] (-405.165) (-406.188) * (-406.647) [-404.808] (-403.225) (-403.846) -- 0:00:47
241000 -- (-404.335) (-405.676) [-404.693] (-408.129) * (-406.153) (-404.330) [-406.426] (-407.145) -- 0:00:47
241500 -- (-406.041) [-405.112] (-408.658) (-404.611) * [-404.788] (-407.517) (-407.168) (-405.071) -- 0:00:47
242000 -- (-403.890) (-405.835) [-405.677] (-405.474) * (-407.020) (-407.566) [-404.154] (-405.982) -- 0:00:46
242500 -- (-406.115) [-404.602] (-405.382) (-406.979) * (-404.665) [-408.178] (-405.617) (-405.989) -- 0:00:46
243000 -- (-405.385) (-404.944) (-405.013) [-404.286] * [-405.495] (-405.484) (-405.050) (-407.441) -- 0:00:46
243500 -- [-404.845] (-406.261) (-404.112) (-406.457) * (-407.477) (-403.616) (-406.487) [-407.802] -- 0:00:46
244000 -- (-405.686) (-409.146) [-404.096] (-407.480) * (-406.162) (-407.548) (-404.393) [-407.315] -- 0:00:46
244500 -- (-403.749) (-406.218) (-404.687) [-403.966] * (-404.370) [-404.827] (-403.356) (-407.003) -- 0:00:49
245000 -- [-409.340] (-407.138) (-406.196) (-407.731) * (-405.850) [-404.316] (-406.058) (-405.274) -- 0:00:49
Average standard deviation of split frequencies: 0.015604
245500 -- (-408.520) [-406.315] (-406.359) (-405.813) * (-407.799) [-408.857] (-403.570) (-404.872) -- 0:00:49
246000 -- (-403.756) [-405.309] (-403.669) (-407.802) * (-406.381) [-406.960] (-406.059) (-406.518) -- 0:00:49
246500 -- (-403.842) [-405.434] (-406.987) (-406.259) * [-405.951] (-410.823) (-404.700) (-405.603) -- 0:00:48
247000 -- (-406.054) [-406.212] (-405.961) (-408.296) * (-406.114) [-404.998] (-403.914) (-404.271) -- 0:00:48
247500 -- [-404.779] (-404.778) (-406.764) (-405.179) * (-403.848) (-404.059) (-404.181) [-404.046] -- 0:00:48
248000 -- (-404.750) (-405.810) (-405.167) [-404.984] * (-408.053) (-404.230) (-405.092) [-407.187] -- 0:00:48
248500 -- (-406.899) [-406.581] (-403.760) (-407.959) * [-406.960] (-405.022) (-403.133) (-406.678) -- 0:00:48
249000 -- (-403.966) (-405.513) (-403.789) [-408.068] * [-405.368] (-405.480) (-404.370) (-404.809) -- 0:00:48
249500 -- (-407.315) [-406.760] (-407.378) (-406.386) * (-405.555) [-406.426] (-405.455) (-404.387) -- 0:00:48
250000 -- (-403.738) (-407.182) (-404.782) [-406.397] * (-404.434) (-405.731) [-404.151] (-404.389) -- 0:00:48
Average standard deviation of split frequencies: 0.015985
250500 -- [-404.086] (-404.728) (-407.061) (-405.633) * (-405.938) (-405.792) [-403.603] (-405.410) -- 0:00:47
251000 -- (-405.228) (-407.442) (-405.570) [-404.416] * (-404.629) (-406.148) (-407.451) [-407.269] -- 0:00:47
251500 -- [-406.406] (-404.345) (-406.014) (-403.893) * (-403.859) [-404.108] (-406.387) (-406.788) -- 0:00:47
252000 -- (-409.509) [-404.575] (-405.897) (-405.461) * (-404.912) [-404.329] (-407.943) (-405.814) -- 0:00:47
252500 -- (-404.005) (-406.647) (-404.269) [-406.588] * (-404.158) [-404.083] (-405.460) (-406.193) -- 0:00:47
253000 -- (-405.593) [-403.577] (-408.154) (-407.156) * [-404.049] (-406.610) (-406.087) (-404.064) -- 0:00:47
253500 -- (-404.230) (-407.550) [-404.675] (-408.524) * (-403.396) [-404.163] (-406.133) (-406.661) -- 0:00:47
254000 -- [-405.688] (-404.562) (-406.805) (-406.860) * (-409.337) (-408.054) (-404.593) [-406.540] -- 0:00:46
254500 -- (-404.526) (-404.639) [-407.016] (-408.657) * (-405.994) (-409.370) (-408.425) [-405.308] -- 0:00:46
255000 -- (-406.708) (-403.877) (-404.054) [-407.581] * [-406.796] (-405.876) (-408.604) (-405.514) -- 0:00:46
Average standard deviation of split frequencies: 0.016864
255500 -- [-405.182] (-406.456) (-406.438) (-405.284) * (-406.054) (-404.365) (-405.581) [-404.639] -- 0:00:46
256000 -- [-403.955] (-406.295) (-406.501) (-406.519) * [-406.097] (-405.264) (-406.761) (-404.695) -- 0:00:46
256500 -- [-405.791] (-406.380) (-405.888) (-406.996) * (-403.211) (-407.123) [-404.631] (-404.523) -- 0:00:46
257000 -- (-407.360) (-406.391) [-406.617] (-405.143) * (-403.954) (-405.505) (-406.415) [-404.227] -- 0:00:46
257500 -- [-404.913] (-407.659) (-406.390) (-408.859) * (-403.984) (-406.215) (-404.052) [-407.251] -- 0:00:46
258000 -- (-404.689) [-404.820] (-403.877) (-403.549) * [-409.706] (-408.418) (-405.064) (-406.926) -- 0:00:46
258500 -- (-403.815) (-403.673) (-406.602) [-404.102] * [-408.688] (-407.134) (-405.067) (-404.573) -- 0:00:45
259000 -- (-403.705) (-403.797) (-407.823) [-407.082] * (-404.020) [-409.547] (-404.454) (-403.581) -- 0:00:45
259500 -- (-403.994) (-405.175) [-406.072] (-412.342) * [-405.123] (-419.600) (-404.311) (-404.649) -- 0:00:45
260000 -- [-403.581] (-406.892) (-408.906) (-405.764) * (-405.151) (-406.544) (-407.362) [-404.361] -- 0:00:45
Average standard deviation of split frequencies: 0.016979
260500 -- [-405.403] (-408.837) (-407.882) (-405.574) * (-405.907) [-405.994] (-404.868) (-406.723) -- 0:00:45
261000 -- (-404.749) (-407.989) [-407.785] (-405.036) * (-405.142) (-404.785) [-405.719] (-404.341) -- 0:00:48
261500 -- (-403.461) (-405.023) [-405.834] (-404.853) * (-406.305) [-404.626] (-407.921) (-404.768) -- 0:00:48
262000 -- [-403.853] (-404.753) (-408.903) (-407.451) * (-405.404) [-406.882] (-406.379) (-405.776) -- 0:00:47
262500 -- (-406.347) [-403.987] (-409.362) (-403.319) * [-405.385] (-405.522) (-404.412) (-406.167) -- 0:00:47
263000 -- [-405.741] (-406.157) (-408.184) (-406.853) * (-405.071) (-404.812) (-406.380) [-405.232] -- 0:00:47
263500 -- [-405.083] (-407.697) (-407.017) (-407.740) * (-403.754) (-409.642) (-404.497) [-404.222] -- 0:00:47
264000 -- [-406.909] (-408.371) (-407.142) (-404.685) * [-408.283] (-407.341) (-404.959) (-404.757) -- 0:00:47
264500 -- (-406.038) [-404.718] (-407.042) (-406.696) * [-407.189] (-408.505) (-405.067) (-405.246) -- 0:00:47
265000 -- [-407.211] (-406.597) (-407.832) (-404.010) * (-405.745) (-407.664) (-404.932) [-406.300] -- 0:00:47
Average standard deviation of split frequencies: 0.015857
265500 -- [-404.706] (-406.472) (-404.671) (-404.010) * [-405.126] (-404.348) (-405.621) (-408.045) -- 0:00:47
266000 -- (-408.922) (-403.698) (-406.307) [-404.054] * [-404.421] (-405.523) (-407.438) (-409.061) -- 0:00:46
266500 -- (-410.656) (-406.960) (-404.571) [-404.924] * (-405.303) (-404.448) (-408.183) [-407.508] -- 0:00:46
267000 -- (-406.124) [-405.825] (-404.398) (-405.825) * (-404.900) (-404.102) (-405.229) [-405.928] -- 0:00:46
267500 -- (-405.232) (-407.071) (-405.468) [-404.453] * (-404.931) (-404.645) [-404.257] (-403.901) -- 0:00:46
268000 -- (-404.819) (-404.093) (-418.549) [-403.920] * (-407.255) (-406.006) [-406.882] (-405.410) -- 0:00:46
268500 -- [-405.507] (-403.967) (-409.199) (-404.799) * (-406.961) (-407.311) [-405.182] (-403.971) -- 0:00:46
269000 -- (-403.536) (-404.756) (-406.810) [-405.104] * [-404.973] (-407.465) (-406.317) (-406.302) -- 0:00:46
269500 -- (-404.835) (-405.141) [-405.340] (-404.402) * (-406.073) (-410.623) [-403.514] (-406.952) -- 0:00:46
270000 -- (-407.975) (-404.685) (-409.936) [-404.717] * (-405.557) (-406.331) (-403.849) [-404.541] -- 0:00:45
Average standard deviation of split frequencies: 0.016159
270500 -- (-406.394) (-404.433) [-404.173] (-405.059) * (-406.022) (-404.457) (-404.995) [-403.618] -- 0:00:45
271000 -- [-405.521] (-407.092) (-405.979) (-409.693) * [-404.835] (-405.253) (-405.215) (-406.525) -- 0:00:45
271500 -- (-403.194) [-403.899] (-405.482) (-405.335) * [-406.343] (-408.071) (-403.529) (-404.351) -- 0:00:45
272000 -- (-403.939) [-405.040] (-406.166) (-411.766) * (-406.582) (-408.371) [-406.256] (-404.272) -- 0:00:45
272500 -- (-407.830) (-404.787) (-403.923) [-409.669] * (-404.871) (-405.548) (-403.981) [-404.644] -- 0:00:45
273000 -- [-408.103] (-407.861) (-404.658) (-408.929) * (-411.507) (-404.190) [-404.805] (-406.142) -- 0:00:45
273500 -- (-406.562) [-403.906] (-403.880) (-403.162) * (-404.903) [-405.207] (-404.454) (-406.796) -- 0:00:45
274000 -- [-405.754] (-406.180) (-404.215) (-405.116) * (-406.568) [-404.371] (-407.009) (-405.198) -- 0:00:45
274500 -- (-405.267) (-408.402) (-405.895) [-405.028] * (-407.890) [-404.934] (-407.531) (-406.682) -- 0:00:44
275000 -- (-405.721) [-404.911] (-408.608) (-407.487) * (-412.518) (-408.511) (-406.215) [-406.367] -- 0:00:44
Average standard deviation of split frequencies: 0.015462
275500 -- (-405.670) (-408.674) [-404.191] (-406.506) * (-406.304) (-405.606) (-404.370) [-404.770] -- 0:00:44
276000 -- (-407.138) (-403.668) (-403.855) [-409.177] * (-403.748) (-404.387) (-406.319) [-405.462] -- 0:00:44
276500 -- [-403.353] (-408.647) (-407.230) (-406.786) * (-404.722) (-405.877) [-406.497] (-406.900) -- 0:00:44
277000 -- (-411.128) (-404.664) (-403.880) [-410.159] * (-405.313) (-405.328) (-408.790) [-404.819] -- 0:00:44
277500 -- (-403.966) (-404.318) [-406.506] (-408.576) * (-404.394) [-405.447] (-405.825) (-405.424) -- 0:00:46
278000 -- (-403.857) (-408.048) (-404.263) [-408.055] * (-404.738) (-406.594) (-408.015) [-403.760] -- 0:00:46
278500 -- [-404.678] (-404.620) (-403.187) (-404.864) * (-403.569) (-407.850) (-407.781) [-403.399] -- 0:00:46
279000 -- (-403.839) [-405.801] (-406.907) (-405.036) * (-404.409) [-404.232] (-404.126) (-407.185) -- 0:00:46
279500 -- (-404.796) [-406.977] (-403.897) (-403.512) * (-404.728) (-408.862) [-407.402] (-404.377) -- 0:00:46
280000 -- (-404.367) (-406.968) [-405.452] (-405.079) * (-404.852) [-406.316] (-411.784) (-404.229) -- 0:00:46
Average standard deviation of split frequencies: 0.013702
280500 -- (-405.157) (-405.553) (-404.103) [-406.336] * [-404.391] (-404.306) (-407.701) (-406.718) -- 0:00:46
281000 -- (-404.234) (-407.554) [-403.740] (-405.538) * (-405.896) [-403.450] (-403.992) (-404.370) -- 0:00:46
281500 -- [-406.252] (-406.376) (-403.667) (-413.093) * (-404.282) [-407.415] (-408.459) (-404.203) -- 0:00:45
282000 -- (-403.735) [-405.107] (-407.713) (-405.241) * [-406.267] (-407.836) (-405.199) (-404.441) -- 0:00:45
282500 -- [-404.121] (-406.437) (-404.104) (-408.614) * (-405.238) [-405.778] (-404.863) (-406.222) -- 0:00:45
283000 -- (-406.622) (-404.288) [-404.043] (-405.644) * (-406.556) (-405.398) [-406.991] (-405.987) -- 0:00:45
283500 -- (-406.459) [-405.969] (-405.465) (-408.750) * (-407.427) (-405.551) (-403.523) [-403.596] -- 0:00:45
284000 -- (-407.845) (-404.421) (-404.855) [-406.696] * (-404.523) (-406.157) [-404.972] (-403.776) -- 0:00:45
284500 -- (-404.186) (-404.641) (-405.353) [-404.699] * (-403.403) (-407.255) (-410.858) [-404.926] -- 0:00:45
285000 -- (-406.195) [-404.966] (-410.116) (-407.417) * [-404.892] (-404.071) (-404.461) (-404.859) -- 0:00:45
Average standard deviation of split frequencies: 0.012839
285500 -- (-408.214) (-405.097) (-407.939) [-404.988] * (-406.460) [-404.887] (-405.187) (-404.918) -- 0:00:45
286000 -- [-405.464] (-408.421) (-413.866) (-408.165) * (-403.817) (-405.239) [-405.706] (-404.051) -- 0:00:44
286500 -- [-405.221] (-405.044) (-406.951) (-406.935) * (-406.311) (-405.091) [-407.900] (-407.095) -- 0:00:44
287000 -- [-404.881] (-405.544) (-405.732) (-404.038) * (-403.787) [-406.031] (-407.304) (-404.748) -- 0:00:44
287500 -- (-404.264) (-404.915) (-405.147) [-408.834] * (-406.796) (-406.714) [-404.185] (-405.764) -- 0:00:44
288000 -- [-406.530] (-407.246) (-405.379) (-404.639) * [-403.762] (-405.005) (-403.865) (-408.133) -- 0:00:44
288500 -- (-405.613) (-406.779) [-404.867] (-404.699) * (-405.346) (-403.873) [-403.822] (-406.081) -- 0:00:44
289000 -- [-405.892] (-404.902) (-404.228) (-408.068) * [-405.607] (-404.284) (-407.004) (-408.096) -- 0:00:44
289500 -- (-404.025) (-405.481) [-405.276] (-406.983) * (-407.608) [-403.964] (-405.994) (-406.968) -- 0:00:44
290000 -- (-405.600) (-404.653) (-408.313) [-403.759] * [-406.453] (-406.473) (-404.800) (-404.887) -- 0:00:44
Average standard deviation of split frequencies: 0.012524
290500 -- (-408.780) (-404.136) [-405.992] (-406.380) * (-405.138) [-407.626] (-404.803) (-408.808) -- 0:00:43
291000 -- (-406.019) [-406.669] (-405.083) (-404.040) * (-406.961) (-405.405) (-404.306) [-406.120] -- 0:00:43
291500 -- [-405.212] (-404.795) (-406.140) (-406.367) * [-405.748] (-405.876) (-406.914) (-405.446) -- 0:00:43
292000 -- (-409.537) (-404.992) [-404.299] (-405.921) * (-408.953) (-405.830) [-407.420] (-407.811) -- 0:00:43
292500 -- (-406.481) (-405.384) [-404.205] (-404.940) * (-404.194) (-405.107) (-404.428) [-405.219] -- 0:00:43
293000 -- (-407.271) (-406.032) [-404.618] (-404.968) * [-410.155] (-411.514) (-405.417) (-410.616) -- 0:00:43
293500 -- (-405.437) (-404.818) [-406.657] (-404.501) * (-414.754) [-405.391] (-406.949) (-409.361) -- 0:00:43
294000 -- (-405.869) (-408.669) (-406.986) [-404.463] * [-404.796] (-404.298) (-407.628) (-403.751) -- 0:00:45
294500 -- (-405.673) (-405.363) (-408.677) [-405.620] * (-404.109) [-407.893] (-408.867) (-403.612) -- 0:00:45
295000 -- (-405.238) [-405.939] (-406.126) (-404.145) * [-404.080] (-407.383) (-414.566) (-404.746) -- 0:00:45
Average standard deviation of split frequencies: 0.012475
295500 -- [-404.380] (-405.257) (-405.199) (-405.755) * (-405.643) [-403.943] (-409.007) (-404.463) -- 0:00:45
296000 -- (-404.494) [-409.411] (-406.278) (-405.397) * (-404.915) (-404.119) [-406.840] (-403.673) -- 0:00:45
296500 -- (-404.417) [-406.864] (-404.751) (-404.802) * [-405.260] (-405.398) (-409.108) (-404.023) -- 0:00:45
297000 -- (-405.022) (-406.117) [-404.237] (-404.120) * [-404.530] (-403.812) (-404.359) (-403.907) -- 0:00:44
297500 -- (-403.845) [-403.138] (-405.783) (-404.123) * (-406.160) (-406.902) [-406.509] (-405.343) -- 0:00:44
298000 -- [-404.214] (-407.999) (-417.851) (-404.175) * (-406.003) [-404.055] (-408.929) (-407.041) -- 0:00:44
298500 -- (-403.236) (-408.583) [-406.505] (-407.120) * (-409.561) (-403.945) [-406.627] (-413.840) -- 0:00:44
299000 -- (-407.786) (-403.847) (-406.106) [-404.452] * (-412.782) (-404.356) [-408.726] (-404.133) -- 0:00:44
299500 -- (-406.136) (-404.791) (-404.507) [-404.263] * (-407.895) (-407.708) [-404.982] (-408.096) -- 0:00:44
300000 -- (-406.275) (-404.438) (-404.761) [-404.730] * (-407.557) (-405.263) [-403.838] (-408.826) -- 0:00:44
Average standard deviation of split frequencies: 0.011933
300500 -- (-405.680) (-406.104) [-405.542] (-404.453) * (-408.500) (-408.586) (-404.861) [-406.053] -- 0:00:44
301000 -- (-406.404) (-405.024) (-403.675) [-404.285] * (-406.243) (-403.935) (-403.727) [-405.336] -- 0:00:44
301500 -- (-411.441) (-407.148) (-403.542) [-405.119] * (-404.140) (-403.308) (-406.751) [-406.798] -- 0:00:44
302000 -- (-406.472) [-404.190] (-404.054) (-405.926) * (-404.213) (-404.060) [-406.210] (-404.886) -- 0:00:43
302500 -- (-405.935) [-404.738] (-409.240) (-406.483) * (-404.910) (-405.902) [-405.758] (-403.796) -- 0:00:43
303000 -- [-404.092] (-405.150) (-404.587) (-405.223) * (-405.886) [-404.440] (-404.862) (-403.198) -- 0:00:43
303500 -- [-404.323] (-403.323) (-404.628) (-404.428) * (-406.195) [-404.056] (-405.893) (-404.683) -- 0:00:43
304000 -- [-403.520] (-408.762) (-404.498) (-407.913) * [-411.073] (-407.460) (-406.801) (-405.214) -- 0:00:43
304500 -- [-403.671] (-404.933) (-403.526) (-405.817) * (-407.428) (-410.379) (-405.518) [-405.452] -- 0:00:43
305000 -- [-403.626] (-405.254) (-404.111) (-403.600) * (-408.443) (-408.646) (-405.799) [-405.247] -- 0:00:43
Average standard deviation of split frequencies: 0.011896
305500 -- (-408.081) (-408.978) [-403.539] (-404.295) * [-406.224] (-406.019) (-404.793) (-406.399) -- 0:00:43
306000 -- (-406.397) (-404.819) (-404.528) [-406.039] * (-404.485) [-405.365] (-403.547) (-409.800) -- 0:00:43
306500 -- (-404.897) [-405.056] (-407.217) (-407.054) * (-404.122) (-404.840) [-405.880] (-407.091) -- 0:00:42
307000 -- [-405.303] (-404.384) (-405.770) (-405.905) * (-408.473) (-406.631) (-406.098) [-405.363] -- 0:00:42
307500 -- (-406.850) (-405.494) [-404.108] (-404.755) * (-404.253) [-408.286] (-408.075) (-407.247) -- 0:00:42
308000 -- [-408.043] (-404.562) (-405.754) (-404.908) * [-405.511] (-407.017) (-407.012) (-407.685) -- 0:00:42
308500 -- (-407.685) (-408.889) (-403.420) [-404.556] * (-406.893) [-407.295] (-403.972) (-405.126) -- 0:00:42
309000 -- (-408.142) (-405.396) [-403.687] (-407.805) * (-406.687) (-411.337) [-403.924] (-404.228) -- 0:00:42
309500 -- (-410.616) (-404.421) (-403.918) [-403.696] * [-406.521] (-403.415) (-404.730) (-407.113) -- 0:00:42
310000 -- (-406.462) (-404.674) (-405.899) [-404.193] * (-407.233) [-405.965] (-404.156) (-409.088) -- 0:00:42
Average standard deviation of split frequencies: 0.012055
310500 -- [-403.588] (-406.592) (-406.716) (-403.750) * [-407.152] (-410.833) (-406.787) (-406.177) -- 0:00:44
311000 -- (-409.362) (-405.893) (-407.893) [-404.158] * (-405.727) (-406.514) [-404.777] (-406.730) -- 0:00:44
311500 -- (-406.825) [-406.201] (-405.112) (-405.788) * (-404.195) (-405.712) [-405.690] (-407.084) -- 0:00:44
312000 -- (-404.553) [-406.176] (-413.957) (-405.063) * (-403.385) (-405.142) [-407.226] (-409.272) -- 0:00:44
312500 -- (-405.623) [-404.688] (-408.050) (-404.847) * (-404.657) (-403.763) (-408.498) [-404.248] -- 0:00:44
313000 -- [-405.315] (-405.258) (-404.727) (-404.559) * (-405.362) (-405.547) (-405.810) [-403.250] -- 0:00:43
313500 -- (-405.178) [-405.839] (-406.277) (-406.236) * [-408.099] (-403.740) (-404.180) (-406.172) -- 0:00:43
314000 -- [-405.081] (-403.818) (-411.118) (-407.146) * [-404.479] (-404.597) (-407.549) (-405.086) -- 0:00:43
314500 -- (-403.431) [-404.218] (-404.872) (-408.116) * (-404.153) [-403.597] (-409.273) (-406.442) -- 0:00:43
315000 -- (-403.775) [-404.538] (-407.277) (-407.008) * [-404.305] (-404.901) (-404.049) (-406.451) -- 0:00:43
Average standard deviation of split frequencies: 0.011106
315500 -- (-405.820) (-404.721) [-405.209] (-404.199) * (-407.100) [-404.595] (-406.357) (-404.337) -- 0:00:43
316000 -- [-403.244] (-404.545) (-405.035) (-403.317) * (-404.193) [-404.124] (-406.788) (-409.586) -- 0:00:43
316500 -- [-405.257] (-405.553) (-403.607) (-404.780) * [-404.459] (-404.324) (-403.766) (-406.272) -- 0:00:43
317000 -- (-405.661) [-404.010] (-406.730) (-405.393) * [-405.072] (-407.801) (-405.379) (-404.319) -- 0:00:43
317500 -- (-404.631) (-404.067) (-406.864) [-403.994] * (-403.904) [-406.833] (-407.361) (-405.204) -- 0:00:42
318000 -- (-403.527) (-404.555) (-407.968) [-405.414] * [-403.552] (-409.278) (-405.982) (-405.279) -- 0:00:42
318500 -- (-404.680) (-404.177) [-406.368] (-404.653) * (-403.553) (-408.840) [-405.145] (-408.146) -- 0:00:42
319000 -- [-406.091] (-405.935) (-403.934) (-403.913) * [-405.850] (-405.929) (-405.865) (-404.446) -- 0:00:42
319500 -- (-408.846) (-404.358) [-405.118] (-404.159) * (-407.362) [-407.033] (-404.665) (-403.266) -- 0:00:42
320000 -- [-405.695] (-403.831) (-403.891) (-405.091) * (-406.704) [-406.845] (-404.349) (-403.802) -- 0:00:42
Average standard deviation of split frequencies: 0.010699
320500 -- [-403.747] (-409.292) (-404.506) (-403.365) * [-403.455] (-407.845) (-404.218) (-404.383) -- 0:00:42
321000 -- (-406.514) (-405.732) [-409.325] (-403.832) * (-403.389) (-405.442) [-403.886] (-405.228) -- 0:00:42
321500 -- [-403.269] (-406.475) (-405.348) (-404.980) * [-406.988] (-405.340) (-403.289) (-405.075) -- 0:00:42
322000 -- (-405.250) (-407.265) [-404.315] (-405.077) * (-406.912) (-406.057) (-410.134) [-407.166] -- 0:00:42
322500 -- (-403.950) [-404.530] (-404.654) (-411.057) * (-403.246) [-403.791] (-405.998) (-405.260) -- 0:00:42
323000 -- (-407.468) (-405.786) [-405.353] (-412.639) * (-406.811) (-405.326) (-405.681) [-405.184] -- 0:00:41
323500 -- (-406.914) (-403.956) [-406.330] (-403.432) * (-405.292) (-404.556) [-408.375] (-408.550) -- 0:00:41
324000 -- [-404.711] (-407.491) (-405.705) (-409.357) * [-407.055] (-405.597) (-406.879) (-403.573) -- 0:00:41
324500 -- (-404.137) (-406.103) [-404.126] (-406.254) * (-408.843) [-403.310] (-408.920) (-405.343) -- 0:00:41
325000 -- [-403.871] (-406.425) (-404.272) (-404.210) * (-407.388) (-404.960) [-407.064] (-410.969) -- 0:00:41
Average standard deviation of split frequencies: 0.011167
325500 -- (-404.602) (-409.397) [-408.225] (-404.514) * [-408.421] (-406.721) (-409.076) (-407.492) -- 0:00:41
326000 -- (-407.867) [-406.604] (-405.490) (-403.972) * [-404.455] (-404.763) (-408.100) (-404.911) -- 0:00:41
326500 -- (-405.023) (-405.206) [-404.407] (-404.287) * (-406.584) (-407.397) (-406.533) [-404.798] -- 0:00:41
327000 -- [-403.394] (-406.239) (-405.520) (-404.721) * [-404.656] (-404.324) (-406.871) (-405.281) -- 0:00:41
327500 -- (-407.021) [-406.660] (-404.527) (-411.029) * (-405.658) (-406.247) [-406.570] (-405.544) -- 0:00:43
328000 -- [-404.383] (-406.262) (-403.998) (-407.894) * [-406.985] (-412.742) (-406.961) (-405.958) -- 0:00:43
328500 -- (-412.274) [-403.638] (-404.802) (-404.711) * (-405.143) (-404.559) (-404.390) [-403.474] -- 0:00:42
329000 -- (-409.175) (-404.125) (-405.343) [-403.679] * [-404.530] (-406.486) (-404.235) (-403.262) -- 0:00:42
329500 -- (-403.878) (-404.185) [-405.565] (-405.165) * (-407.017) [-406.110] (-404.541) (-403.186) -- 0:00:42
330000 -- (-404.581) (-406.163) [-408.384] (-413.266) * [-404.086] (-413.178) (-403.736) (-408.461) -- 0:00:42
Average standard deviation of split frequencies: 0.010217
330500 -- (-404.308) (-405.197) (-405.591) [-403.872] * (-409.808) (-409.111) (-405.659) [-404.700] -- 0:00:42
331000 -- (-407.259) [-405.037] (-406.715) (-405.689) * (-408.495) (-406.993) (-403.684) [-406.399] -- 0:00:42
331500 -- [-408.009] (-404.464) (-405.887) (-406.346) * [-405.552] (-410.537) (-408.375) (-404.520) -- 0:00:42
332000 -- (-403.625) [-406.516] (-404.935) (-405.397) * (-403.642) (-405.204) (-403.363) [-406.000] -- 0:00:42
332500 -- (-405.767) [-404.933] (-406.263) (-408.157) * (-404.462) (-406.391) [-406.503] (-405.334) -- 0:00:42
333000 -- [-404.119] (-407.507) (-404.678) (-404.107) * (-405.624) (-407.634) (-410.271) [-407.740] -- 0:00:42
333500 -- (-405.121) [-406.767] (-404.657) (-407.057) * (-407.010) (-404.315) [-406.273] (-406.840) -- 0:00:41
334000 -- [-404.733] (-408.824) (-408.229) (-407.234) * (-404.103) [-404.008] (-408.454) (-404.070) -- 0:00:41
334500 -- (-406.686) (-409.846) [-404.735] (-405.638) * (-403.999) (-404.472) (-404.585) [-405.064] -- 0:00:41
335000 -- [-405.652] (-404.016) (-405.812) (-403.755) * [-404.972] (-406.285) (-406.543) (-409.880) -- 0:00:41
Average standard deviation of split frequencies: 0.009665
335500 -- (-406.456) [-405.114] (-404.667) (-405.089) * (-403.625) (-407.474) [-407.069] (-410.117) -- 0:00:41
336000 -- (-405.666) (-403.509) (-404.490) [-404.511] * (-404.698) [-407.703] (-407.983) (-404.887) -- 0:00:41
336500 -- (-405.565) (-404.657) (-406.477) [-406.127] * (-406.190) (-405.377) [-404.416] (-408.974) -- 0:00:41
337000 -- (-404.538) [-410.267] (-406.320) (-407.075) * (-406.051) (-407.136) [-404.666] (-404.452) -- 0:00:41
337500 -- (-405.052) (-409.839) [-404.678] (-409.694) * [-404.687] (-406.892) (-406.719) (-403.754) -- 0:00:41
338000 -- [-405.587] (-407.942) (-404.324) (-409.150) * (-406.500) [-404.529] (-404.768) (-404.585) -- 0:00:41
338500 -- (-406.896) (-407.238) [-403.614] (-406.705) * (-403.926) (-405.120) (-406.086) [-406.139] -- 0:00:41
339000 -- (-405.545) (-406.484) (-406.197) [-404.037] * (-404.856) (-405.341) [-407.033] (-404.324) -- 0:00:40
339500 -- (-404.744) (-404.968) (-404.772) [-407.103] * [-406.954] (-404.097) (-403.998) (-404.768) -- 0:00:40
340000 -- (-406.424) [-404.664] (-406.260) (-405.466) * (-409.034) [-406.132] (-408.061) (-407.617) -- 0:00:40
Average standard deviation of split frequencies: 0.009605
340500 -- [-404.778] (-406.438) (-405.952) (-406.548) * (-405.144) [-405.182] (-404.899) (-405.895) -- 0:00:40
341000 -- (-405.806) (-406.995) [-406.801] (-406.351) * (-406.328) (-405.178) (-405.119) [-404.451] -- 0:00:40
341500 -- (-406.404) [-403.659] (-404.398) (-404.532) * (-405.118) (-404.365) (-403.807) [-404.049] -- 0:00:40
342000 -- (-409.750) [-406.567] (-408.824) (-409.439) * (-405.971) (-404.425) (-406.107) [-404.281] -- 0:00:40
342500 -- (-403.931) [-405.682] (-406.205) (-404.417) * (-405.093) [-403.301] (-408.161) (-406.309) -- 0:00:40
343000 -- (-404.706) (-408.191) [-404.342] (-408.195) * (-408.088) (-404.536) (-407.259) [-405.150] -- 0:00:40
343500 -- (-405.501) [-405.430] (-409.132) (-408.241) * [-407.510] (-405.725) (-404.757) (-406.738) -- 0:00:40
344000 -- (-404.918) (-406.722) [-409.059] (-405.496) * [-404.610] (-406.412) (-403.116) (-406.060) -- 0:00:40
344500 -- [-406.048] (-405.790) (-407.838) (-409.485) * (-403.858) (-403.519) [-405.507] (-403.176) -- 0:00:41
345000 -- (-406.492) (-406.666) [-404.950] (-406.239) * [-405.120] (-405.071) (-405.175) (-409.842) -- 0:00:41
Average standard deviation of split frequencies: 0.009605
345500 -- (-406.494) [-405.443] (-403.820) (-404.847) * [-408.707] (-404.608) (-404.006) (-407.485) -- 0:00:41
346000 -- [-404.357] (-406.226) (-406.228) (-408.960) * [-405.063] (-408.466) (-404.323) (-405.436) -- 0:00:41
346500 -- [-404.329] (-404.520) (-405.672) (-408.571) * [-404.932] (-403.951) (-411.097) (-406.695) -- 0:00:41
347000 -- [-406.653] (-404.364) (-404.224) (-408.113) * [-409.016] (-404.146) (-408.809) (-404.379) -- 0:00:41
347500 -- (-404.548) [-404.654] (-403.902) (-406.412) * [-404.361] (-406.115) (-406.291) (-408.588) -- 0:00:41
348000 -- (-404.909) [-404.082] (-404.598) (-404.954) * [-407.725] (-405.260) (-407.768) (-407.179) -- 0:00:41
348500 -- (-407.723) (-404.689) (-408.927) [-404.564] * (-406.295) (-407.144) (-412.788) [-403.925] -- 0:00:41
349000 -- (-405.318) (-406.012) (-407.672) [-406.543] * (-405.108) (-405.505) [-403.723] (-404.430) -- 0:00:41
349500 -- (-406.074) (-403.731) (-404.558) [-405.517] * [-404.933] (-405.756) (-404.222) (-408.242) -- 0:00:40
350000 -- (-406.443) [-404.043] (-404.667) (-404.620) * (-405.993) (-405.290) (-406.766) [-405.629] -- 0:00:40
Average standard deviation of split frequencies: 0.008805
350500 -- (-405.157) [-405.067] (-405.825) (-406.746) * (-407.612) [-403.874] (-404.133) (-404.650) -- 0:00:40
351000 -- [-405.296] (-404.780) (-408.543) (-405.441) * (-406.873) [-403.812] (-404.019) (-404.158) -- 0:00:40
351500 -- (-406.417) (-407.148) [-407.022] (-406.946) * (-406.670) [-405.117] (-403.642) (-404.545) -- 0:00:40
352000 -- [-405.721] (-403.954) (-403.468) (-403.442) * (-404.975) (-408.327) [-403.935] (-403.745) -- 0:00:40
352500 -- [-410.582] (-405.312) (-404.839) (-403.994) * (-409.621) [-406.437] (-407.382) (-403.233) -- 0:00:40
353000 -- (-405.399) (-407.054) [-403.803] (-414.104) * (-404.920) [-404.538] (-408.251) (-406.932) -- 0:00:40
353500 -- (-406.917) [-404.944] (-404.975) (-410.302) * (-407.950) (-404.218) (-405.315) [-404.831] -- 0:00:40
354000 -- (-405.704) (-404.494) (-403.793) [-404.482] * (-405.912) (-404.843) [-405.985] (-405.462) -- 0:00:40
354500 -- (-408.428) (-407.306) [-403.945] (-409.330) * (-406.107) (-404.189) (-403.407) [-404.319] -- 0:00:40
355000 -- [-404.047] (-406.351) (-404.185) (-406.177) * (-405.686) (-404.302) [-404.465] (-406.204) -- 0:00:39
Average standard deviation of split frequencies: 0.009468
355500 -- (-408.013) (-407.198) (-404.907) [-405.163] * (-405.903) (-405.428) [-404.741] (-412.989) -- 0:00:39
356000 -- (-404.113) (-405.501) (-406.071) [-404.229] * (-407.176) [-404.830] (-408.012) (-404.010) -- 0:00:39
356500 -- (-404.129) [-404.652] (-406.685) (-404.337) * (-404.429) (-404.211) [-411.405] (-404.186) -- 0:00:39
357000 -- (-403.903) (-406.297) [-405.073] (-405.783) * (-406.196) (-405.612) [-406.953] (-405.435) -- 0:00:39
357500 -- [-405.919] (-406.288) (-404.878) (-403.908) * (-407.095) [-405.472] (-406.033) (-405.224) -- 0:00:39
358000 -- (-407.060) [-403.626] (-404.608) (-404.756) * (-408.968) (-406.596) [-404.492] (-404.800) -- 0:00:39
358500 -- (-405.998) (-404.006) (-406.077) [-407.387] * (-406.281) (-406.580) (-404.764) [-406.517] -- 0:00:39
359000 -- [-405.912] (-406.338) (-407.338) (-413.530) * (-407.388) [-403.395] (-405.769) (-403.656) -- 0:00:39
359500 -- [-408.515] (-405.418) (-405.899) (-407.045) * [-403.713] (-405.375) (-404.491) (-406.961) -- 0:00:39
360000 -- [-406.920] (-403.544) (-405.058) (-404.326) * (-405.447) (-405.660) (-405.191) [-403.534] -- 0:00:39
Average standard deviation of split frequencies: 0.010250
360500 -- (-404.353) (-407.688) (-404.761) [-410.412] * (-410.032) (-404.133) (-407.105) [-404.405] -- 0:00:39
361000 -- (-405.244) (-409.795) (-405.842) [-406.738] * (-406.929) (-408.992) (-403.668) [-403.667] -- 0:00:40
361500 -- (-406.134) (-405.815) (-407.704) [-403.902] * (-410.265) (-407.034) [-406.177] (-405.883) -- 0:00:40
362000 -- [-405.718] (-404.539) (-405.280) (-407.658) * (-403.602) (-404.044) (-404.805) [-403.920] -- 0:00:40
362500 -- (-413.243) (-405.141) [-405.903] (-405.182) * [-404.284] (-404.506) (-404.722) (-408.293) -- 0:00:40
363000 -- (-405.754) [-405.148] (-411.222) (-406.076) * (-405.004) [-404.751] (-406.218) (-409.285) -- 0:00:40
363500 -- (-408.936) [-404.845] (-404.882) (-403.797) * (-406.020) [-406.848] (-405.517) (-408.856) -- 0:00:40
364000 -- (-408.330) [-403.723] (-409.597) (-406.043) * (-405.629) (-404.068) [-406.670] (-406.283) -- 0:00:40
364500 -- (-407.940) (-406.765) [-407.641] (-403.613) * (-404.605) [-405.622] (-407.869) (-405.866) -- 0:00:40
365000 -- (-404.150) [-405.944] (-408.407) (-404.281) * [-404.976] (-404.280) (-404.880) (-404.291) -- 0:00:40
Average standard deviation of split frequencies: 0.010755
365500 -- (-405.819) [-407.522] (-407.893) (-404.682) * (-405.174) (-405.848) (-404.787) [-409.601] -- 0:00:39
366000 -- (-406.892) [-404.705] (-406.591) (-406.067) * (-406.850) (-409.008) [-404.951] (-406.003) -- 0:00:39
366500 -- (-404.948) [-403.748] (-407.109) (-405.872) * (-404.809) (-409.672) [-404.730] (-405.533) -- 0:00:39
367000 -- (-406.367) (-408.523) [-405.063] (-411.055) * (-405.186) (-407.367) (-408.709) [-406.854] -- 0:00:39
367500 -- [-408.650] (-405.267) (-406.513) (-405.508) * (-403.988) [-404.404] (-405.805) (-404.519) -- 0:00:39
368000 -- (-405.672) [-404.491] (-410.346) (-409.794) * (-403.694) (-406.766) [-409.404] (-407.651) -- 0:00:39
368500 -- (-404.792) (-409.071) [-404.770] (-407.896) * [-403.372] (-407.506) (-406.800) (-406.915) -- 0:00:39
369000 -- (-405.196) [-405.670] (-406.715) (-406.213) * (-405.005) [-403.839] (-407.338) (-407.281) -- 0:00:39
369500 -- (-404.507) (-409.800) [-407.572] (-406.357) * [-403.167] (-406.201) (-406.692) (-405.833) -- 0:00:39
370000 -- (-407.001) (-405.971) [-405.500] (-410.285) * [-404.711] (-404.852) (-405.260) (-404.355) -- 0:00:39
Average standard deviation of split frequencies: 0.010238
370500 -- (-410.125) (-403.632) (-404.893) [-405.756] * (-404.217) (-404.908) [-407.700] (-404.713) -- 0:00:39
371000 -- (-406.130) (-406.509) [-403.601] (-407.035) * (-405.623) [-406.724] (-409.317) (-405.302) -- 0:00:38
371500 -- (-406.724) [-404.029] (-404.922) (-407.640) * (-405.492) (-407.812) (-406.932) [-405.337] -- 0:00:38
372000 -- (-408.755) [-404.888] (-406.277) (-404.243) * (-404.152) (-406.517) (-404.981) [-408.281] -- 0:00:38
372500 -- [-403.356] (-403.239) (-404.506) (-406.040) * (-407.757) (-405.903) [-404.963] (-403.494) -- 0:00:38
373000 -- (-403.615) (-404.518) [-405.291] (-405.932) * (-408.261) [-405.370] (-405.071) (-407.141) -- 0:00:38
373500 -- (-406.057) (-409.725) [-406.809] (-405.655) * (-403.627) (-406.672) (-406.634) [-404.244] -- 0:00:38
374000 -- [-404.290] (-405.263) (-404.943) (-410.203) * (-406.571) (-408.186) [-403.667] (-406.621) -- 0:00:38
374500 -- (-403.533) [-404.469] (-404.827) (-406.280) * [-404.241] (-407.219) (-408.912) (-405.346) -- 0:00:38
375000 -- [-404.955] (-404.799) (-404.192) (-406.969) * [-408.455] (-407.948) (-406.972) (-405.616) -- 0:00:38
Average standard deviation of split frequencies: 0.009040
375500 -- (-404.768) (-409.042) (-406.633) [-408.005] * (-404.796) (-406.011) (-404.410) [-405.332] -- 0:00:38
376000 -- (-404.802) (-404.526) (-404.683) [-407.466] * (-406.436) [-404.005] (-404.523) (-409.287) -- 0:00:38
376500 -- (-405.946) [-405.575] (-403.908) (-406.750) * [-403.902] (-409.023) (-404.815) (-406.922) -- 0:00:38
377000 -- (-406.312) (-405.882) [-406.380] (-407.600) * (-404.861) [-405.423] (-407.057) (-406.571) -- 0:00:38
377500 -- [-406.521] (-404.057) (-404.750) (-406.220) * [-403.681] (-405.102) (-405.001) (-404.274) -- 0:00:37
378000 -- (-404.694) (-404.964) [-405.005] (-405.343) * (-404.032) (-405.821) (-404.492) [-407.028] -- 0:00:39
378500 -- (-407.117) (-405.327) [-406.378] (-406.225) * (-403.204) (-407.107) [-407.044] (-405.284) -- 0:00:39
379000 -- [-406.705] (-403.376) (-407.176) (-406.755) * (-405.323) [-405.220] (-405.237) (-403.958) -- 0:00:39
379500 -- (-405.540) (-406.389) [-406.338] (-407.526) * (-404.261) (-407.173) (-404.862) [-404.167] -- 0:00:39
380000 -- (-406.527) (-405.616) (-407.866) [-406.070] * (-406.606) (-406.192) [-403.696] (-406.491) -- 0:00:39
Average standard deviation of split frequencies: 0.008960
380500 -- (-404.537) [-403.514] (-408.978) (-407.899) * [-404.753] (-405.985) (-407.532) (-403.597) -- 0:00:39
381000 -- (-403.903) [-405.438] (-411.036) (-408.198) * (-410.054) (-406.746) (-407.483) [-404.267] -- 0:00:38
381500 -- [-405.201] (-403.454) (-406.621) (-407.895) * (-404.513) [-406.616] (-405.590) (-403.695) -- 0:00:38
382000 -- (-408.433) (-410.749) [-406.377] (-404.287) * (-405.222) [-405.195] (-405.370) (-406.739) -- 0:00:38
382500 -- (-405.007) (-403.620) (-404.095) [-404.930] * (-409.181) (-404.152) (-405.036) [-404.056] -- 0:00:38
383000 -- (-406.932) (-405.139) (-405.867) [-403.789] * (-405.926) [-408.457] (-406.563) (-404.644) -- 0:00:38
383500 -- (-406.871) (-404.555) [-407.021] (-406.295) * [-406.086] (-403.117) (-403.766) (-404.221) -- 0:00:38
384000 -- (-404.212) (-405.561) [-403.729] (-405.371) * (-405.163) [-403.081] (-403.583) (-410.168) -- 0:00:38
384500 -- [-409.616] (-406.670) (-403.968) (-404.146) * (-409.525) (-404.480) (-404.391) [-409.638] -- 0:00:38
385000 -- (-406.639) [-405.530] (-404.779) (-407.782) * (-405.705) [-404.065] (-404.017) (-412.239) -- 0:00:38
Average standard deviation of split frequencies: 0.009431
385500 -- (-403.939) (-403.726) [-404.748] (-404.947) * (-405.598) (-409.736) [-404.468] (-406.403) -- 0:00:38
386000 -- (-405.214) (-403.331) [-404.276] (-404.053) * (-404.091) (-405.422) (-404.701) [-409.549] -- 0:00:38
386500 -- [-403.752] (-405.735) (-406.448) (-404.047) * [-404.547] (-404.058) (-403.796) (-405.395) -- 0:00:38
387000 -- [-403.601] (-410.127) (-405.766) (-404.980) * (-403.901) (-404.248) [-404.623] (-407.275) -- 0:00:38
387500 -- (-407.852) (-403.774) (-404.330) [-404.568] * (-403.812) [-407.870] (-408.191) (-406.559) -- 0:00:37
388000 -- [-407.305] (-405.114) (-403.324) (-405.511) * (-404.015) (-405.603) [-405.022] (-408.296) -- 0:00:37
388500 -- (-405.323) [-406.271] (-403.225) (-407.683) * (-405.503) (-404.349) [-404.350] (-405.384) -- 0:00:37
389000 -- (-404.472) (-405.251) [-404.091] (-403.532) * [-407.281] (-405.812) (-404.805) (-405.003) -- 0:00:37
389500 -- (-406.087) [-405.690] (-406.230) (-403.986) * (-404.599) [-404.764] (-407.387) (-409.890) -- 0:00:37
390000 -- (-403.662) [-405.955] (-406.717) (-410.347) * (-407.174) (-405.811) [-404.221] (-406.478) -- 0:00:37
Average standard deviation of split frequencies: 0.009653
390500 -- [-404.224] (-406.214) (-404.596) (-413.984) * (-404.845) (-407.033) [-405.204] (-406.295) -- 0:00:37
391000 -- (-405.555) [-405.412] (-404.138) (-408.860) * (-405.213) (-405.124) [-404.950] (-405.055) -- 0:00:37
391500 -- (-405.032) (-405.234) [-404.529] (-408.343) * (-404.889) (-404.129) (-405.030) [-405.199] -- 0:00:37
392000 -- (-406.557) (-404.914) (-404.469) [-405.017] * (-406.253) (-404.854) [-407.545] (-406.995) -- 0:00:37
392500 -- [-405.173] (-405.127) (-407.748) (-404.818) * (-408.462) (-403.797) (-404.386) [-405.918] -- 0:00:37
393000 -- (-404.329) (-403.794) (-404.560) [-404.461] * (-408.530) [-404.315] (-408.560) (-407.404) -- 0:00:37
393500 -- (-404.598) (-403.791) [-403.998] (-404.739) * (-408.033) (-405.815) (-404.414) [-404.889] -- 0:00:36
394000 -- (-406.199) (-403.869) (-406.450) [-405.017] * (-408.257) (-405.134) [-405.058] (-403.827) -- 0:00:36
394500 -- (-404.010) [-404.483] (-405.050) (-407.094) * (-404.653) (-408.162) [-404.388] (-406.800) -- 0:00:36
395000 -- (-404.632) (-404.402) (-405.322) [-404.586] * (-406.291) [-404.885] (-405.085) (-405.600) -- 0:00:38
Average standard deviation of split frequencies: 0.009656
395500 -- [-406.131] (-404.309) (-404.551) (-403.865) * (-405.979) [-405.486] (-403.465) (-409.261) -- 0:00:38
396000 -- [-408.466] (-406.373) (-405.658) (-404.029) * (-406.114) (-406.194) (-405.772) [-406.916] -- 0:00:38
396500 -- (-409.857) (-404.068) [-406.313] (-403.914) * (-410.183) (-410.078) [-403.627] (-404.981) -- 0:00:38
397000 -- (-409.115) (-405.533) (-405.756) [-406.456] * [-406.032] (-405.624) (-405.683) (-408.577) -- 0:00:37
397500 -- (-404.273) (-403.626) (-406.247) [-407.036] * [-405.333] (-404.060) (-405.202) (-406.248) -- 0:00:37
398000 -- (-405.166) [-406.185] (-408.856) (-405.362) * [-406.863] (-405.387) (-406.391) (-404.026) -- 0:00:37
398500 -- (-404.840) (-406.055) [-407.205] (-407.982) * [-404.088] (-404.530) (-410.368) (-405.011) -- 0:00:37
399000 -- [-404.290] (-406.089) (-409.309) (-407.892) * [-405.384] (-403.431) (-404.062) (-404.243) -- 0:00:37
399500 -- (-407.186) (-408.051) (-403.321) [-406.305] * [-405.351] (-403.948) (-407.842) (-405.590) -- 0:00:37
400000 -- (-408.026) (-410.538) [-405.292] (-409.178) * (-404.438) [-404.143] (-406.163) (-405.335) -- 0:00:37
Average standard deviation of split frequencies: 0.009216
400500 -- (-404.874) (-412.258) [-405.696] (-404.000) * [-403.874] (-404.952) (-407.728) (-405.091) -- 0:00:37
401000 -- (-407.867) [-403.601] (-406.069) (-404.919) * (-405.806) [-404.161] (-404.458) (-407.395) -- 0:00:37
401500 -- (-406.964) (-404.102) [-405.923] (-408.457) * (-405.690) (-403.184) [-406.037] (-404.969) -- 0:00:37
402000 -- (-408.026) (-406.254) (-407.138) [-405.114] * (-406.213) (-404.485) [-405.394] (-403.561) -- 0:00:37
402500 -- [-404.382] (-405.579) (-407.413) (-409.042) * (-405.128) (-405.949) (-405.550) [-406.762] -- 0:00:37
403000 -- (-405.035) (-404.657) [-403.459] (-410.227) * [-405.028] (-405.197) (-406.226) (-405.029) -- 0:00:37
403500 -- (-403.523) [-404.794] (-403.304) (-406.160) * [-405.952] (-404.601) (-405.077) (-405.243) -- 0:00:36
404000 -- (-405.036) [-403.945] (-404.695) (-404.300) * (-406.431) (-405.423) (-404.290) [-406.809] -- 0:00:36
404500 -- [-403.699] (-404.997) (-406.580) (-405.762) * [-405.718] (-404.308) (-405.165) (-405.011) -- 0:00:36
405000 -- (-406.026) [-406.587] (-415.082) (-404.271) * (-403.200) (-407.712) (-404.309) [-404.882] -- 0:00:36
Average standard deviation of split frequencies: 0.010108
405500 -- [-406.679] (-407.192) (-405.755) (-406.699) * [-403.643] (-407.095) (-408.824) (-404.255) -- 0:00:36
406000 -- (-408.024) (-406.933) (-404.223) [-404.379] * (-407.158) (-406.391) (-405.231) [-404.060] -- 0:00:36
406500 -- (-405.247) (-404.662) (-413.596) [-403.581] * [-403.996] (-406.928) (-406.286) (-404.235) -- 0:00:36
407000 -- (-405.032) (-407.091) [-405.567] (-404.037) * [-405.712] (-409.151) (-406.720) (-404.683) -- 0:00:36
407500 -- (-404.683) (-403.856) [-406.555] (-404.768) * (-404.661) [-404.603] (-404.944) (-405.786) -- 0:00:36
408000 -- [-405.950] (-403.544) (-409.276) (-404.806) * (-405.538) (-403.715) (-409.668) [-408.538] -- 0:00:36
408500 -- (-406.410) (-404.265) (-407.052) [-407.909] * (-406.500) (-403.884) [-406.871] (-405.415) -- 0:00:36
409000 -- [-406.279] (-403.469) (-404.721) (-408.161) * (-404.392) (-405.756) [-404.197] (-403.203) -- 0:00:36
409500 -- (-405.661) [-405.576] (-405.820) (-411.491) * (-404.706) (-404.098) [-404.231] (-404.463) -- 0:00:36
410000 -- (-406.771) [-403.762] (-406.878) (-406.174) * (-407.758) (-404.531) (-406.426) [-405.163] -- 0:00:35
Average standard deviation of split frequencies: 0.010196
410500 -- [-404.817] (-404.532) (-404.698) (-407.298) * [-404.976] (-403.925) (-410.161) (-405.133) -- 0:00:35
411000 -- (-405.430) (-404.926) (-409.335) [-406.194] * [-404.306] (-404.791) (-404.719) (-404.197) -- 0:00:35
411500 -- [-403.349] (-408.378) (-410.201) (-405.620) * (-407.772) (-407.268) (-403.368) [-404.174] -- 0:00:37
412000 -- (-405.121) (-411.103) [-407.503] (-404.060) * (-403.824) (-405.110) [-407.330] (-405.979) -- 0:00:37
412500 -- (-407.595) (-403.988) (-406.001) [-404.972] * (-408.653) (-406.446) (-408.237) [-404.306] -- 0:00:37
413000 -- [-404.419] (-408.333) (-407.887) (-405.111) * [-405.301] (-409.840) (-405.765) (-405.327) -- 0:00:36
413500 -- (-403.514) (-405.816) (-410.006) [-406.429] * (-404.060) (-410.757) (-403.518) [-404.540] -- 0:00:36
414000 -- (-405.249) [-405.413] (-407.397) (-405.186) * [-404.704] (-406.922) (-405.063) (-405.900) -- 0:00:36
414500 -- (-404.902) [-404.508] (-403.724) (-404.083) * (-408.503) [-407.606] (-405.717) (-404.305) -- 0:00:36
415000 -- (-407.002) [-404.754] (-406.131) (-403.996) * [-403.929] (-404.228) (-408.859) (-404.218) -- 0:00:36
Average standard deviation of split frequencies: 0.010865
415500 -- (-410.405) (-407.430) [-404.215] (-405.057) * [-403.786] (-408.825) (-404.906) (-404.408) -- 0:00:36
416000 -- (-406.428) (-407.715) [-404.012] (-406.722) * (-405.594) (-407.772) [-408.116] (-406.108) -- 0:00:36
416500 -- [-404.402] (-406.642) (-405.014) (-404.468) * (-405.654) (-410.462) (-406.451) [-405.203] -- 0:00:36
417000 -- (-404.442) (-404.621) (-404.974) [-405.997] * (-405.381) (-407.253) [-405.962] (-405.074) -- 0:00:36
417500 -- (-404.442) (-404.321) [-403.829] (-405.407) * (-406.191) (-407.653) (-405.203) [-404.416] -- 0:00:36
418000 -- (-403.326) [-406.038] (-405.002) (-406.477) * (-407.195) (-404.230) (-407.337) [-403.527] -- 0:00:36
418500 -- [-404.063] (-404.568) (-403.806) (-406.035) * (-403.781) [-406.122] (-406.307) (-408.048) -- 0:00:36
419000 -- (-407.316) [-407.766] (-404.586) (-405.837) * (-404.620) (-406.554) (-405.522) [-405.396] -- 0:00:36
419500 -- [-405.256] (-405.632) (-405.199) (-404.881) * (-404.017) (-404.133) [-405.762] (-404.206) -- 0:00:35
420000 -- (-409.992) [-404.748] (-406.746) (-407.963) * [-404.515] (-406.449) (-405.356) (-406.697) -- 0:00:35
Average standard deviation of split frequencies: 0.009035
420500 -- [-405.141] (-404.302) (-404.772) (-404.597) * [-404.825] (-404.885) (-407.765) (-405.077) -- 0:00:35
421000 -- [-405.202] (-405.018) (-405.581) (-404.697) * (-404.403) [-404.102] (-408.397) (-404.473) -- 0:00:35
421500 -- [-404.847] (-404.478) (-403.926) (-405.500) * (-404.075) (-404.085) (-405.696) [-404.120] -- 0:00:35
422000 -- [-404.100] (-405.288) (-406.286) (-403.682) * (-405.458) [-404.166] (-403.633) (-404.328) -- 0:00:35
422500 -- [-407.087] (-404.253) (-404.190) (-408.962) * (-403.551) [-403.411] (-405.350) (-405.212) -- 0:00:35
423000 -- (-411.276) (-405.529) (-403.936) [-406.298] * (-406.065) (-404.082) (-407.864) [-403.495] -- 0:00:35
423500 -- (-408.201) (-404.136) [-404.693] (-404.979) * (-403.838) (-405.755) (-405.568) [-405.263] -- 0:00:35
424000 -- (-403.541) (-405.451) [-405.899] (-406.660) * (-405.149) (-404.288) [-406.810] (-403.554) -- 0:00:35
424500 -- (-406.913) [-405.304] (-403.242) (-410.941) * [-406.480] (-404.364) (-408.232) (-403.682) -- 0:00:35
425000 -- (-405.059) (-403.987) [-403.527] (-404.019) * (-404.939) [-408.327] (-404.536) (-403.854) -- 0:00:35
Average standard deviation of split frequencies: 0.008503
425500 -- (-403.485) [-405.607] (-406.400) (-404.292) * [-404.492] (-409.270) (-405.565) (-408.791) -- 0:00:35
426000 -- (-405.747) (-404.116) [-409.720] (-405.311) * (-404.220) (-408.716) [-407.606] (-408.209) -- 0:00:35
426500 -- (-405.815) (-403.760) [-403.499] (-406.710) * (-405.402) (-408.857) (-404.769) [-406.461] -- 0:00:34
427000 -- [-407.039] (-406.945) (-405.980) (-406.826) * (-404.130) (-403.704) [-403.763] (-406.455) -- 0:00:34
427500 -- [-404.757] (-404.414) (-404.299) (-405.320) * [-405.218] (-403.649) (-403.170) (-404.302) -- 0:00:34
428000 -- [-405.541] (-405.528) (-406.031) (-408.014) * (-405.532) (-409.483) [-405.015] (-405.698) -- 0:00:34
428500 -- (-406.435) (-407.288) (-404.011) [-403.821] * (-405.649) (-408.261) (-404.722) [-405.589] -- 0:00:36
429000 -- (-406.814) (-407.430) (-404.815) [-404.573] * (-403.637) (-405.926) (-404.554) [-406.344] -- 0:00:35
429500 -- (-405.885) (-412.336) (-405.111) [-403.612] * (-405.570) (-406.090) (-403.986) [-405.845] -- 0:00:35
430000 -- [-406.092] (-410.559) (-406.026) (-403.659) * (-405.565) [-404.720] (-407.340) (-405.951) -- 0:00:35
Average standard deviation of split frequencies: 0.008526
430500 -- [-405.848] (-408.838) (-403.745) (-406.096) * [-405.610] (-407.224) (-405.130) (-408.079) -- 0:00:35
431000 -- (-406.748) [-411.489] (-404.942) (-408.573) * (-406.170) [-404.118] (-404.120) (-404.924) -- 0:00:35
431500 -- (-404.028) [-410.861] (-405.734) (-403.962) * [-407.071] (-404.407) (-410.421) (-410.738) -- 0:00:35
432000 -- [-404.195] (-406.730) (-404.833) (-405.572) * (-405.429) (-404.146) [-409.305] (-405.650) -- 0:00:35
432500 -- [-405.778] (-405.584) (-405.126) (-405.477) * (-404.540) [-405.014] (-407.128) (-406.745) -- 0:00:35
433000 -- (-403.301) (-406.774) (-405.914) [-409.632] * (-403.731) [-404.427] (-405.156) (-404.951) -- 0:00:35
433500 -- [-404.537] (-404.838) (-404.953) (-405.532) * (-407.029) (-406.352) [-403.717] (-406.472) -- 0:00:35
434000 -- [-406.217] (-409.218) (-408.205) (-407.827) * (-406.617) [-405.551] (-403.946) (-404.074) -- 0:00:35
434500 -- (-405.390) (-408.626) [-404.171] (-406.604) * (-403.765) (-406.699) [-406.237] (-405.205) -- 0:00:35
435000 -- (-414.404) (-403.859) [-404.807] (-413.577) * (-404.876) (-403.488) [-404.630] (-404.327) -- 0:00:35
Average standard deviation of split frequencies: 0.009276
435500 -- (-405.724) (-406.425) (-406.740) [-406.235] * (-405.439) (-403.796) (-406.698) [-403.505] -- 0:00:34
436000 -- (-407.765) (-406.083) (-409.370) [-406.255] * (-404.727) [-403.810] (-405.542) (-406.023) -- 0:00:34
436500 -- (-406.762) [-404.003] (-405.841) (-406.453) * (-404.062) (-407.380) (-407.527) [-406.070] -- 0:00:34
437000 -- (-405.526) (-403.801) [-404.452] (-407.887) * [-405.771] (-411.591) (-404.103) (-405.997) -- 0:00:34
437500 -- (-409.234) [-405.377] (-407.068) (-408.997) * (-406.598) (-405.345) (-407.023) [-405.136] -- 0:00:34
438000 -- (-405.943) (-403.508) (-406.830) [-404.546] * (-404.652) (-403.390) [-404.632] (-405.550) -- 0:00:34
438500 -- (-405.208) (-409.265) (-407.823) [-406.543] * (-407.045) (-405.433) [-405.189] (-406.002) -- 0:00:34
439000 -- [-406.523] (-405.930) (-404.682) (-408.195) * (-406.818) (-405.261) (-406.668) [-405.801] -- 0:00:34
439500 -- (-407.493) [-403.603] (-406.415) (-410.430) * (-408.225) (-404.770) (-405.006) [-406.045] -- 0:00:34
440000 -- [-407.695] (-404.585) (-405.296) (-407.021) * [-406.531] (-404.151) (-405.961) (-407.374) -- 0:00:34
Average standard deviation of split frequencies: 0.009008
440500 -- (-410.511) (-405.212) (-405.103) [-404.929] * (-405.365) [-405.392] (-408.933) (-404.054) -- 0:00:34
441000 -- (-405.455) [-404.102] (-408.156) (-404.268) * (-406.257) [-403.891] (-407.596) (-406.992) -- 0:00:34
441500 -- (-405.118) (-404.580) [-405.082] (-405.194) * (-404.614) (-405.715) (-405.825) [-403.270] -- 0:00:34
442000 -- (-404.945) (-407.295) (-407.083) [-407.894] * [-408.309] (-404.159) (-406.281) (-405.681) -- 0:00:34
442500 -- (-406.899) (-408.565) (-406.420) [-405.108] * (-406.878) [-403.136] (-404.140) (-403.899) -- 0:00:34
443000 -- [-404.570] (-404.308) (-404.398) (-408.099) * (-403.795) (-404.483) [-406.149] (-404.722) -- 0:00:33
443500 -- (-404.532) (-407.996) [-403.676] (-406.381) * (-407.867) [-404.735] (-403.711) (-404.409) -- 0:00:33
444000 -- (-404.405) [-405.705] (-403.567) (-408.313) * (-406.474) (-403.123) (-405.287) [-407.351] -- 0:00:33
444500 -- (-404.528) (-407.699) [-404.923] (-409.808) * (-405.853) (-405.464) (-407.042) [-404.320] -- 0:00:33
445000 -- (-404.478) (-405.871) [-406.477] (-403.081) * (-405.645) (-408.655) (-405.044) [-404.507] -- 0:00:33
Average standard deviation of split frequencies: 0.008845
445500 -- (-404.841) (-408.162) [-404.267] (-403.438) * [-406.463] (-410.519) (-407.269) (-405.330) -- 0:00:34
446000 -- [-407.480] (-408.372) (-403.048) (-404.090) * (-408.293) [-405.813] (-404.332) (-409.464) -- 0:00:34
446500 -- [-404.455] (-406.355) (-405.408) (-408.094) * (-404.669) (-404.586) (-405.667) [-410.373] -- 0:00:34
447000 -- (-404.318) [-405.838] (-408.789) (-410.568) * [-403.568] (-407.434) (-406.509) (-404.306) -- 0:00:34
447500 -- [-406.555] (-404.696) (-407.183) (-405.485) * (-403.166) [-406.863] (-404.436) (-406.461) -- 0:00:34
448000 -- (-405.018) [-405.755] (-404.607) (-406.756) * (-404.777) (-410.573) [-403.596] (-405.613) -- 0:00:34
448500 -- [-405.685] (-404.660) (-405.585) (-404.731) * (-406.047) (-406.033) (-405.384) [-405.634] -- 0:00:34
449000 -- (-404.837) (-406.078) (-406.207) [-407.746] * (-408.379) [-404.272] (-404.093) (-405.977) -- 0:00:34
449500 -- [-405.195] (-405.668) (-404.361) (-404.452) * (-405.661) (-403.495) (-404.249) [-405.049] -- 0:00:34
450000 -- [-405.435] (-405.071) (-405.530) (-404.815) * (-404.669) (-405.464) [-403.585] (-405.435) -- 0:00:34
Average standard deviation of split frequencies: 0.007873
450500 -- [-406.607] (-404.375) (-405.954) (-405.964) * (-404.405) (-409.317) [-403.805] (-405.628) -- 0:00:34
451000 -- [-405.687] (-404.708) (-407.493) (-403.425) * (-403.941) [-405.081] (-407.302) (-404.835) -- 0:00:34
451500 -- [-406.090] (-406.340) (-404.223) (-405.924) * (-403.586) [-404.630] (-405.375) (-407.232) -- 0:00:34
452000 -- [-407.863] (-405.293) (-404.363) (-406.693) * (-404.934) (-406.913) [-407.292] (-404.976) -- 0:00:33
452500 -- (-408.567) [-404.643] (-404.043) (-410.347) * (-404.242) (-406.432) (-405.012) [-404.776] -- 0:00:33
453000 -- (-405.620) [-406.234] (-405.077) (-405.683) * (-409.364) [-406.058] (-407.226) (-404.914) -- 0:00:33
453500 -- (-403.607) [-407.468] (-407.145) (-404.901) * (-405.010) (-404.235) [-406.928] (-406.422) -- 0:00:33
454000 -- [-403.062] (-407.111) (-405.448) (-405.704) * [-404.542] (-404.204) (-410.378) (-408.479) -- 0:00:33
454500 -- (-403.355) [-405.755] (-405.596) (-406.099) * (-403.182) (-407.220) [-406.099] (-409.691) -- 0:00:33
455000 -- [-404.767] (-403.114) (-408.489) (-407.070) * (-408.357) (-408.650) (-403.330) [-408.017] -- 0:00:33
Average standard deviation of split frequencies: 0.007672
455500 -- (-403.749) (-405.127) [-405.249] (-404.601) * [-405.414] (-411.363) (-404.680) (-405.670) -- 0:00:33
456000 -- (-407.145) (-406.018) [-404.571] (-408.154) * (-404.523) (-405.538) [-404.153] (-406.748) -- 0:00:33
456500 -- (-403.493) (-405.103) (-405.673) [-404.394] * (-405.720) [-406.892] (-405.920) (-405.958) -- 0:00:33
457000 -- (-407.104) (-404.780) [-404.688] (-405.203) * (-406.869) (-405.248) (-405.030) [-404.582] -- 0:00:33
457500 -- (-406.558) [-407.487] (-405.041) (-407.021) * (-407.212) (-404.979) (-405.355) [-407.808] -- 0:00:33
458000 -- (-405.156) (-403.595) [-406.613] (-406.912) * (-407.281) (-405.769) (-404.363) [-405.079] -- 0:00:33
458500 -- [-404.429] (-405.653) (-404.835) (-404.088) * [-406.628] (-410.535) (-404.958) (-410.635) -- 0:00:33
459000 -- [-404.496] (-404.743) (-404.258) (-407.531) * (-404.411) (-403.784) (-404.206) [-406.969] -- 0:00:33
459500 -- [-406.424] (-404.266) (-408.608) (-406.406) * (-411.033) (-404.563) (-404.690) [-407.764] -- 0:00:32
460000 -- (-406.550) (-403.529) (-404.747) [-405.322] * (-407.293) [-404.895] (-405.579) (-404.774) -- 0:00:32
Average standard deviation of split frequencies: 0.007959
460500 -- [-406.304] (-403.852) (-409.026) (-405.834) * (-404.886) (-410.215) (-407.044) [-404.132] -- 0:00:32
461000 -- [-405.491] (-405.892) (-407.413) (-406.206) * (-405.804) (-408.692) (-406.227) [-404.220] -- 0:00:32
461500 -- (-409.884) (-404.369) (-405.783) [-405.116] * [-406.042] (-404.217) (-406.748) (-411.407) -- 0:00:32
462000 -- (-404.430) (-405.071) (-404.631) [-403.046] * (-404.149) (-404.081) (-406.277) [-408.180] -- 0:00:33
462500 -- (-404.567) (-404.595) [-404.216] (-403.605) * [-407.536] (-407.697) (-405.048) (-405.979) -- 0:00:33
463000 -- (-406.255) [-406.271] (-405.234) (-404.861) * (-406.539) (-404.045) (-406.257) [-403.837] -- 0:00:33
463500 -- (-406.606) (-404.291) (-406.651) [-403.726] * (-406.044) (-408.299) (-411.710) [-405.158] -- 0:00:33
464000 -- (-404.246) (-405.153) (-404.145) [-404.898] * (-405.869) (-409.853) (-406.605) [-406.247] -- 0:00:33
464500 -- (-407.703) (-403.730) (-404.203) [-405.711] * (-404.754) (-404.924) (-403.610) [-406.183] -- 0:00:33
465000 -- (-404.147) (-406.109) (-404.651) [-404.167] * (-406.716) (-405.089) [-404.839] (-408.702) -- 0:00:33
Average standard deviation of split frequencies: 0.006856
465500 -- (-406.188) (-404.737) (-407.690) [-404.942] * (-407.589) (-405.936) (-405.155) [-406.272] -- 0:00:33
466000 -- (-404.628) [-405.873] (-404.467) (-403.822) * (-405.489) (-404.852) (-406.001) [-403.885] -- 0:00:33
466500 -- (-404.209) (-406.993) [-406.226] (-403.750) * (-404.674) (-405.053) (-404.455) [-404.641] -- 0:00:33
467000 -- [-405.473] (-406.150) (-405.806) (-404.964) * [-411.259] (-403.474) (-404.858) (-405.872) -- 0:00:33
467500 -- (-406.406) [-403.845] (-403.750) (-404.364) * (-404.600) (-403.383) [-406.443] (-406.125) -- 0:00:33
468000 -- (-404.818) (-403.247) (-406.244) [-405.389] * (-405.206) [-404.459] (-405.123) (-403.459) -- 0:00:32
468500 -- (-403.354) (-409.492) (-404.718) [-406.546] * (-404.546) [-404.130] (-404.072) (-409.962) -- 0:00:32
469000 -- (-406.229) [-406.587] (-406.283) (-404.578) * (-404.078) (-405.848) (-404.891) [-408.469] -- 0:00:32
469500 -- (-405.538) [-404.979] (-405.653) (-405.802) * (-403.841) [-406.144] (-403.850) (-405.139) -- 0:00:32
470000 -- (-404.351) [-404.690] (-408.282) (-409.831) * (-404.949) [-406.327] (-406.729) (-404.610) -- 0:00:32
Average standard deviation of split frequencies: 0.007067
470500 -- (-405.680) (-404.659) (-404.858) [-404.821] * (-408.326) (-407.446) (-404.749) [-403.866] -- 0:00:32
471000 -- (-409.900) [-404.394] (-408.281) (-409.184) * (-403.338) [-407.383] (-407.303) (-407.990) -- 0:00:32
471500 -- [-404.820] (-404.386) (-406.749) (-404.370) * [-403.890] (-407.924) (-406.927) (-403.668) -- 0:00:32
472000 -- (-405.214) [-405.362] (-405.888) (-405.575) * (-406.576) (-404.824) (-408.859) [-404.841] -- 0:00:32
472500 -- (-407.081) [-406.645] (-406.355) (-404.942) * (-407.178) (-407.450) (-405.180) [-404.283] -- 0:00:32
473000 -- (-405.144) (-403.655) [-410.358] (-406.109) * (-407.794) (-405.964) (-405.375) [-404.506] -- 0:00:32
473500 -- (-409.775) [-405.252] (-411.880) (-403.606) * [-405.216] (-406.058) (-404.975) (-404.938) -- 0:00:32
474000 -- (-408.627) [-404.493] (-405.378) (-406.027) * [-406.706] (-403.908) (-407.687) (-405.933) -- 0:00:32
474500 -- (-407.413) [-404.760] (-406.262) (-404.675) * [-404.315] (-403.819) (-405.930) (-405.586) -- 0:00:32
475000 -- (-409.273) [-404.720] (-404.084) (-407.088) * (-409.172) [-403.473] (-405.625) (-403.897) -- 0:00:32
Average standard deviation of split frequencies: 0.007538
475500 -- (-404.603) (-409.441) (-405.077) [-410.262] * (-404.352) [-404.015] (-404.452) (-404.972) -- 0:00:31
476000 -- (-403.948) [-404.024] (-403.885) (-407.914) * (-406.157) (-405.328) (-404.154) [-404.278] -- 0:00:31
476500 -- (-405.148) (-403.166) [-404.075] (-406.780) * [-404.865] (-405.704) (-406.851) (-404.845) -- 0:00:31
477000 -- (-404.920) (-406.117) [-403.648] (-407.491) * [-403.520] (-405.129) (-403.792) (-405.539) -- 0:00:31
477500 -- (-409.879) (-406.431) (-403.629) [-405.705] * (-405.534) [-405.097] (-408.896) (-404.194) -- 0:00:31
478000 -- (-408.110) (-406.898) [-404.536] (-405.566) * [-405.110] (-405.138) (-407.298) (-404.001) -- 0:00:32
478500 -- [-404.394] (-404.929) (-403.834) (-404.235) * (-405.373) [-406.046] (-404.572) (-403.540) -- 0:00:32
479000 -- (-408.557) [-404.419] (-412.220) (-404.845) * [-404.564] (-407.638) (-406.280) (-405.316) -- 0:00:32
479500 -- (-406.195) (-403.770) [-410.065] (-403.776) * (-404.284) [-404.342] (-407.219) (-404.281) -- 0:00:32
480000 -- (-405.273) (-410.997) [-405.770] (-406.488) * [-403.699] (-405.439) (-403.561) (-404.477) -- 0:00:32
Average standard deviation of split frequencies: 0.008009
480500 -- (-410.313) (-403.881) [-405.065] (-404.464) * (-403.401) [-407.438] (-406.761) (-405.131) -- 0:00:32
481000 -- (-405.135) (-404.917) (-403.616) [-404.815] * (-403.826) [-403.584] (-406.058) (-407.753) -- 0:00:32
481500 -- (-404.302) (-404.342) (-405.246) [-403.711] * [-404.328] (-403.681) (-405.880) (-406.383) -- 0:00:32
482000 -- (-410.507) (-406.108) [-407.351] (-403.925) * [-404.191] (-405.320) (-403.747) (-404.647) -- 0:00:32
482500 -- (-409.448) (-403.882) (-409.158) [-405.896] * (-406.644) [-405.819] (-408.878) (-406.771) -- 0:00:32
483000 -- (-405.266) (-403.236) [-406.655] (-407.033) * (-405.790) (-404.028) [-408.083] (-405.201) -- 0:00:32
483500 -- (-406.633) [-405.876] (-406.642) (-406.158) * (-404.398) (-404.810) [-405.299] (-406.077) -- 0:00:32
484000 -- (-405.681) (-407.201) (-407.753) [-404.732] * [-406.707] (-407.216) (-404.386) (-406.949) -- 0:00:31
484500 -- (-405.421) (-404.014) [-408.279] (-403.927) * [-408.064] (-407.023) (-404.575) (-404.159) -- 0:00:31
485000 -- (-406.958) [-404.188] (-406.037) (-408.982) * [-403.403] (-404.196) (-405.601) (-410.434) -- 0:00:31
Average standard deviation of split frequencies: 0.008029
485500 -- (-407.138) (-404.302) (-404.588) [-403.344] * [-406.522] (-406.949) (-408.541) (-403.880) -- 0:00:31
486000 -- [-407.178] (-406.457) (-404.134) (-403.699) * [-404.587] (-405.887) (-403.584) (-406.175) -- 0:00:31
486500 -- [-406.899] (-406.245) (-403.326) (-403.669) * (-405.346) (-408.669) [-406.330] (-406.653) -- 0:00:31
487000 -- (-406.855) [-405.488] (-405.634) (-404.758) * (-407.122) (-406.211) [-405.116] (-405.519) -- 0:00:31
487500 -- (-406.555) (-404.246) [-406.226] (-406.528) * (-405.116) (-408.256) [-404.862] (-407.659) -- 0:00:31
488000 -- (-405.074) (-404.383) (-404.777) [-404.273] * (-404.368) (-404.617) (-405.914) [-404.703] -- 0:00:31
488500 -- (-405.572) (-404.005) (-404.191) [-405.730] * (-405.912) (-404.705) [-403.960] (-403.665) -- 0:00:31
489000 -- (-404.901) [-406.694] (-408.003) (-406.522) * (-405.710) (-404.307) (-405.386) [-407.024] -- 0:00:31
489500 -- [-404.561] (-407.557) (-405.553) (-404.660) * (-404.997) (-405.454) [-406.094] (-411.178) -- 0:00:31
490000 -- (-404.126) (-407.081) [-404.466] (-404.514) * (-405.659) [-407.309] (-405.733) (-408.303) -- 0:00:31
Average standard deviation of split frequencies: 0.007686
490500 -- (-407.143) [-405.190] (-404.839) (-404.153) * [-405.417] (-411.583) (-403.637) (-406.579) -- 0:00:31
491000 -- (-409.078) (-405.823) [-406.480] (-412.468) * (-404.118) (-405.249) [-404.112] (-409.990) -- 0:00:31
491500 -- [-407.029] (-408.063) (-406.115) (-413.755) * (-405.268) (-404.336) [-404.794] (-404.175) -- 0:00:31
492000 -- [-403.673] (-404.764) (-405.122) (-407.805) * (-407.477) (-403.703) [-405.093] (-406.299) -- 0:00:30
492500 -- (-405.719) (-407.900) (-405.777) [-407.266] * [-404.643] (-407.398) (-406.106) (-408.216) -- 0:00:30
493000 -- (-405.535) (-404.579) (-404.942) [-403.722] * (-405.074) (-405.550) [-406.299] (-404.012) -- 0:00:31
493500 -- (-405.869) [-404.335] (-407.726) (-403.133) * (-404.381) (-404.297) (-404.790) [-404.059] -- 0:00:31
494000 -- (-405.243) (-410.948) (-407.421) [-405.839] * (-403.699) (-403.099) [-404.419] (-405.065) -- 0:00:31
494500 -- (-404.776) [-403.935] (-406.720) (-404.784) * (-405.893) [-405.020] (-403.936) (-407.092) -- 0:00:31
495000 -- (-407.736) (-403.451) [-407.083] (-403.610) * (-404.034) (-404.932) [-403.486] (-403.833) -- 0:00:31
Average standard deviation of split frequencies: 0.007603
495500 -- (-405.469) (-403.448) [-405.868] (-406.548) * (-404.505) (-405.234) [-407.084] (-406.431) -- 0:00:31
496000 -- (-405.886) (-407.163) (-408.022) [-404.367] * (-406.442) (-406.719) [-404.426] (-409.197) -- 0:00:31
496500 -- (-404.981) [-404.710] (-404.049) (-406.090) * [-404.224] (-406.935) (-403.920) (-408.349) -- 0:00:31
497000 -- (-406.133) [-404.717] (-404.668) (-408.477) * (-408.596) (-406.536) (-404.586) [-404.336] -- 0:00:31
497500 -- (-404.153) (-403.772) [-407.349] (-409.564) * (-406.046) (-403.825) [-405.524] (-407.830) -- 0:00:31
498000 -- (-404.152) (-403.981) (-407.177) [-405.612] * [-405.023] (-406.080) (-403.323) (-404.312) -- 0:00:31
498500 -- (-412.120) (-405.204) [-409.236] (-405.406) * (-404.546) (-406.782) [-403.528] (-410.403) -- 0:00:31
499000 -- [-407.589] (-405.997) (-404.719) (-405.594) * (-405.738) (-404.764) [-408.093] (-403.782) -- 0:00:31
499500 -- (-407.611) (-409.752) [-404.956] (-408.930) * [-405.214] (-405.128) (-411.024) (-405.492) -- 0:00:31
500000 -- (-407.544) (-405.069) (-405.190) [-408.506] * (-405.384) (-404.459) [-404.439] (-403.600) -- 0:00:31
Average standard deviation of split frequencies: 0.007794
500500 -- (-406.749) (-405.232) (-407.949) [-403.717] * (-404.200) [-404.811] (-407.790) (-404.639) -- 0:00:30
501000 -- (-405.758) [-404.910] (-407.621) (-408.213) * (-406.834) (-405.616) (-407.104) [-408.675] -- 0:00:30
501500 -- (-406.960) (-404.218) [-410.158] (-405.344) * [-407.135] (-406.389) (-404.990) (-407.512) -- 0:00:30
502000 -- (-405.761) (-404.007) (-404.499) [-404.143] * [-405.209] (-404.684) (-405.933) (-404.094) -- 0:00:30
502500 -- (-403.969) [-404.743] (-405.407) (-408.814) * (-405.578) (-405.896) (-407.566) [-405.158] -- 0:00:30
503000 -- (-403.694) (-403.516) [-407.300] (-408.597) * (-404.783) (-403.549) [-404.059] (-410.184) -- 0:00:30
503500 -- [-404.647] (-405.169) (-404.138) (-405.183) * (-405.708) (-405.236) [-403.822] (-406.690) -- 0:00:30
504000 -- [-404.290] (-406.086) (-403.773) (-407.945) * (-408.069) (-408.316) (-403.691) [-404.781] -- 0:00:30
504500 -- (-406.177) (-406.124) (-404.528) [-407.369] * (-406.565) [-404.382] (-403.782) (-403.452) -- 0:00:30
505000 -- (-403.582) [-406.373] (-405.484) (-406.292) * (-405.537) (-405.556) [-405.626] (-405.820) -- 0:00:30
Average standard deviation of split frequencies: 0.008090
505500 -- (-407.038) (-405.326) [-404.558] (-405.144) * [-405.006] (-406.284) (-403.761) (-406.258) -- 0:00:30
506000 -- (-406.502) (-404.848) [-403.594] (-403.536) * (-405.553) (-404.234) (-405.374) [-405.554] -- 0:00:30
506500 -- [-404.825] (-404.273) (-408.594) (-406.091) * (-410.048) (-408.024) (-405.216) [-407.242] -- 0:00:30
507000 -- [-404.421] (-406.196) (-403.664) (-407.143) * [-407.153] (-409.306) (-404.473) (-408.998) -- 0:00:30
507500 -- [-403.516] (-406.033) (-405.169) (-408.476) * [-404.982] (-404.547) (-405.142) (-411.899) -- 0:00:30
508000 -- (-407.028) (-405.270) (-404.188) [-407.990] * (-405.721) [-403.956] (-403.788) (-404.689) -- 0:00:30
508500 -- [-408.087] (-404.558) (-405.182) (-407.541) * (-404.606) [-404.381] (-403.896) (-403.870) -- 0:00:29
509000 -- (-406.302) (-404.331) (-407.100) [-406.214] * [-408.471] (-407.947) (-404.800) (-405.243) -- 0:00:30
509500 -- (-406.175) (-407.445) [-406.548] (-406.399) * (-408.290) [-404.705] (-404.227) (-409.026) -- 0:00:30
510000 -- [-406.548] (-405.858) (-405.400) (-411.462) * (-407.786) [-404.650] (-406.476) (-404.812) -- 0:00:30
Average standard deviation of split frequencies: 0.007774
510500 -- [-405.802] (-404.801) (-403.654) (-406.906) * (-410.729) (-404.882) (-408.943) [-407.248] -- 0:00:30
511000 -- (-405.528) (-404.822) [-403.520] (-405.281) * (-406.031) (-403.343) [-405.973] (-409.906) -- 0:00:30
511500 -- (-404.796) (-403.855) (-404.174) [-404.650] * (-406.089) [-404.723] (-403.394) (-405.768) -- 0:00:30
512000 -- (-405.180) [-407.462] (-404.262) (-407.677) * (-404.991) (-404.249) (-406.373) [-406.589] -- 0:00:30
512500 -- (-405.474) (-404.155) (-407.788) [-407.308] * (-404.230) (-404.103) (-405.330) [-411.921] -- 0:00:30
513000 -- [-404.747] (-408.762) (-407.053) (-403.754) * (-405.701) (-403.262) (-404.720) [-404.226] -- 0:00:30
513500 -- (-406.088) (-405.289) (-404.386) [-403.732] * (-405.066) (-403.388) (-408.831) [-406.395] -- 0:00:30
514000 -- (-417.140) [-403.627] (-406.005) (-407.151) * (-405.300) (-405.777) [-403.961] (-404.425) -- 0:00:30
514500 -- (-407.524) (-404.461) [-405.508] (-403.833) * (-403.201) (-407.326) (-406.783) [-404.335] -- 0:00:30
515000 -- (-405.945) (-403.587) [-404.721] (-406.356) * (-406.028) [-407.547] (-404.688) (-405.693) -- 0:00:30
Average standard deviation of split frequencies: 0.006953
515500 -- [-404.848] (-406.084) (-405.643) (-405.948) * (-405.053) [-405.342] (-406.147) (-409.538) -- 0:00:30
516000 -- (-405.915) [-403.252] (-404.209) (-408.268) * (-405.574) (-407.477) [-404.223] (-404.217) -- 0:00:30
516500 -- (-404.006) (-407.176) [-404.220] (-407.791) * [-407.148] (-406.341) (-403.184) (-405.200) -- 0:00:29
517000 -- (-404.187) (-405.380) [-408.082] (-403.641) * (-403.431) [-405.747] (-403.992) (-403.829) -- 0:00:29
517500 -- [-405.982] (-404.702) (-404.422) (-404.163) * (-403.423) (-410.161) (-404.163) [-406.794] -- 0:00:29
518000 -- (-405.608) [-407.209] (-405.789) (-406.096) * (-406.873) (-406.705) [-403.755] (-408.402) -- 0:00:29
518500 -- (-408.524) [-404.279] (-406.847) (-404.301) * (-409.318) [-408.414] (-403.804) (-403.368) -- 0:00:29
519000 -- (-409.084) [-404.801] (-407.669) (-403.193) * [-407.229] (-408.186) (-404.793) (-409.134) -- 0:00:29
519500 -- (-410.812) (-404.452) [-406.311] (-408.406) * (-405.201) (-404.831) [-406.421] (-409.003) -- 0:00:29
520000 -- (-406.642) [-406.749] (-406.715) (-404.421) * (-407.947) (-408.304) [-404.743] (-404.034) -- 0:00:29
Average standard deviation of split frequencies: 0.006740
520500 -- (-406.371) [-405.693] (-403.491) (-406.094) * (-403.736) [-405.446] (-404.632) (-407.198) -- 0:00:29
521000 -- (-403.506) [-404.014] (-403.350) (-405.928) * (-403.477) [-405.089] (-404.709) (-404.566) -- 0:00:29
521500 -- [-405.702] (-403.918) (-405.056) (-406.023) * (-405.349) (-408.744) (-406.862) [-403.820] -- 0:00:29
522000 -- [-409.805] (-404.755) (-408.075) (-405.664) * (-406.657) (-406.589) (-411.225) [-403.541] -- 0:00:29
522500 -- (-406.040) (-406.781) (-406.228) [-407.425] * (-406.028) [-405.312] (-405.456) (-405.185) -- 0:00:29
523000 -- [-405.155] (-405.219) (-405.572) (-404.498) * (-406.068) [-405.701] (-404.368) (-406.350) -- 0:00:29
523500 -- (-405.095) (-404.554) (-405.992) [-403.245] * (-406.609) (-405.488) [-405.208] (-409.367) -- 0:00:29
524000 -- (-404.325) (-404.145) [-404.417] (-404.089) * (-416.865) (-403.490) [-407.957] (-406.492) -- 0:00:29
524500 -- (-407.626) (-405.142) [-406.992] (-404.732) * [-404.950] (-406.288) (-406.301) (-406.336) -- 0:00:29
525000 -- [-404.168] (-406.004) (-405.130) (-405.446) * [-404.448] (-406.280) (-408.418) (-406.564) -- 0:00:29
Average standard deviation of split frequencies: 0.006722
525500 -- [-411.041] (-405.943) (-403.911) (-406.357) * (-405.089) (-407.200) [-405.867] (-403.292) -- 0:00:29
526000 -- (-406.874) [-404.253] (-404.723) (-403.943) * (-407.365) (-409.008) (-405.183) [-404.261] -- 0:00:29
526500 -- [-409.129] (-403.850) (-404.474) (-404.807) * [-403.656] (-409.018) (-407.424) (-406.429) -- 0:00:29
527000 -- (-404.149) [-403.965] (-404.305) (-404.015) * (-404.683) [-405.490] (-404.765) (-406.824) -- 0:00:29
527500 -- (-408.663) [-403.984] (-403.361) (-410.410) * (-403.661) (-404.994) (-403.738) [-404.503] -- 0:00:29
528000 -- (-405.549) (-404.486) [-404.045] (-407.719) * [-405.817] (-408.615) (-406.444) (-404.003) -- 0:00:29
528500 -- (-405.456) [-406.630] (-406.079) (-407.847) * (-404.515) (-403.728) (-413.696) [-405.469] -- 0:00:29
529000 -- (-405.175) (-412.821) (-405.574) [-406.104] * (-407.137) (-405.459) (-408.703) [-405.740] -- 0:00:29
529500 -- (-404.748) (-406.603) [-403.771] (-405.813) * (-408.004) [-404.877] (-409.330) (-404.737) -- 0:00:29
530000 -- (-404.811) [-406.033] (-403.714) (-405.831) * (-413.334) [-406.960] (-404.299) (-404.343) -- 0:00:29
Average standard deviation of split frequencies: 0.007255
530500 -- (-407.658) [-406.471] (-407.250) (-406.044) * (-407.086) (-404.221) (-407.916) [-404.076] -- 0:00:29
531000 -- [-403.586] (-404.433) (-406.188) (-405.713) * [-407.272] (-407.195) (-405.267) (-406.131) -- 0:00:29
531500 -- (-404.891) (-405.904) (-405.579) [-406.894] * (-403.967) [-408.797] (-403.722) (-404.409) -- 0:00:29
532000 -- (-406.181) (-405.147) [-407.650] (-403.935) * [-406.727] (-406.255) (-403.631) (-405.269) -- 0:00:29
532500 -- (-404.452) [-404.308] (-407.410) (-404.140) * (-404.494) [-407.092] (-403.549) (-405.385) -- 0:00:28
533000 -- [-407.975] (-404.088) (-403.955) (-408.068) * (-403.970) (-404.272) (-406.973) [-404.291] -- 0:00:28
533500 -- (-408.426) [-406.139] (-404.255) (-408.761) * (-406.228) (-403.729) (-407.352) [-406.711] -- 0:00:28
534000 -- [-404.463] (-403.753) (-407.322) (-405.610) * [-405.414] (-407.415) (-404.898) (-404.685) -- 0:00:28
534500 -- (-405.429) [-405.630] (-407.230) (-404.934) * [-405.727] (-406.257) (-409.247) (-403.509) -- 0:00:28
535000 -- [-404.193] (-406.014) (-405.847) (-405.567) * (-403.254) [-406.654] (-405.207) (-404.242) -- 0:00:28
Average standard deviation of split frequencies: 0.006938
535500 -- (-405.349) (-409.599) [-405.825] (-407.133) * (-403.757) (-411.753) (-407.269) [-406.447] -- 0:00:28
536000 -- (-404.391) [-409.714] (-408.227) (-404.168) * [-408.020] (-404.423) (-404.625) (-405.429) -- 0:00:28
536500 -- (-405.445) (-407.565) (-408.348) [-403.857] * (-407.466) (-408.000) (-404.250) [-405.146] -- 0:00:28
537000 -- (-403.994) (-406.395) [-405.559] (-404.662) * [-404.830] (-406.420) (-405.791) (-403.502) -- 0:00:28
537500 -- [-404.985] (-405.933) (-403.733) (-405.278) * [-405.517] (-405.929) (-405.630) (-407.288) -- 0:00:28
538000 -- [-407.106] (-405.024) (-404.235) (-406.972) * [-406.544] (-403.888) (-403.900) (-405.278) -- 0:00:28
538500 -- (-404.111) [-405.444] (-404.017) (-407.322) * (-404.383) [-404.887] (-404.991) (-408.154) -- 0:00:28
539000 -- (-408.813) [-406.206] (-403.752) (-404.861) * [-404.292] (-406.667) (-405.899) (-405.803) -- 0:00:28
539500 -- [-403.461] (-406.700) (-403.248) (-406.436) * (-408.611) [-404.611] (-404.440) (-404.060) -- 0:00:28
540000 -- (-403.768) (-404.652) [-404.030] (-407.496) * (-404.746) (-405.403) [-406.830] (-406.226) -- 0:00:28
Average standard deviation of split frequencies: 0.006411
540500 -- (-405.304) (-405.795) [-406.536] (-405.872) * (-407.162) (-407.992) (-403.835) [-404.464] -- 0:00:28
541000 -- (-405.458) [-403.917] (-414.701) (-404.554) * [-411.179] (-404.329) (-406.848) (-403.980) -- 0:00:27
541500 -- (-406.521) (-405.386) [-405.498] (-404.139) * (-408.050) [-404.696] (-405.360) (-403.774) -- 0:00:28
542000 -- (-404.629) (-409.263) [-404.152] (-409.202) * (-405.054) (-405.113) (-405.194) [-405.206] -- 0:00:28
542500 -- (-404.727) [-405.025] (-405.401) (-407.364) * (-403.507) [-404.485] (-404.853) (-405.151) -- 0:00:28
543000 -- (-405.906) [-403.862] (-406.718) (-403.812) * [-404.856] (-406.301) (-406.192) (-404.342) -- 0:00:28
543500 -- (-405.121) [-407.147] (-413.546) (-405.560) * [-403.342] (-405.225) (-404.023) (-411.255) -- 0:00:28
544000 -- [-404.758] (-404.659) (-404.855) (-403.253) * (-404.305) (-403.741) (-408.670) [-408.454] -- 0:00:28
544500 -- [-404.939] (-404.406) (-406.470) (-407.128) * [-407.337] (-403.593) (-409.452) (-407.607) -- 0:00:28
545000 -- [-404.174] (-404.103) (-407.398) (-405.362) * (-404.397) [-405.045] (-409.724) (-405.190) -- 0:00:28
Average standard deviation of split frequencies: 0.006667
545500 -- (-405.969) (-403.459) [-405.094] (-405.088) * (-407.270) (-413.481) [-407.325] (-406.375) -- 0:00:28
546000 -- (-406.707) (-404.118) [-404.688] (-406.199) * (-406.357) (-404.544) [-407.739] (-405.420) -- 0:00:28
546500 -- (-407.440) (-404.192) (-410.080) [-405.315] * (-406.006) (-403.554) [-403.659] (-404.162) -- 0:00:28
547000 -- (-404.587) (-405.018) (-405.594) [-403.511] * (-407.341) (-404.238) [-403.615] (-406.334) -- 0:00:28
547500 -- [-405.559] (-404.202) (-405.063) (-406.501) * [-403.596] (-405.310) (-403.481) (-407.734) -- 0:00:28
548000 -- (-405.058) (-406.927) [-404.642] (-408.034) * (-405.739) [-408.640] (-404.426) (-404.807) -- 0:00:28
548500 -- (-405.450) [-406.697] (-408.794) (-406.867) * [-409.231] (-407.659) (-405.030) (-405.048) -- 0:00:27
549000 -- (-410.871) (-405.290) (-404.771) [-405.399] * (-406.787) [-408.247] (-406.731) (-407.510) -- 0:00:27
549500 -- (-405.581) (-406.064) (-407.213) [-406.069] * (-406.380) (-408.483) (-408.576) [-403.280] -- 0:00:27
550000 -- (-403.443) [-406.108] (-406.132) (-406.686) * (-409.118) (-406.078) [-405.763] (-405.063) -- 0:00:27
Average standard deviation of split frequencies: 0.007134
550500 -- (-405.026) (-404.671) (-405.621) [-407.581] * (-408.736) (-403.862) (-404.991) [-406.918] -- 0:00:27
551000 -- (-405.002) (-405.682) (-412.075) [-405.823] * (-408.223) [-405.837] (-404.050) (-405.196) -- 0:00:27
551500 -- [-404.225] (-404.816) (-408.768) (-406.123) * (-404.407) [-407.699] (-405.581) (-406.420) -- 0:00:27
552000 -- (-403.830) (-405.863) (-407.171) [-405.799] * (-404.432) [-407.113] (-404.621) (-406.468) -- 0:00:27
552500 -- [-407.301] (-404.126) (-404.398) (-405.119) * (-405.835) (-404.265) [-404.553] (-407.138) -- 0:00:27
553000 -- (-406.791) (-404.105) [-404.072] (-404.989) * (-407.255) (-405.423) [-404.610] (-403.251) -- 0:00:27
553500 -- (-404.176) (-407.988) [-403.506] (-405.176) * (-405.519) (-406.841) (-405.074) [-406.450] -- 0:00:27
554000 -- (-407.547) [-407.052] (-407.185) (-404.353) * (-404.004) [-403.776] (-406.081) (-407.284) -- 0:00:27
554500 -- (-407.543) (-407.836) [-407.598] (-408.452) * (-404.359) [-405.900] (-405.001) (-405.778) -- 0:00:27
555000 -- (-407.211) [-403.179] (-404.020) (-405.780) * (-404.479) (-409.029) [-407.011] (-408.676) -- 0:00:27
Average standard deviation of split frequencies: 0.005835
555500 -- (-406.017) (-404.262) [-404.750] (-403.548) * (-408.326) (-405.772) [-405.320] (-404.009) -- 0:00:27
556000 -- (-404.491) [-409.024] (-411.193) (-405.231) * (-408.706) (-405.406) (-403.585) [-404.374] -- 0:00:27
556500 -- [-405.842] (-404.938) (-409.878) (-404.780) * (-407.117) (-404.317) (-405.459) [-404.855] -- 0:00:27
557000 -- (-405.948) [-404.357] (-408.552) (-406.440) * (-406.015) (-407.979) (-410.489) [-404.603] -- 0:00:27
557500 -- (-408.515) (-407.489) [-403.964] (-404.794) * (-404.799) [-405.792] (-407.014) (-403.887) -- 0:00:26
558000 -- (-405.197) (-408.642) [-405.228] (-405.521) * (-407.534) (-412.618) [-404.046] (-403.914) -- 0:00:26
558500 -- (-405.530) [-403.330] (-404.783) (-405.599) * (-407.948) (-406.278) [-403.848] (-407.269) -- 0:00:27
559000 -- (-404.659) [-403.746] (-403.637) (-406.359) * (-405.240) (-406.752) [-405.483] (-405.916) -- 0:00:27
559500 -- (-404.467) (-404.478) (-407.611) [-404.279] * (-405.963) (-404.891) [-405.778] (-407.099) -- 0:00:27
560000 -- (-403.649) [-405.710] (-407.529) (-404.035) * (-405.105) [-406.861] (-404.993) (-407.146) -- 0:00:27
Average standard deviation of split frequencies: 0.005675
560500 -- (-406.939) [-404.647] (-405.265) (-404.151) * (-404.075) (-407.588) (-407.981) [-406.830] -- 0:00:27
561000 -- (-404.335) (-405.921) [-406.477] (-403.942) * (-404.876) (-405.830) [-407.932] (-405.677) -- 0:00:27
561500 -- (-404.434) (-405.624) [-403.741] (-405.099) * (-405.882) (-409.683) [-403.815] (-404.666) -- 0:00:27
562000 -- (-404.587) (-405.038) (-405.216) [-403.708] * (-405.841) [-407.697] (-404.655) (-407.286) -- 0:00:27
562500 -- (-405.440) [-403.935] (-405.896) (-406.053) * (-406.358) [-404.292] (-410.236) (-404.821) -- 0:00:27
563000 -- (-405.323) (-407.795) [-406.383] (-408.479) * (-405.010) [-406.013] (-404.277) (-404.809) -- 0:00:27
563500 -- [-404.997] (-406.557) (-405.028) (-404.727) * (-405.143) [-405.985] (-405.258) (-404.486) -- 0:00:27
564000 -- (-405.560) (-404.707) [-404.772] (-404.357) * (-409.010) (-408.157) [-403.874] (-404.186) -- 0:00:27
564500 -- (-404.636) [-403.660] (-404.212) (-406.881) * (-408.617) (-407.302) (-403.890) [-407.940] -- 0:00:27
565000 -- (-406.949) [-403.420] (-409.763) (-408.982) * (-406.210) (-408.926) [-407.106] (-406.867) -- 0:00:26
Average standard deviation of split frequencies: 0.005830
565500 -- (-406.114) [-404.081] (-409.306) (-408.298) * [-406.518] (-404.507) (-405.895) (-405.020) -- 0:00:26
566000 -- (-407.526) [-403.980] (-410.239) (-412.779) * [-406.996] (-408.285) (-406.346) (-405.458) -- 0:00:26
566500 -- (-405.539) (-406.081) (-409.333) [-415.274] * [-405.753] (-406.378) (-405.652) (-407.926) -- 0:00:26
567000 -- (-407.590) [-403.795] (-405.802) (-406.543) * [-403.520] (-407.347) (-406.450) (-408.628) -- 0:00:26
567500 -- (-405.819) (-404.471) [-405.903] (-403.192) * (-404.250) (-405.565) (-404.753) [-405.409] -- 0:00:26
568000 -- [-404.787] (-405.745) (-407.906) (-404.467) * (-406.043) (-407.765) (-405.259) [-403.479] -- 0:00:26
568500 -- (-404.495) [-403.555] (-405.890) (-405.344) * (-403.937) [-407.523] (-406.618) (-404.875) -- 0:00:26
569000 -- (-403.753) (-406.186) [-404.025] (-405.741) * [-404.123] (-403.882) (-404.775) (-404.347) -- 0:00:26
569500 -- (-406.956) [-403.753] (-405.759) (-405.320) * (-405.983) (-406.037) (-404.441) [-405.215] -- 0:00:26
570000 -- (-404.226) [-404.620] (-408.331) (-406.921) * (-405.240) [-405.445] (-408.749) (-404.683) -- 0:00:26
Average standard deviation of split frequencies: 0.006608
570500 -- (-405.876) [-404.793] (-404.573) (-405.511) * (-405.811) [-406.086] (-405.744) (-406.722) -- 0:00:26
571000 -- (-409.506) [-405.212] (-404.043) (-404.905) * (-404.208) (-404.331) [-407.570] (-408.329) -- 0:00:26
571500 -- (-405.646) (-403.669) [-404.053] (-405.794) * (-404.731) (-411.270) [-405.534] (-403.760) -- 0:00:26
572000 -- (-403.950) (-404.711) (-405.542) [-404.476] * [-406.473] (-406.477) (-403.522) (-406.688) -- 0:00:26
572500 -- [-404.728] (-409.891) (-408.224) (-404.512) * (-412.368) [-403.778] (-406.584) (-406.009) -- 0:00:26
573000 -- (-404.649) (-408.210) [-408.550] (-404.840) * (-407.996) [-404.930] (-407.139) (-406.270) -- 0:00:26
573500 -- [-403.575] (-405.000) (-404.435) (-407.002) * (-405.020) (-407.694) [-405.847] (-407.024) -- 0:00:26
574000 -- (-405.322) (-406.909) (-404.682) [-405.660] * (-404.869) (-406.052) (-406.189) [-405.026] -- 0:00:25
574500 -- (-405.716) (-403.992) [-407.360] (-405.781) * (-407.644) (-404.433) [-406.380] (-404.145) -- 0:00:25
575000 -- (-412.308) [-405.099] (-404.859) (-405.052) * (-406.420) [-404.413] (-409.089) (-403.046) -- 0:00:25
Average standard deviation of split frequencies: 0.005933
575500 -- [-407.157] (-405.484) (-404.516) (-405.992) * (-407.089) (-407.176) (-407.219) [-405.339] -- 0:00:26
576000 -- (-409.069) (-408.958) (-405.436) [-404.397] * (-409.800) (-405.842) [-405.568] (-407.019) -- 0:00:26
576500 -- (-404.936) [-404.365] (-407.242) (-407.252) * (-404.808) [-405.986] (-408.236) (-406.422) -- 0:00:26
577000 -- (-403.705) (-404.383) (-405.598) [-404.460] * (-412.207) [-405.946] (-405.377) (-403.386) -- 0:00:26
577500 -- (-404.774) (-407.135) [-403.929] (-405.895) * (-405.970) (-407.823) [-404.538] (-404.271) -- 0:00:26
578000 -- (-405.902) (-406.178) [-403.752] (-406.139) * (-405.794) (-406.282) [-405.121] (-405.289) -- 0:00:26
578500 -- [-406.905] (-407.288) (-405.322) (-405.098) * [-406.143] (-405.569) (-403.243) (-403.875) -- 0:00:26
579000 -- (-405.390) (-408.110) [-405.934] (-405.898) * (-406.879) (-405.632) (-412.049) [-405.226] -- 0:00:26
579500 -- [-406.375] (-408.754) (-405.714) (-403.401) * [-405.595] (-405.202) (-404.652) (-409.247) -- 0:00:26
580000 -- [-406.538] (-407.455) (-406.655) (-405.255) * (-404.414) (-406.235) (-406.640) [-408.687] -- 0:00:26
Average standard deviation of split frequencies: 0.005581
580500 -- [-405.794] (-405.348) (-405.754) (-405.050) * (-403.874) [-406.193] (-406.337) (-405.973) -- 0:00:26
581000 -- [-407.939] (-404.191) (-403.985) (-404.796) * (-403.432) [-403.060] (-406.738) (-407.589) -- 0:00:25
581500 -- (-406.986) (-408.706) [-403.958] (-406.309) * [-404.387] (-408.177) (-404.698) (-405.848) -- 0:00:25
582000 -- (-407.489) (-405.738) [-406.900] (-404.423) * [-406.066] (-406.437) (-406.679) (-403.603) -- 0:00:25
582500 -- (-405.400) [-406.732] (-405.461) (-403.900) * (-405.644) [-406.304] (-406.875) (-406.802) -- 0:00:25
583000 -- (-405.200) (-406.738) (-406.247) [-407.273] * [-405.759] (-404.294) (-409.069) (-404.429) -- 0:00:25
583500 -- (-406.899) (-404.652) [-408.278] (-403.840) * (-407.489) (-403.860) (-407.793) [-405.285] -- 0:00:25
584000 -- (-407.331) (-406.349) (-404.588) [-404.947] * [-406.635] (-404.247) (-406.411) (-405.961) -- 0:00:25
584500 -- [-406.940] (-407.437) (-404.768) (-406.353) * (-405.652) [-405.710] (-405.264) (-406.510) -- 0:00:25
585000 -- [-406.846] (-405.397) (-404.951) (-404.254) * (-407.710) (-405.670) [-407.153] (-405.093) -- 0:00:25
Average standard deviation of split frequencies: 0.005832
585500 -- [-407.256] (-406.546) (-409.543) (-405.762) * (-404.436) (-405.072) (-404.434) [-404.338] -- 0:00:25
586000 -- [-406.514] (-406.157) (-405.198) (-408.677) * (-409.138) (-405.530) [-404.637] (-404.186) -- 0:00:25
586500 -- (-407.762) (-406.311) (-403.461) [-403.823] * (-404.960) (-409.003) [-404.403] (-411.581) -- 0:00:25
587000 -- [-406.465] (-405.421) (-408.301) (-404.448) * (-404.131) (-407.038) [-405.852] (-405.242) -- 0:00:25
587500 -- [-404.731] (-405.474) (-407.994) (-404.363) * (-405.344) (-408.363) (-408.553) [-403.811] -- 0:00:25
588000 -- (-405.157) (-404.735) (-408.766) [-404.940] * (-403.940) [-405.112] (-405.209) (-404.151) -- 0:00:25
588500 -- [-406.728] (-405.541) (-404.910) (-404.059) * (-404.702) (-404.317) [-406.893] (-407.350) -- 0:00:25
589000 -- (-406.940) (-406.754) [-406.902] (-407.604) * (-406.080) [-405.409] (-408.097) (-408.943) -- 0:00:25
589500 -- (-407.171) [-405.453] (-405.692) (-406.890) * (-403.882) (-404.581) (-406.436) [-407.148] -- 0:00:25
590000 -- (-405.660) (-404.397) [-408.655] (-405.205) * (-406.250) [-406.097] (-409.079) (-411.037) -- 0:00:25
Average standard deviation of split frequencies: 0.005936
590500 -- (-405.358) [-406.798] (-407.583) (-404.122) * (-406.651) (-406.498) [-408.442] (-404.318) -- 0:00:24
591000 -- [-405.155] (-405.552) (-405.286) (-405.613) * [-407.258] (-407.219) (-411.758) (-404.618) -- 0:00:24
591500 -- (-406.101) (-405.117) (-407.050) [-405.003] * [-405.468] (-405.125) (-405.552) (-405.806) -- 0:00:24
592000 -- (-406.052) (-409.832) (-408.058) [-405.820] * [-404.176] (-404.083) (-404.475) (-403.893) -- 0:00:25
592500 -- [-407.219] (-406.198) (-406.525) (-404.514) * (-405.191) (-404.636) [-406.790] (-404.850) -- 0:00:25
593000 -- [-403.472] (-407.664) (-410.894) (-407.228) * (-405.417) (-404.950) [-403.911] (-406.684) -- 0:00:25
593500 -- (-404.081) (-404.715) [-404.464] (-403.993) * (-409.193) [-404.593] (-406.981) (-404.698) -- 0:00:25
594000 -- (-404.020) [-405.355] (-405.944) (-405.984) * (-408.505) [-404.512] (-406.526) (-404.863) -- 0:00:25
594500 -- (-404.818) (-404.730) [-405.392] (-403.954) * (-407.622) (-406.300) (-409.059) [-403.578] -- 0:00:25
595000 -- (-407.723) [-405.979] (-406.743) (-409.137) * (-407.774) (-406.163) [-405.591] (-408.186) -- 0:00:25
Average standard deviation of split frequencies: 0.007212
595500 -- (-404.528) [-404.353] (-406.980) (-406.211) * (-407.415) (-405.378) (-405.400) [-407.698] -- 0:00:25
596000 -- (-405.047) [-404.257] (-403.421) (-408.925) * (-405.963) (-404.543) [-403.957] (-407.507) -- 0:00:25
596500 -- (-409.617) (-404.482) (-405.907) [-405.510] * (-405.033) (-404.485) (-404.018) [-405.643] -- 0:00:25
597000 -- [-407.268] (-405.099) (-407.322) (-404.415) * [-405.571] (-405.462) (-404.610) (-403.329) -- 0:00:24
597500 -- [-403.478] (-405.495) (-404.186) (-404.637) * (-405.729) (-405.198) [-405.632] (-406.005) -- 0:00:24
598000 -- (-405.341) (-404.260) (-405.659) [-406.171] * (-407.131) [-404.443] (-404.902) (-407.099) -- 0:00:24
598500 -- (-403.596) (-404.222) [-407.223] (-403.635) * (-406.098) [-407.493] (-404.097) (-406.544) -- 0:00:24
599000 -- (-403.912) [-403.778] (-406.098) (-404.525) * (-409.018) (-404.846) [-405.035] (-405.409) -- 0:00:24
599500 -- (-404.141) (-406.349) [-405.180] (-407.881) * (-404.357) (-404.124) [-406.775] (-405.146) -- 0:00:24
600000 -- (-405.226) (-405.723) (-406.390) [-406.375] * (-407.540) (-406.079) (-405.910) [-404.746] -- 0:00:24
Average standard deviation of split frequencies: 0.007109
600500 -- [-404.568] (-407.065) (-407.606) (-405.536) * (-407.139) (-404.762) (-406.890) [-405.125] -- 0:00:24
601000 -- [-407.008] (-405.445) (-408.922) (-404.007) * (-407.740) (-405.283) (-406.017) [-405.259] -- 0:00:24
601500 -- [-405.814] (-404.105) (-403.257) (-407.380) * (-406.460) [-406.059] (-407.580) (-405.657) -- 0:00:24
602000 -- (-406.379) (-404.675) (-403.241) [-405.483] * [-404.830] (-407.169) (-404.607) (-404.567) -- 0:00:24
602500 -- (-404.962) [-404.816] (-407.059) (-404.220) * (-404.358) (-405.278) (-405.368) [-408.107] -- 0:00:24
603000 -- [-408.419] (-403.410) (-404.355) (-404.576) * (-403.956) (-410.230) (-407.550) [-405.162] -- 0:00:24
603500 -- (-405.131) (-405.566) [-403.789] (-404.102) * [-404.344] (-406.288) (-404.257) (-406.481) -- 0:00:24
604000 -- [-404.434] (-405.720) (-403.445) (-403.789) * [-405.250] (-406.498) (-405.363) (-408.497) -- 0:00:24
604500 -- (-407.171) [-404.760] (-404.570) (-405.570) * (-405.887) [-409.352] (-404.155) (-404.671) -- 0:00:24
605000 -- (-404.868) (-410.857) (-405.313) [-405.966] * [-405.062] (-407.097) (-412.082) (-405.095) -- 0:00:24
Average standard deviation of split frequencies: 0.007184
605500 -- (-408.937) (-408.845) [-408.016] (-405.198) * (-406.058) (-407.098) [-405.845] (-405.235) -- 0:00:24
606000 -- (-406.380) [-405.786] (-407.905) (-405.051) * (-409.148) (-406.588) (-407.023) [-406.140] -- 0:00:24
606500 -- [-404.350] (-410.162) (-403.506) (-407.452) * [-404.655] (-407.935) (-405.791) (-410.273) -- 0:00:24
607000 -- (-404.587) [-407.642] (-407.241) (-405.564) * (-406.490) (-404.029) [-403.454] (-406.663) -- 0:00:23
607500 -- (-410.170) (-407.383) [-406.137] (-404.273) * (-404.644) [-404.700] (-403.742) (-405.502) -- 0:00:23
608000 -- (-408.220) [-406.154] (-409.573) (-406.365) * (-405.290) [-406.240] (-403.527) (-414.032) -- 0:00:23
608500 -- (-404.305) [-404.499] (-404.164) (-404.058) * (-411.228) [-405.907] (-403.994) (-409.589) -- 0:00:24
609000 -- [-405.744] (-406.309) (-403.556) (-403.260) * (-403.830) (-404.708) (-404.580) [-404.490] -- 0:00:24
609500 -- [-405.440] (-405.565) (-403.521) (-409.086) * (-404.749) [-405.695] (-404.620) (-405.764) -- 0:00:24
610000 -- (-407.310) [-404.585] (-405.175) (-404.841) * (-408.029) [-405.979] (-411.230) (-404.543) -- 0:00:24
Average standard deviation of split frequencies: 0.005934
610500 -- [-406.756] (-404.434) (-405.593) (-403.607) * [-404.271] (-405.108) (-405.966) (-406.608) -- 0:00:24
611000 -- (-407.663) (-405.171) (-409.954) [-404.183] * [-403.793] (-405.268) (-403.703) (-403.610) -- 0:00:24
611500 -- (-405.425) (-405.090) (-405.994) [-403.380] * (-406.720) (-404.257) [-411.634] (-405.107) -- 0:00:24
612000 -- [-405.484] (-403.661) (-406.576) (-403.997) * (-404.828) (-404.640) (-409.534) [-405.092] -- 0:00:24
612500 -- (-406.447) [-403.829] (-406.198) (-409.122) * (-405.313) (-404.046) (-409.785) [-405.334] -- 0:00:24
613000 -- (-410.332) (-408.063) [-407.162] (-405.486) * (-406.260) (-403.707) (-405.127) [-404.944] -- 0:00:23
613500 -- (-408.187) (-405.191) (-404.999) [-407.142] * [-406.322] (-405.525) (-404.902) (-407.492) -- 0:00:23
614000 -- (-407.152) [-404.236] (-405.471) (-407.088) * [-404.532] (-404.423) (-408.383) (-403.601) -- 0:00:23
614500 -- (-405.176) (-405.672) [-406.070] (-406.383) * (-405.955) (-404.630) [-407.136] (-406.560) -- 0:00:23
615000 -- (-404.292) (-404.975) (-407.040) [-409.739] * (-404.224) (-407.949) (-405.012) [-405.136] -- 0:00:23
Average standard deviation of split frequencies: 0.006266
615500 -- (-405.582) [-406.153] (-407.866) (-407.919) * (-408.377) (-404.813) (-406.408) [-404.046] -- 0:00:23
616000 -- [-405.386] (-410.661) (-409.001) (-403.619) * (-408.178) (-404.827) (-407.396) [-405.255] -- 0:00:23
616500 -- (-406.502) (-406.015) (-405.332) [-403.707] * [-403.920] (-405.803) (-406.088) (-405.156) -- 0:00:23
617000 -- (-404.442) [-408.482] (-404.718) (-404.052) * [-404.257] (-407.344) (-403.844) (-411.528) -- 0:00:23
617500 -- (-403.551) (-407.118) [-405.230] (-406.348) * (-403.507) [-403.560] (-404.057) (-410.338) -- 0:00:23
618000 -- (-403.883) [-407.105] (-403.363) (-406.425) * (-406.615) [-405.912] (-406.242) (-406.175) -- 0:00:23
618500 -- (-404.559) (-406.078) (-404.076) [-404.091] * [-405.704] (-409.984) (-404.077) (-405.793) -- 0:00:23
619000 -- (-405.194) (-405.849) [-406.091] (-404.781) * (-405.619) (-407.542) (-406.729) [-406.266] -- 0:00:23
619500 -- (-403.473) (-405.135) [-404.356] (-407.164) * [-406.138] (-405.085) (-410.398) (-404.141) -- 0:00:23
620000 -- [-403.806] (-403.495) (-404.554) (-409.678) * [-405.932] (-407.885) (-408.973) (-406.181) -- 0:00:23
Average standard deviation of split frequencies: 0.006551
620500 -- [-404.041] (-404.665) (-404.286) (-406.622) * (-404.270) [-407.911] (-406.641) (-403.390) -- 0:00:23
621000 -- [-403.969] (-406.019) (-407.130) (-406.412) * [-405.096] (-406.354) (-405.296) (-403.281) -- 0:00:23
621500 -- (-405.318) [-407.445] (-408.633) (-409.934) * (-406.164) (-403.814) [-404.724] (-404.283) -- 0:00:23
622000 -- (-405.099) (-406.554) (-404.121) [-404.219] * (-408.507) [-407.893] (-407.242) (-403.710) -- 0:00:23
622500 -- [-405.519] (-407.917) (-407.251) (-406.562) * (-405.319) [-408.758] (-407.720) (-414.678) -- 0:00:23
623000 -- [-405.581] (-407.283) (-403.189) (-404.543) * (-405.582) (-409.377) [-404.865] (-405.156) -- 0:00:22
623500 -- [-409.404] (-404.405) (-404.609) (-405.539) * (-407.004) (-407.582) (-405.170) [-403.932] -- 0:00:22
624000 -- (-405.410) (-403.522) [-407.245] (-409.012) * (-408.601) (-406.472) [-403.547] (-404.547) -- 0:00:22
624500 -- (-407.999) (-406.223) (-407.763) [-404.537] * (-408.990) [-405.415] (-406.332) (-404.427) -- 0:00:22
625000 -- [-403.976] (-405.695) (-406.958) (-404.637) * [-405.975] (-403.850) (-405.416) (-403.727) -- 0:00:22
Average standard deviation of split frequencies: 0.006824
625500 -- [-403.218] (-404.980) (-407.027) (-404.574) * (-405.765) (-403.561) [-405.628] (-406.513) -- 0:00:23
626000 -- [-403.218] (-404.138) (-406.005) (-403.436) * (-407.115) [-403.744] (-405.851) (-405.811) -- 0:00:23
626500 -- (-404.767) (-405.003) [-406.555] (-406.262) * (-410.079) (-404.881) (-405.175) [-404.333] -- 0:00:23
627000 -- [-405.141] (-404.360) (-406.116) (-406.310) * (-407.606) [-409.410] (-404.639) (-403.236) -- 0:00:23
627500 -- [-405.186] (-405.776) (-405.443) (-405.208) * (-404.565) (-403.538) (-403.351) [-403.826] -- 0:00:23
628000 -- (-406.941) (-405.495) (-404.243) [-405.052] * (-407.935) [-404.005] (-410.365) (-405.389) -- 0:00:23
628500 -- (-405.670) (-404.385) (-404.689) [-405.535] * (-411.813) (-404.183) [-405.458] (-405.171) -- 0:00:23
629000 -- [-403.590] (-404.608) (-404.401) (-404.175) * (-405.157) [-404.487] (-409.285) (-406.438) -- 0:00:23
629500 -- (-404.758) (-405.339) [-406.262] (-403.174) * (-407.203) [-403.637] (-404.203) (-410.022) -- 0:00:22
630000 -- (-406.477) (-405.328) [-404.690] (-407.087) * (-406.017) (-404.253) (-405.827) [-408.290] -- 0:00:22
Average standard deviation of split frequencies: 0.007428
630500 -- (-407.600) (-404.111) (-405.218) [-405.932] * (-406.365) (-405.095) (-405.440) [-404.909] -- 0:00:22
631000 -- [-406.828] (-408.577) (-407.085) (-403.746) * (-414.569) [-406.479] (-405.484) (-406.872) -- 0:00:22
631500 -- [-409.207] (-404.718) (-406.285) (-406.357) * (-408.603) (-404.327) (-404.101) [-404.864] -- 0:00:22
632000 -- (-408.243) (-405.245) [-404.399] (-405.161) * [-405.281] (-406.277) (-404.140) (-404.963) -- 0:00:22
632500 -- (-405.113) [-404.643] (-403.727) (-405.075) * (-403.695) (-404.867) [-404.727] (-405.265) -- 0:00:22
633000 -- (-405.679) (-404.471) [-403.432] (-404.189) * (-405.343) (-405.957) [-405.321] (-406.179) -- 0:00:22
633500 -- (-406.499) [-405.071] (-403.382) (-407.253) * [-406.150] (-404.453) (-403.550) (-410.201) -- 0:00:22
634000 -- (-407.110) (-403.821) (-404.997) [-405.553] * (-404.764) [-405.680] (-405.524) (-409.085) -- 0:00:22
634500 -- (-405.483) [-404.688] (-409.301) (-409.754) * (-403.683) [-403.326] (-403.948) (-407.529) -- 0:00:22
635000 -- (-404.324) (-406.039) [-407.357] (-410.084) * [-405.184] (-404.759) (-404.468) (-412.459) -- 0:00:22
Average standard deviation of split frequencies: 0.007366
635500 -- [-407.260] (-405.567) (-407.919) (-407.825) * [-404.262] (-404.579) (-408.598) (-412.895) -- 0:00:22
636000 -- [-406.351] (-407.904) (-410.320) (-407.228) * (-404.559) (-406.931) [-406.183] (-411.426) -- 0:00:22
636500 -- (-404.643) [-403.767] (-406.416) (-407.941) * [-404.888] (-405.846) (-408.350) (-406.292) -- 0:00:22
637000 -- [-409.085] (-404.793) (-405.088) (-408.097) * (-407.050) [-405.445] (-404.035) (-404.126) -- 0:00:22
637500 -- [-405.727] (-407.378) (-408.887) (-410.756) * [-407.238] (-403.479) (-408.011) (-404.828) -- 0:00:22
638000 -- (-403.149) (-403.614) [-404.401] (-404.320) * [-409.959] (-404.139) (-403.265) (-404.844) -- 0:00:22
638500 -- (-404.382) (-406.408) [-404.097] (-403.269) * (-404.312) (-404.284) (-408.838) [-405.536] -- 0:00:22
639000 -- (-406.402) [-403.930] (-406.595) (-404.147) * (-404.422) (-404.793) (-406.831) [-407.493] -- 0:00:22
639500 -- (-405.696) (-404.174) [-404.981] (-409.502) * (-404.797) (-404.408) [-406.065] (-410.488) -- 0:00:21
640000 -- (-404.666) [-406.082] (-408.988) (-409.356) * (-405.303) (-404.996) (-405.872) [-407.308] -- 0:00:21
Average standard deviation of split frequencies: 0.007588
640500 -- (-404.001) (-407.972) (-408.442) [-405.448] * [-406.307] (-406.473) (-406.521) (-405.685) -- 0:00:21
641000 -- (-404.713) (-404.006) (-408.120) [-405.626] * (-404.055) (-405.096) (-407.014) [-403.905] -- 0:00:21
641500 -- (-406.002) (-403.904) [-405.870] (-407.912) * (-404.616) [-404.939] (-409.088) (-403.219) -- 0:00:21
642000 -- [-404.253] (-405.424) (-404.603) (-409.683) * (-404.412) [-403.985] (-407.389) (-405.926) -- 0:00:22
642500 -- (-405.310) [-406.056] (-405.390) (-409.301) * (-404.557) (-408.758) (-406.300) [-404.214] -- 0:00:22
643000 -- [-403.992] (-404.121) (-408.294) (-407.190) * [-403.329] (-405.142) (-407.291) (-404.870) -- 0:00:22
643500 -- [-407.208] (-404.147) (-404.866) (-405.381) * [-404.504] (-405.603) (-405.778) (-410.805) -- 0:00:22
644000 -- [-406.774] (-413.246) (-407.610) (-405.610) * (-405.333) [-405.086] (-405.533) (-406.584) -- 0:00:22
644500 -- (-404.203) [-406.129] (-407.638) (-408.590) * (-407.419) (-409.462) (-405.264) [-405.960] -- 0:00:22
645000 -- [-404.429] (-406.282) (-406.270) (-410.949) * (-405.822) [-405.869] (-405.174) (-406.100) -- 0:00:22
Average standard deviation of split frequencies: 0.008199
645500 -- [-404.017] (-407.299) (-407.428) (-407.666) * (-403.371) (-405.643) [-404.386] (-410.184) -- 0:00:21
646000 -- (-405.589) (-404.229) (-405.633) [-406.908] * (-408.779) (-407.006) [-403.874] (-410.398) -- 0:00:21
646500 -- (-404.427) [-403.875] (-406.824) (-406.795) * (-410.241) (-406.263) [-403.737] (-406.818) -- 0:00:21
647000 -- [-403.523] (-406.012) (-404.537) (-410.182) * (-406.341) (-407.163) [-404.486] (-405.477) -- 0:00:21
647500 -- [-403.405] (-405.224) (-405.931) (-407.208) * (-410.460) [-409.802] (-404.090) (-405.906) -- 0:00:21
648000 -- (-404.317) (-407.359) [-405.768] (-409.441) * (-407.395) (-405.413) [-404.748] (-404.902) -- 0:00:21
648500 -- (-405.058) [-405.573] (-405.736) (-403.934) * (-407.313) [-406.814] (-405.610) (-406.194) -- 0:00:21
649000 -- (-404.889) (-406.188) [-407.247] (-411.650) * (-407.416) (-405.818) [-403.694] (-407.123) -- 0:00:21
649500 -- [-403.888] (-406.433) (-409.510) (-408.743) * (-406.896) [-405.304] (-405.182) (-404.972) -- 0:00:21
650000 -- (-404.839) [-404.333] (-405.077) (-405.406) * [-406.439] (-407.403) (-409.735) (-406.195) -- 0:00:21
Average standard deviation of split frequencies: 0.008566
650500 -- [-406.440] (-404.840) (-404.762) (-407.106) * (-406.187) (-407.080) (-408.932) [-405.087] -- 0:00:21
651000 -- (-405.024) (-412.664) [-405.049] (-403.977) * (-408.283) (-404.301) (-407.694) [-405.378] -- 0:00:21
651500 -- (-403.803) [-404.633] (-404.538) (-403.330) * [-406.618] (-404.809) (-405.753) (-411.011) -- 0:00:21
652000 -- (-405.142) (-405.349) [-404.917] (-409.935) * (-409.465) (-409.476) [-408.502] (-405.702) -- 0:00:21
652500 -- [-405.940] (-404.597) (-406.940) (-404.786) * [-404.850] (-406.173) (-405.618) (-403.561) -- 0:00:21
653000 -- [-404.677] (-404.458) (-410.126) (-403.642) * (-407.195) (-406.778) [-406.314] (-407.474) -- 0:00:21
653500 -- (-403.605) (-406.903) [-405.305] (-404.973) * (-406.344) [-405.750] (-405.785) (-405.401) -- 0:00:21
654000 -- (-403.366) (-405.062) [-405.169] (-406.614) * (-405.664) (-406.955) (-406.731) [-404.547] -- 0:00:21
654500 -- (-409.881) (-406.367) [-404.915] (-407.350) * [-404.076] (-406.061) (-405.618) (-408.129) -- 0:00:21
655000 -- (-409.292) (-404.991) [-404.220] (-411.692) * (-405.042) (-405.186) [-405.026] (-406.510) -- 0:00:21
Average standard deviation of split frequencies: 0.007411
655500 -- (-406.043) (-403.815) (-403.936) [-405.864] * (-413.525) (-406.262) [-405.753] (-403.823) -- 0:00:21
656000 -- (-404.441) (-407.647) (-404.129) [-404.327] * [-405.779] (-405.843) (-406.824) (-404.286) -- 0:00:20
656500 -- (-404.324) (-409.525) (-406.148) [-405.732] * [-405.540] (-405.029) (-407.152) (-404.635) -- 0:00:20
657000 -- (-406.904) [-409.429] (-404.724) (-404.528) * (-408.685) [-403.540] (-406.571) (-405.147) -- 0:00:20
657500 -- (-406.085) (-410.624) [-404.874] (-407.824) * (-406.186) (-405.730) (-404.641) [-406.233] -- 0:00:20
658000 -- [-406.385] (-408.035) (-406.087) (-405.794) * [-404.282] (-405.126) (-404.281) (-408.381) -- 0:00:20
658500 -- (-407.052) (-404.587) [-404.219] (-405.433) * [-405.993] (-403.423) (-408.962) (-404.229) -- 0:00:20
659000 -- (-404.102) [-405.354] (-404.205) (-404.172) * (-404.499) (-404.496) [-406.149] (-405.043) -- 0:00:21
659500 -- (-405.459) (-410.712) (-406.592) [-408.594] * (-405.007) [-403.258] (-404.234) (-404.017) -- 0:00:21
660000 -- (-404.225) [-405.649] (-404.181) (-405.890) * (-405.082) [-404.287] (-408.570) (-405.626) -- 0:00:21
Average standard deviation of split frequencies: 0.007314
660500 -- (-403.822) (-404.446) [-406.678] (-408.143) * (-405.635) (-406.013) (-405.246) [-405.321] -- 0:00:21
661000 -- (-404.296) (-404.441) (-406.220) [-403.337] * (-411.353) [-405.020] (-403.732) (-404.713) -- 0:00:21
661500 -- (-405.373) (-405.731) (-404.453) [-406.768] * [-407.284] (-404.038) (-405.641) (-405.720) -- 0:00:20
662000 -- [-404.151] (-406.209) (-404.269) (-407.588) * (-405.761) (-403.457) [-405.250] (-405.646) -- 0:00:20
662500 -- (-404.355) [-403.727] (-404.797) (-407.062) * [-403.252] (-403.945) (-404.710) (-408.060) -- 0:00:20
663000 -- [-404.237] (-404.180) (-405.732) (-407.966) * [-409.334] (-404.023) (-404.996) (-408.247) -- 0:00:20
663500 -- (-403.290) [-404.312] (-407.982) (-406.240) * (-404.789) [-405.451] (-407.908) (-407.307) -- 0:00:20
664000 -- (-405.105) (-406.141) [-405.664] (-409.429) * [-403.943] (-407.489) (-403.975) (-404.027) -- 0:00:20
664500 -- (-404.490) (-405.697) (-406.698) [-404.804] * (-406.215) (-404.663) [-403.676] (-406.043) -- 0:00:20
665000 -- (-404.063) (-406.351) (-403.534) [-406.659] * (-406.419) [-403.863] (-404.327) (-405.195) -- 0:00:20
Average standard deviation of split frequencies: 0.007255
665500 -- (-403.251) (-407.427) (-404.265) [-407.473] * (-404.465) (-406.239) [-406.216] (-403.915) -- 0:00:20
666000 -- (-409.193) (-404.957) [-404.462] (-409.458) * (-405.782) [-404.558] (-403.719) (-407.274) -- 0:00:20
666500 -- (-406.911) (-404.098) [-408.092] (-409.107) * (-409.978) (-404.830) (-404.004) [-403.126] -- 0:00:20
667000 -- (-408.526) (-404.829) (-404.316) [-409.356] * [-408.386] (-404.491) (-405.465) (-409.815) -- 0:00:20
667500 -- (-404.340) (-405.207) [-404.112] (-406.185) * [-404.333] (-404.136) (-405.025) (-407.584) -- 0:00:20
668000 -- (-404.689) [-404.774] (-404.716) (-404.695) * (-404.878) (-406.902) [-405.345] (-405.484) -- 0:00:20
668500 -- [-404.841] (-403.667) (-404.413) (-406.088) * (-404.357) [-403.499] (-405.549) (-406.030) -- 0:00:20
669000 -- [-407.080] (-403.908) (-404.702) (-406.796) * (-405.512) [-403.729] (-405.184) (-407.496) -- 0:00:20
669500 -- (-405.560) (-403.890) (-410.894) [-409.208] * [-404.359] (-404.128) (-406.432) (-404.549) -- 0:00:20
670000 -- (-403.551) (-406.814) (-403.614) [-406.948] * [-405.376] (-405.303) (-406.317) (-404.302) -- 0:00:20
Average standard deviation of split frequencies: 0.006634
670500 -- (-403.624) (-405.792) [-404.833] (-408.172) * [-405.928] (-405.727) (-405.072) (-406.345) -- 0:00:20
671000 -- (-409.184) [-408.205] (-407.860) (-405.047) * (-403.567) (-406.559) [-404.146] (-404.699) -- 0:00:20
671500 -- (-406.434) (-407.995) (-412.327) [-405.203] * (-403.955) (-404.160) [-407.927] (-407.149) -- 0:00:20
672000 -- (-404.493) (-408.106) [-403.712] (-403.990) * (-405.961) [-404.654] (-405.113) (-404.712) -- 0:00:20
672500 -- (-405.522) (-404.167) (-403.798) [-404.396] * [-404.656] (-403.790) (-403.784) (-404.227) -- 0:00:19
673000 -- (-406.024) [-407.473] (-404.753) (-403.747) * (-405.696) [-404.904] (-405.731) (-410.823) -- 0:00:19
673500 -- (-404.690) [-405.441] (-408.126) (-405.919) * (-404.846) [-407.400] (-403.187) (-406.482) -- 0:00:19
674000 -- (-405.336) (-403.632) [-406.922] (-408.266) * [-405.068] (-403.874) (-405.238) (-406.724) -- 0:00:19
674500 -- (-404.276) [-403.619] (-406.827) (-405.242) * [-405.836] (-406.762) (-406.871) (-404.812) -- 0:00:19
675000 -- (-415.057) [-406.069] (-405.185) (-404.615) * (-409.194) (-406.078) [-406.759] (-404.745) -- 0:00:19
Average standard deviation of split frequencies: 0.006581
675500 -- (-408.828) (-406.444) [-405.483] (-406.393) * (-403.265) [-409.543] (-406.188) (-408.375) -- 0:00:19
676000 -- (-407.432) [-405.107] (-407.982) (-404.177) * (-403.521) (-408.222) (-405.644) [-406.958] -- 0:00:20
676500 -- (-405.739) (-412.279) (-405.840) [-405.966] * (-406.535) (-406.039) [-404.973] (-413.415) -- 0:00:20
677000 -- [-405.437] (-405.566) (-404.546) (-408.379) * (-405.864) (-404.782) (-405.070) [-404.966] -- 0:00:20
677500 -- (-404.909) (-409.165) (-404.718) [-403.611] * (-405.489) (-405.408) [-403.835] (-404.075) -- 0:00:19
678000 -- (-406.564) (-409.785) [-405.250] (-407.359) * [-407.155] (-407.005) (-404.125) (-407.840) -- 0:00:19
678500 -- (-410.520) (-404.042) (-405.417) [-405.037] * (-406.099) [-407.516] (-404.283) (-407.311) -- 0:00:19
679000 -- (-406.887) (-404.134) (-404.401) [-405.084] * [-406.984] (-405.113) (-404.505) (-405.591) -- 0:00:19
679500 -- (-409.314) (-407.885) [-406.190] (-406.151) * (-405.501) [-404.124] (-406.212) (-404.725) -- 0:00:19
680000 -- [-406.478] (-410.058) (-404.876) (-407.072) * (-404.585) [-405.350] (-407.837) (-404.725) -- 0:00:19
Average standard deviation of split frequencies: 0.006363
680500 -- [-406.503] (-404.077) (-403.699) (-405.217) * (-404.254) [-405.100] (-406.073) (-403.431) -- 0:00:19
681000 -- (-404.705) [-404.846] (-404.871) (-405.499) * (-407.244) [-406.136] (-403.778) (-404.883) -- 0:00:19
681500 -- [-403.326] (-405.379) (-407.485) (-404.582) * [-406.924] (-404.098) (-408.285) (-407.592) -- 0:00:19
682000 -- [-403.920] (-404.421) (-406.470) (-407.413) * [-404.772] (-405.942) (-403.768) (-405.972) -- 0:00:19
682500 -- (-404.042) [-403.732] (-404.298) (-405.906) * [-404.465] (-405.770) (-408.046) (-403.790) -- 0:00:19
683000 -- (-404.546) (-405.275) [-404.961] (-405.652) * (-405.349) [-404.759] (-406.815) (-406.362) -- 0:00:19
683500 -- (-407.659) (-407.553) [-404.696] (-405.985) * (-407.247) (-407.420) [-403.980] (-404.901) -- 0:00:19
684000 -- [-406.568] (-404.677) (-406.287) (-405.282) * (-413.780) [-404.666] (-404.465) (-405.362) -- 0:00:19
684500 -- (-405.856) [-405.818] (-406.731) (-407.741) * (-408.613) (-404.424) (-408.651) [-403.775] -- 0:00:19
685000 -- (-406.933) [-404.625] (-403.670) (-403.967) * (-404.236) [-404.932] (-404.659) (-406.079) -- 0:00:19
Average standard deviation of split frequencies: 0.006614
685500 -- (-408.937) [-405.952] (-404.271) (-405.597) * (-407.943) (-403.907) [-404.958] (-406.559) -- 0:00:19
686000 -- (-404.229) (-405.002) [-405.924] (-405.532) * [-406.027] (-405.422) (-411.746) (-407.753) -- 0:00:19
686500 -- [-405.306] (-403.896) (-405.597) (-404.879) * (-409.505) (-403.961) (-407.161) [-406.132] -- 0:00:19
687000 -- (-408.134) (-403.910) [-408.075] (-404.519) * (-408.879) [-405.563] (-406.847) (-405.649) -- 0:00:19
687500 -- (-410.284) (-404.690) (-407.270) [-405.832] * (-406.668) (-404.729) (-403.952) [-408.686] -- 0:00:19
688000 -- [-405.053] (-409.427) (-408.290) (-405.310) * (-407.216) (-405.660) (-403.957) [-407.940] -- 0:00:19
688500 -- (-403.814) [-406.549] (-404.639) (-405.239) * (-408.408) [-409.407] (-404.839) (-405.453) -- 0:00:19
689000 -- (-404.674) (-404.581) [-406.349] (-404.515) * (-404.168) (-405.090) (-404.818) [-405.403] -- 0:00:18
689500 -- (-403.570) (-403.226) [-405.720] (-407.376) * (-405.255) (-404.346) (-405.852) [-406.507] -- 0:00:18
690000 -- [-403.322] (-404.344) (-407.001) (-405.387) * (-404.357) (-404.114) [-404.540] (-407.592) -- 0:00:18
Average standard deviation of split frequencies: 0.006271
690500 -- (-405.296) [-406.434] (-407.067) (-404.546) * [-403.358] (-407.536) (-405.648) (-413.428) -- 0:00:18
691000 -- (-404.549) [-404.045] (-406.603) (-406.776) * [-404.595] (-404.410) (-405.390) (-404.653) -- 0:00:18
691500 -- [-405.215] (-405.080) (-407.496) (-404.398) * (-406.127) (-405.671) [-407.260] (-411.102) -- 0:00:18
692000 -- (-405.674) (-404.739) [-403.695] (-406.262) * (-407.370) (-406.065) (-408.154) [-405.550] -- 0:00:18
692500 -- [-406.171] (-405.759) (-406.136) (-405.171) * (-404.466) [-403.604] (-407.715) (-405.551) -- 0:00:18
693000 -- (-406.847) [-405.105] (-408.645) (-404.941) * [-404.658] (-404.646) (-410.960) (-406.532) -- 0:00:19
693500 -- (-404.121) (-403.084) (-404.611) [-405.846] * (-407.273) (-409.124) [-404.570] (-405.488) -- 0:00:19
694000 -- (-406.475) (-403.098) (-404.575) [-406.283] * (-411.587) (-406.700) (-403.762) [-403.712] -- 0:00:18
694500 -- (-406.629) (-405.225) [-406.080] (-406.854) * (-408.434) (-408.181) (-403.263) [-406.267] -- 0:00:18
695000 -- (-407.190) (-405.119) [-408.790] (-404.485) * (-403.450) (-403.954) [-407.061] (-406.111) -- 0:00:18
Average standard deviation of split frequencies: 0.005969
695500 -- (-407.972) (-406.574) [-405.300] (-403.884) * [-403.942] (-403.806) (-408.962) (-408.669) -- 0:00:18
696000 -- (-404.945) (-407.642) (-408.039) [-405.180] * (-409.382) (-408.285) (-405.868) [-403.860] -- 0:00:18
696500 -- [-403.852] (-405.087) (-404.688) (-403.386) * (-407.463) (-407.848) (-406.350) [-408.426] -- 0:00:18
697000 -- (-404.591) [-406.749] (-405.890) (-404.352) * (-407.024) (-406.188) (-408.534) [-404.195] -- 0:00:18
697500 -- (-404.271) (-407.990) [-405.528] (-405.022) * [-406.230] (-404.302) (-405.797) (-405.560) -- 0:00:18
698000 -- (-405.512) (-404.324) [-404.036] (-406.127) * [-404.501] (-406.132) (-404.629) (-406.788) -- 0:00:18
698500 -- [-404.396] (-409.726) (-406.148) (-408.081) * (-406.174) (-404.538) (-405.658) [-406.813] -- 0:00:18
699000 -- (-405.619) [-405.660] (-414.895) (-405.289) * [-405.508] (-403.854) (-404.088) (-404.787) -- 0:00:18
699500 -- (-410.015) (-408.215) [-407.006] (-404.008) * [-404.619] (-404.086) (-406.965) (-406.538) -- 0:00:18
700000 -- (-410.272) (-409.838) [-407.162] (-404.286) * (-403.854) (-404.936) [-406.982] (-403.481) -- 0:00:18
Average standard deviation of split frequencies: 0.005971
700500 -- (-407.684) [-407.745] (-404.557) (-405.663) * (-408.832) [-403.834] (-404.822) (-405.285) -- 0:00:18
701000 -- (-405.855) (-404.932) [-405.799] (-404.467) * (-408.702) (-405.640) [-405.779] (-405.291) -- 0:00:18
701500 -- (-405.599) (-404.704) (-408.127) [-403.579] * (-405.782) (-404.196) (-404.005) [-407.217] -- 0:00:18
702000 -- (-404.906) (-406.406) (-407.203) [-404.659] * (-405.508) (-404.854) [-403.121] (-404.802) -- 0:00:18
702500 -- (-405.276) (-407.668) [-405.228] (-405.351) * (-405.941) [-404.162] (-403.180) (-405.719) -- 0:00:18
703000 -- [-403.420] (-405.921) (-403.537) (-406.521) * (-410.368) (-406.142) [-404.204] (-404.250) -- 0:00:18
703500 -- (-404.409) (-405.520) [-410.483] (-406.302) * [-404.134] (-408.370) (-403.917) (-404.333) -- 0:00:18
704000 -- (-405.638) (-408.626) (-409.563) [-404.878] * (-403.684) (-407.733) (-405.811) [-404.782] -- 0:00:18
704500 -- [-405.128] (-404.866) (-405.287) (-403.646) * (-407.057) (-405.493) [-406.088] (-404.679) -- 0:00:18
705000 -- [-404.533] (-404.447) (-403.914) (-404.998) * [-407.779] (-404.621) (-404.563) (-404.226) -- 0:00:17
Average standard deviation of split frequencies: 0.005676
705500 -- [-404.171] (-406.835) (-404.377) (-406.279) * (-408.393) (-406.578) (-406.114) [-404.946] -- 0:00:17
706000 -- (-404.523) [-403.553] (-405.350) (-405.343) * (-405.095) (-404.665) [-404.485] (-407.002) -- 0:00:17
706500 -- (-404.256) (-406.888) (-413.764) [-403.297] * (-405.026) [-409.095] (-404.167) (-405.743) -- 0:00:17
707000 -- (-405.744) [-404.091] (-406.693) (-405.456) * [-407.901] (-405.416) (-410.988) (-410.237) -- 0:00:17
707500 -- (-406.307) (-403.747) (-408.672) [-404.600] * (-410.547) (-405.387) (-404.495) [-404.786] -- 0:00:17
708000 -- (-406.910) [-405.880] (-407.081) (-404.390) * [-407.640] (-405.762) (-403.813) (-403.807) -- 0:00:17
708500 -- [-404.952] (-407.818) (-406.821) (-408.886) * (-406.818) [-407.306] (-406.070) (-404.006) -- 0:00:17
709000 -- [-407.778] (-406.173) (-406.770) (-404.548) * (-404.681) (-407.042) (-407.171) [-405.494] -- 0:00:17
709500 -- (-405.486) (-403.993) [-407.367] (-409.706) * (-405.702) (-405.348) (-408.253) [-405.715] -- 0:00:18
710000 -- (-405.916) (-405.145) [-406.791] (-405.379) * (-405.000) (-404.292) (-406.233) [-407.286] -- 0:00:17
Average standard deviation of split frequencies: 0.005265
710500 -- (-407.619) [-404.037] (-404.053) (-404.782) * (-404.853) (-405.894) [-405.101] (-405.925) -- 0:00:17
711000 -- [-405.740] (-407.032) (-403.518) (-405.105) * (-404.791) (-403.345) (-403.981) [-404.827] -- 0:00:17
711500 -- (-406.247) (-406.256) [-405.103] (-404.310) * [-404.066] (-407.448) (-406.805) (-407.942) -- 0:00:17
712000 -- (-405.272) (-403.190) [-407.076] (-406.591) * [-405.829] (-403.904) (-408.503) (-405.539) -- 0:00:17
712500 -- [-404.828] (-404.407) (-404.922) (-404.283) * (-403.687) [-406.547] (-404.952) (-409.333) -- 0:00:17
713000 -- (-410.835) [-404.577] (-413.242) (-406.279) * (-404.243) [-404.086] (-406.276) (-406.269) -- 0:00:17
713500 -- (-408.072) (-403.446) (-403.815) [-404.796] * (-403.939) [-404.574] (-403.207) (-406.840) -- 0:00:17
714000 -- (-404.657) (-404.365) [-405.154] (-405.354) * [-404.276] (-411.034) (-406.213) (-403.468) -- 0:00:17
714500 -- (-405.426) [-404.105] (-405.318) (-404.198) * (-404.509) (-404.174) [-406.720] (-403.304) -- 0:00:17
715000 -- (-408.155) (-407.456) [-403.668] (-404.818) * [-405.498] (-404.298) (-405.940) (-403.539) -- 0:00:17
Average standard deviation of split frequencies: 0.005349
715500 -- (-405.262) (-404.994) [-403.668] (-405.103) * (-404.024) (-405.981) (-406.853) [-406.517] -- 0:00:17
716000 -- (-410.126) (-406.173) [-404.920] (-408.359) * (-409.141) [-405.465] (-404.621) (-403.336) -- 0:00:17
716500 -- (-406.586) (-404.701) (-404.681) [-406.459] * (-408.812) (-410.132) [-404.926] (-403.508) -- 0:00:17
717000 -- (-404.421) (-408.922) [-405.776] (-404.965) * [-403.883] (-404.553) (-407.422) (-406.574) -- 0:00:17
717500 -- (-404.392) [-403.331] (-405.467) (-407.853) * (-406.029) (-404.768) (-408.755) [-408.328] -- 0:00:17
718000 -- (-408.248) (-405.496) [-404.827] (-407.713) * [-405.588] (-403.493) (-404.751) (-410.491) -- 0:00:17
718500 -- (-408.686) [-404.718] (-404.843) (-405.464) * (-405.133) (-406.169) [-403.896] (-403.744) -- 0:00:17
719000 -- (-407.080) [-404.540] (-408.083) (-404.516) * (-410.310) (-409.534) [-403.848] (-404.670) -- 0:00:17
719500 -- (-406.388) (-404.861) [-406.251] (-404.500) * (-408.031) (-404.868) [-405.918] (-412.497) -- 0:00:17
720000 -- (-407.577) (-404.464) (-404.861) [-406.660] * [-406.848] (-404.316) (-405.337) (-403.988) -- 0:00:17
Average standard deviation of split frequencies: 0.005642
720500 -- (-405.597) (-404.513) [-403.861] (-404.699) * [-407.489] (-404.452) (-404.029) (-407.258) -- 0:00:17
721000 -- (-405.013) (-404.769) [-403.225] (-404.918) * [-406.564] (-405.422) (-404.750) (-404.898) -- 0:00:17
721500 -- [-405.643] (-405.567) (-404.858) (-404.590) * (-408.074) (-404.394) [-406.268] (-406.297) -- 0:00:16
722000 -- (-405.000) [-406.519] (-405.543) (-403.676) * [-409.262] (-407.511) (-404.625) (-404.399) -- 0:00:16
722500 -- [-403.766] (-404.040) (-406.468) (-404.945) * (-408.579) (-410.108) [-404.681] (-403.665) -- 0:00:16
723000 -- (-404.273) [-407.070] (-411.902) (-405.562) * (-404.618) (-408.354) (-404.089) [-404.671] -- 0:00:16
723500 -- [-410.923] (-405.712) (-404.231) (-405.165) * (-404.571) (-404.842) [-404.481] (-409.682) -- 0:00:16
724000 -- (-405.657) (-407.901) [-407.674] (-404.397) * (-407.596) [-405.127] (-404.042) (-406.329) -- 0:00:16
724500 -- (-404.841) (-406.838) (-406.881) [-404.790] * [-407.421] (-404.048) (-403.214) (-407.974) -- 0:00:16
725000 -- (-404.568) [-404.869] (-406.648) (-404.779) * [-409.456] (-404.068) (-404.873) (-403.785) -- 0:00:16
Average standard deviation of split frequencies: 0.005803
725500 -- (-411.550) (-405.289) (-411.750) [-406.635] * (-410.363) (-405.179) (-404.987) [-404.068] -- 0:00:16
726000 -- (-405.030) (-405.356) [-406.410] (-404.912) * (-407.461) [-405.237] (-404.843) (-406.478) -- 0:00:16
726500 -- (-406.173) (-404.977) [-405.117] (-403.614) * (-403.197) [-406.840] (-403.671) (-404.602) -- 0:00:16
727000 -- (-406.063) [-405.386] (-405.223) (-408.329) * (-404.501) (-408.682) [-404.815] (-404.166) -- 0:00:16
727500 -- [-405.735] (-406.046) (-405.644) (-408.002) * (-410.640) [-406.372] (-404.474) (-407.005) -- 0:00:16
728000 -- (-411.230) (-407.742) (-404.151) [-404.464] * (-410.548) (-405.560) [-404.513] (-404.727) -- 0:00:16
728500 -- (-408.081) (-405.274) [-408.482] (-406.893) * (-404.899) (-405.651) [-404.654] (-407.930) -- 0:00:16
729000 -- [-405.983] (-404.104) (-407.656) (-404.905) * [-404.670] (-407.457) (-405.669) (-405.330) -- 0:00:16
729500 -- (-405.513) (-406.074) (-408.036) [-403.517] * (-407.411) (-405.149) [-403.883] (-404.795) -- 0:00:16
730000 -- (-404.626) (-405.258) (-408.821) [-407.076] * (-408.552) [-410.263] (-403.210) (-405.022) -- 0:00:16
Average standard deviation of split frequencies: 0.005887
730500 -- (-406.705) [-405.449] (-404.462) (-403.596) * [-404.117] (-408.887) (-411.270) (-404.607) -- 0:00:16
731000 -- [-403.686] (-405.184) (-404.862) (-404.494) * (-406.073) (-405.936) (-406.075) [-404.021] -- 0:00:16
731500 -- [-406.761] (-407.376) (-404.371) (-404.702) * (-405.420) (-413.405) [-405.497] (-404.795) -- 0:00:16
732000 -- (-405.547) (-405.664) (-408.066) [-407.359] * (-406.679) [-405.277] (-405.755) (-406.587) -- 0:00:16
732500 -- [-406.019] (-407.655) (-404.722) (-405.453) * (-407.178) [-405.415] (-405.979) (-407.473) -- 0:00:16
733000 -- (-404.859) (-404.766) [-404.382] (-407.180) * [-407.648] (-407.760) (-406.173) (-405.240) -- 0:00:16
733500 -- (-404.355) (-404.438) (-403.240) [-405.031] * (-409.687) [-408.159] (-404.560) (-407.669) -- 0:00:16
734000 -- (-404.373) [-405.594] (-406.519) (-403.711) * (-406.885) [-404.104] (-404.215) (-412.002) -- 0:00:16
734500 -- (-405.282) (-404.341) [-404.369] (-403.219) * (-404.769) (-404.827) [-407.769] (-406.021) -- 0:00:16
735000 -- (-404.584) (-406.167) (-408.041) [-404.601] * (-405.182) [-404.750] (-406.312) (-406.888) -- 0:00:16
Average standard deviation of split frequencies: 0.005604
735500 -- (-403.407) (-404.111) (-404.254) [-404.366] * (-405.993) (-404.342) (-404.955) [-404.644] -- 0:00:16
736000 -- (-405.788) (-407.961) (-407.204) [-404.426] * (-403.951) (-409.361) (-404.441) [-404.451] -- 0:00:16
736500 -- (-404.270) (-408.326) (-404.138) [-404.509] * (-408.379) (-406.452) (-406.615) [-404.992] -- 0:00:16
737000 -- (-403.463) (-405.610) (-404.223) [-404.491] * (-407.341) [-404.957] (-406.205) (-406.007) -- 0:00:16
737500 -- [-404.248] (-407.396) (-405.343) (-406.157) * (-407.937) [-403.813] (-403.534) (-404.905) -- 0:00:16
738000 -- (-404.887) (-406.704) (-404.833) [-403.381] * (-403.683) [-404.243] (-404.192) (-407.959) -- 0:00:15
738500 -- (-407.184) (-406.959) (-408.135) [-403.859] * (-404.755) (-406.571) (-408.925) [-403.251] -- 0:00:15
739000 -- (-403.353) [-404.755] (-409.513) (-404.554) * (-404.690) [-407.158] (-410.818) (-403.205) -- 0:00:15
739500 -- (-404.621) (-404.118) (-404.876) [-404.514] * [-404.979] (-404.812) (-405.636) (-404.974) -- 0:00:15
740000 -- (-404.933) (-404.549) [-403.439] (-404.379) * (-405.635) (-404.569) (-405.841) [-405.541] -- 0:00:15
Average standard deviation of split frequencies: 0.005887
740500 -- (-406.336) (-409.998) (-405.076) [-403.973] * (-404.281) [-406.629] (-404.791) (-404.689) -- 0:00:15
741000 -- (-405.982) [-405.693] (-405.357) (-404.239) * (-406.767) [-406.339] (-403.420) (-404.874) -- 0:00:15
741500 -- [-403.596] (-405.174) (-404.255) (-407.035) * (-404.728) [-405.034] (-404.195) (-406.020) -- 0:00:15
742000 -- (-406.020) (-405.367) [-406.195] (-405.228) * (-403.878) [-406.318] (-405.934) (-404.642) -- 0:00:15
742500 -- (-408.556) (-406.369) [-404.760] (-403.903) * (-406.326) [-406.766] (-413.288) (-407.672) -- 0:00:15
743000 -- [-404.343] (-405.312) (-409.297) (-403.429) * (-406.587) [-411.682] (-407.909) (-405.322) -- 0:00:15
743500 -- (-404.655) (-404.210) [-404.800] (-403.207) * [-405.861] (-408.160) (-407.973) (-406.255) -- 0:00:15
744000 -- (-407.709) (-407.330) (-403.609) [-403.244] * (-404.072) (-408.438) (-408.125) [-403.855] -- 0:00:15
744500 -- (-408.303) (-407.961) (-408.930) [-405.750] * (-403.693) (-404.292) (-407.518) [-406.789] -- 0:00:15
745000 -- [-409.452] (-407.655) (-405.119) (-406.367) * (-403.703) (-407.201) [-408.543] (-405.480) -- 0:00:15
Average standard deviation of split frequencies: 0.006556
745500 -- (-404.810) (-404.725) (-405.055) [-404.579] * (-407.576) [-405.930] (-406.195) (-404.354) -- 0:00:15
746000 -- [-404.153] (-405.498) (-407.722) (-405.066) * (-406.453) [-409.499] (-406.204) (-404.183) -- 0:00:15
746500 -- (-408.839) (-409.177) (-404.939) [-403.728] * [-405.157] (-405.163) (-408.755) (-405.093) -- 0:00:15
747000 -- (-404.873) (-403.805) (-406.889) [-404.617] * (-406.143) (-407.325) (-404.724) [-405.211] -- 0:00:15
747500 -- (-404.072) (-406.397) (-404.910) [-403.891] * (-404.790) (-404.495) (-403.797) [-403.473] -- 0:00:15
748000 -- (-404.580) (-406.695) (-406.305) [-404.308] * (-404.530) [-403.240] (-405.949) (-406.703) -- 0:00:15
748500 -- (-403.325) [-404.498] (-405.279) (-404.984) * (-404.785) [-405.242] (-405.480) (-407.084) -- 0:00:15
749000 -- (-403.939) (-408.026) [-407.238] (-404.449) * (-406.178) (-404.753) [-406.908] (-405.021) -- 0:00:15
749500 -- (-407.367) (-406.553) [-407.709] (-403.630) * [-405.620] (-406.123) (-403.648) (-410.030) -- 0:00:15
750000 -- [-407.912] (-404.740) (-405.405) (-403.332) * (-405.450) [-406.910] (-407.180) (-405.290) -- 0:00:15
Average standard deviation of split frequencies: 0.006829
750500 -- (-406.861) (-407.707) [-404.800] (-403.910) * [-403.877] (-405.214) (-403.564) (-404.682) -- 0:00:15
751000 -- (-407.783) (-406.911) (-407.864) [-405.000] * (-406.977) (-405.780) [-403.903] (-404.699) -- 0:00:15
751500 -- (-404.215) [-405.128] (-407.307) (-410.537) * (-404.424) (-405.964) [-405.757] (-403.928) -- 0:00:15
752000 -- (-404.391) (-403.966) (-404.301) [-406.038] * (-405.116) [-406.908] (-409.571) (-404.946) -- 0:00:15
752500 -- (-404.562) (-406.323) (-405.830) [-407.280] * (-409.072) [-405.564] (-407.167) (-406.699) -- 0:00:15
753000 -- [-404.919] (-409.846) (-406.961) (-405.539) * (-411.324) (-405.758) (-405.377) [-404.450] -- 0:00:15
753500 -- (-405.850) [-404.057] (-405.756) (-404.327) * (-405.856) (-404.569) (-406.500) [-405.679] -- 0:00:15
754000 -- (-404.628) (-404.196) (-406.724) [-406.638] * (-408.643) (-405.681) [-404.054] (-407.183) -- 0:00:15
754500 -- (-406.068) (-409.170) (-409.524) [-405.329] * (-407.596) (-404.684) (-404.844) [-404.477] -- 0:00:14
755000 -- (-408.434) [-407.984] (-405.097) (-403.607) * (-404.780) (-404.534) (-405.673) [-404.593] -- 0:00:14
Average standard deviation of split frequencies: 0.006859
755500 -- (-404.250) [-404.066] (-406.598) (-404.923) * (-405.446) (-409.536) (-404.825) [-405.421] -- 0:00:14
756000 -- (-403.685) (-404.524) (-407.427) [-408.668] * (-403.770) (-410.504) [-406.758] (-403.944) -- 0:00:14
756500 -- [-404.017] (-404.865) (-405.951) (-411.854) * [-404.416] (-408.199) (-406.372) (-407.103) -- 0:00:14
757000 -- (-405.310) (-406.486) [-406.053] (-404.845) * (-405.196) (-411.947) (-405.927) [-404.507] -- 0:00:14
757500 -- (-404.303) (-410.053) [-406.112] (-404.546) * (-407.177) (-407.359) (-406.077) [-407.225] -- 0:00:14
758000 -- [-403.543] (-404.440) (-408.717) (-405.092) * (-406.452) (-404.890) [-405.561] (-408.861) -- 0:00:14
758500 -- (-403.672) (-405.915) (-404.596) [-407.324] * (-407.582) (-403.518) [-406.499] (-417.009) -- 0:00:14
759000 -- (-406.963) [-403.422] (-404.277) (-404.731) * (-408.032) [-406.029] (-406.571) (-411.330) -- 0:00:14
759500 -- [-404.115] (-406.579) (-404.127) (-403.393) * [-404.630] (-411.496) (-403.612) (-407.019) -- 0:00:14
760000 -- (-404.281) [-404.933] (-405.864) (-403.696) * [-404.169] (-405.446) (-403.929) (-405.555) -- 0:00:14
Average standard deviation of split frequencies: 0.006933
760500 -- [-403.230] (-406.706) (-405.145) (-404.022) * (-405.897) (-405.862) (-407.176) [-404.896] -- 0:00:14
761000 -- (-405.056) (-404.713) (-413.871) [-406.814] * (-406.750) (-406.246) (-406.252) [-404.781] -- 0:00:14
761500 -- [-407.525] (-405.079) (-414.178) (-404.259) * (-406.520) (-406.076) (-408.960) [-404.401] -- 0:00:14
762000 -- (-406.072) (-406.118) (-408.400) [-403.542] * (-405.486) [-407.301] (-406.190) (-404.316) -- 0:00:14
762500 -- (-405.463) (-407.797) (-408.203) [-404.369] * [-405.923] (-405.699) (-407.078) (-405.649) -- 0:00:14
763000 -- (-409.101) (-404.100) (-406.891) [-404.414] * (-405.534) [-403.605] (-404.407) (-406.599) -- 0:00:14
763500 -- (-407.817) [-405.857] (-404.418) (-405.432) * (-413.316) (-404.527) [-403.927] (-406.621) -- 0:00:14
764000 -- (-408.648) (-404.532) [-405.188] (-404.312) * (-403.910) (-407.500) (-409.624) [-406.367] -- 0:00:14
764500 -- (-405.145) (-407.720) [-404.500] (-405.092) * (-403.533) (-405.294) (-403.330) [-408.671] -- 0:00:14
765000 -- (-404.653) (-408.136) (-405.621) [-405.228] * [-403.270] (-406.493) (-408.254) (-405.088) -- 0:00:14
Average standard deviation of split frequencies: 0.006116
765500 -- (-406.944) (-403.229) [-404.227] (-407.393) * [-404.436] (-405.156) (-405.798) (-405.406) -- 0:00:14
766000 -- [-406.167] (-404.381) (-405.224) (-408.583) * (-406.716) [-407.000] (-404.094) (-404.528) -- 0:00:14
766500 -- [-408.366] (-403.836) (-403.872) (-403.895) * (-405.292) (-406.557) [-404.890] (-405.795) -- 0:00:14
767000 -- [-405.210] (-408.499) (-405.194) (-404.596) * [-408.057] (-405.267) (-403.271) (-405.456) -- 0:00:14
767500 -- (-406.091) (-405.867) [-407.163] (-405.633) * (-405.709) (-404.031) [-404.970] (-410.439) -- 0:00:14
768000 -- [-403.743] (-406.388) (-409.339) (-405.408) * (-404.663) [-406.395] (-404.074) (-404.076) -- 0:00:14
768500 -- [-407.856] (-405.529) (-405.055) (-403.888) * [-404.662] (-406.995) (-403.525) (-404.733) -- 0:00:14
769000 -- (-407.157) (-406.485) (-405.700) [-403.900] * [-404.695] (-405.336) (-405.537) (-405.437) -- 0:00:14
769500 -- (-410.197) (-408.087) [-405.050] (-411.844) * (-404.969) (-407.670) (-408.063) [-409.651] -- 0:00:14
770000 -- (-404.833) (-405.869) [-405.198] (-408.426) * (-405.065) (-409.831) [-404.986] (-408.455) -- 0:00:14
Average standard deviation of split frequencies: 0.005658
770500 -- [-405.232] (-407.101) (-408.097) (-409.614) * (-404.194) (-412.725) [-407.531] (-405.942) -- 0:00:13
771000 -- (-405.750) (-405.087) [-408.598] (-407.356) * [-404.977] (-409.621) (-408.695) (-405.764) -- 0:00:13
771500 -- (-410.229) [-403.570] (-408.793) (-408.520) * (-406.848) [-407.120] (-412.622) (-405.681) -- 0:00:13
772000 -- (-404.344) [-405.047] (-403.907) (-405.461) * (-405.511) (-408.422) (-408.236) [-405.683] -- 0:00:13
772500 -- (-405.811) (-406.521) (-403.687) [-408.688] * (-404.768) (-405.373) (-404.771) [-406.270] -- 0:00:13
773000 -- [-404.972] (-405.454) (-407.639) (-407.245) * (-409.548) (-404.808) [-404.014] (-405.245) -- 0:00:13
773500 -- [-406.900] (-405.638) (-405.399) (-406.508) * (-405.874) (-405.388) (-403.467) [-405.408] -- 0:00:13
774000 -- (-405.297) (-405.227) [-405.070] (-407.070) * (-408.676) (-405.178) [-405.652] (-407.438) -- 0:00:13
774500 -- (-406.573) (-407.279) [-404.566] (-410.572) * (-404.668) (-405.791) [-405.300] (-405.775) -- 0:00:13
775000 -- (-407.284) (-409.394) [-404.323] (-403.594) * (-404.919) (-404.997) (-404.401) [-405.510] -- 0:00:13
Average standard deviation of split frequencies: 0.005847
775500 -- (-405.602) (-406.237) [-406.201] (-409.252) * (-405.542) (-403.418) [-404.912] (-404.880) -- 0:00:13
776000 -- (-404.526) (-404.835) (-403.678) [-403.417] * [-405.420] (-405.408) (-404.447) (-406.607) -- 0:00:13
776500 -- (-406.339) [-403.653] (-404.379) (-405.339) * (-408.490) (-403.298) (-404.732) [-404.131] -- 0:00:13
777000 -- (-404.001) [-403.861] (-405.057) (-404.119) * (-405.836) [-404.646] (-406.293) (-405.316) -- 0:00:13
777500 -- (-403.663) [-406.316] (-410.463) (-404.220) * [-408.223] (-407.196) (-406.527) (-405.065) -- 0:00:13
778000 -- [-403.566] (-407.948) (-414.793) (-405.670) * (-406.816) (-408.239) [-404.413] (-405.315) -- 0:00:13
778500 -- (-403.606) (-405.817) [-406.848] (-405.575) * (-405.603) (-406.243) [-403.664] (-404.922) -- 0:00:13
779000 -- (-407.904) (-404.365) [-403.959] (-403.410) * (-405.572) (-405.158) [-405.155] (-406.812) -- 0:00:13
779500 -- (-405.405) (-405.389) [-403.736] (-403.533) * [-405.264] (-405.535) (-404.840) (-405.810) -- 0:00:13
780000 -- (-408.547) (-406.430) [-404.322] (-407.047) * (-404.728) [-403.702] (-408.054) (-406.479) -- 0:00:13
Average standard deviation of split frequencies: 0.006227
780500 -- (-406.976) [-404.988] (-403.590) (-405.113) * (-405.762) [-403.285] (-403.870) (-407.512) -- 0:00:13
781000 -- (-406.082) (-405.707) [-411.572] (-404.463) * (-408.034) (-411.338) [-403.878] (-404.396) -- 0:00:13
781500 -- (-407.424) [-406.417] (-408.223) (-403.465) * (-405.717) (-406.480) [-405.909] (-405.291) -- 0:00:13
782000 -- (-405.841) (-405.845) [-405.382] (-404.623) * (-404.154) (-407.359) (-405.856) [-404.964] -- 0:00:13
782500 -- (-408.664) (-404.149) (-408.533) [-405.134] * (-405.138) [-407.227] (-406.117) (-404.673) -- 0:00:13
783000 -- (-403.817) (-409.188) [-406.466] (-404.216) * [-405.058] (-407.312) (-408.116) (-404.329) -- 0:00:13
783500 -- (-403.251) [-406.968] (-407.923) (-405.719) * (-406.158) [-405.167] (-404.228) (-406.036) -- 0:00:13
784000 -- (-406.190) [-405.466] (-405.101) (-404.888) * (-405.701) (-405.944) (-406.401) [-406.777] -- 0:00:13
784500 -- (-410.157) (-406.905) (-409.151) [-404.458] * (-407.322) (-403.312) (-404.245) [-404.578] -- 0:00:13
785000 -- (-405.526) (-405.649) [-405.931] (-405.008) * [-404.058] (-403.158) (-406.931) (-407.995) -- 0:00:13
Average standard deviation of split frequencies: 0.005848
785500 -- (-405.607) (-404.482) (-407.949) [-407.610] * (-404.572) [-406.441] (-407.442) (-403.268) -- 0:00:13
786000 -- (-405.387) (-403.614) [-405.590] (-408.531) * (-403.528) (-406.168) (-404.263) [-403.790] -- 0:00:13
786500 -- (-408.528) (-405.321) [-405.304] (-404.169) * (-406.608) [-405.095] (-404.266) (-405.870) -- 0:00:13
787000 -- (-406.624) (-406.140) [-403.327] (-406.585) * (-404.040) [-407.974] (-405.106) (-405.340) -- 0:00:12
787500 -- [-405.131] (-406.067) (-404.762) (-408.960) * (-406.116) (-411.869) (-404.045) [-404.770] -- 0:00:12
788000 -- (-403.889) [-404.767] (-409.160) (-404.975) * (-405.333) (-407.162) (-405.806) [-405.537] -- 0:00:12
788500 -- [-404.776] (-407.442) (-405.097) (-404.822) * [-405.827] (-406.356) (-407.490) (-407.187) -- 0:00:12
789000 -- (-404.398) [-408.088] (-405.024) (-404.592) * (-406.406) [-404.214] (-408.513) (-404.601) -- 0:00:12
789500 -- [-403.443] (-404.594) (-405.614) (-405.847) * [-406.248] (-405.906) (-410.532) (-404.824) -- 0:00:12
790000 -- (-410.463) (-407.427) (-406.123) [-404.176] * (-405.590) (-405.199) [-405.267] (-404.760) -- 0:00:12
Average standard deviation of split frequencies: 0.005701
790500 -- (-408.018) (-405.175) (-404.320) [-403.297] * (-404.337) (-405.563) (-405.665) [-405.380] -- 0:00:12
791000 -- (-403.712) (-407.336) (-403.338) [-405.476] * (-403.284) (-403.568) (-410.772) [-403.565] -- 0:00:12
791500 -- (-404.045) [-405.625] (-404.940) (-403.985) * (-404.240) (-406.168) [-408.074] (-405.250) -- 0:00:12
792000 -- [-405.270] (-405.294) (-405.907) (-407.817) * (-408.754) (-404.291) [-406.195] (-408.153) -- 0:00:12
792500 -- (-407.505) [-403.793] (-407.298) (-407.157) * [-403.790] (-404.081) (-406.085) (-408.205) -- 0:00:12
793000 -- (-405.197) (-405.435) [-404.419] (-403.512) * (-406.890) (-403.529) [-404.081] (-403.835) -- 0:00:12
793500 -- [-405.199] (-405.630) (-405.715) (-404.633) * (-406.200) (-410.882) [-407.251] (-406.194) -- 0:00:12
794000 -- [-404.521] (-404.380) (-405.516) (-407.672) * (-405.409) [-405.056] (-407.595) (-404.007) -- 0:00:12
794500 -- [-403.683] (-404.260) (-408.459) (-406.071) * (-405.181) [-405.076] (-408.809) (-405.437) -- 0:00:12
795000 -- (-405.102) (-407.650) [-408.187] (-404.912) * (-408.012) [-404.162] (-407.019) (-405.691) -- 0:00:12
Average standard deviation of split frequencies: 0.005330
795500 -- (-406.228) [-408.516] (-407.335) (-408.053) * (-405.896) (-406.550) [-403.514] (-411.922) -- 0:00:12
796000 -- [-405.351] (-406.208) (-410.811) (-403.826) * (-406.067) (-404.772) (-407.279) [-413.540] -- 0:00:12
796500 -- (-406.332) (-404.722) [-408.036] (-404.970) * (-405.672) (-406.626) (-410.618) [-406.027] -- 0:00:12
797000 -- (-405.619) [-406.153] (-404.933) (-407.766) * [-408.958] (-403.678) (-406.550) (-405.511) -- 0:00:12
797500 -- (-405.759) (-403.811) [-404.654] (-404.092) * (-403.759) (-405.692) [-407.164] (-403.835) -- 0:00:12
798000 -- [-403.434] (-404.968) (-407.729) (-403.949) * [-404.230] (-411.096) (-405.553) (-405.450) -- 0:00:12
798500 -- (-406.049) [-404.532] (-404.318) (-405.417) * (-412.028) [-405.308] (-411.535) (-404.521) -- 0:00:12
799000 -- (-407.014) [-405.563] (-403.605) (-404.245) * (-406.540) (-404.680) [-408.023] (-404.529) -- 0:00:12
799500 -- (-404.102) (-405.032) (-407.659) [-405.134] * [-407.523] (-404.791) (-405.873) (-406.144) -- 0:00:12
800000 -- (-404.289) (-405.368) [-405.304] (-408.944) * (-407.063) (-408.478) (-405.489) [-407.491] -- 0:00:12
Average standard deviation of split frequencies: 0.004673
800500 -- (-404.312) (-404.068) (-403.773) [-405.910] * (-406.018) [-405.439] (-404.424) (-411.184) -- 0:00:12
801000 -- [-403.823] (-405.962) (-403.297) (-407.653) * (-404.725) (-405.450) (-405.128) [-407.303] -- 0:00:12
801500 -- (-406.604) (-404.705) (-403.265) [-409.790] * (-405.206) (-405.437) [-405.275] (-406.665) -- 0:00:12
802000 -- (-404.527) [-404.149] (-405.805) (-404.782) * (-404.848) (-405.138) (-405.514) [-404.726] -- 0:00:12
802500 -- [-403.785] (-407.008) (-404.224) (-405.666) * (-405.687) [-405.135] (-407.155) (-413.159) -- 0:00:12
803000 -- [-405.161] (-407.589) (-406.546) (-405.605) * [-405.919] (-406.046) (-405.273) (-406.094) -- 0:00:12
803500 -- [-404.860] (-404.477) (-407.829) (-411.133) * (-405.121) [-403.945] (-406.267) (-406.718) -- 0:00:11
804000 -- (-403.598) [-406.013] (-405.922) (-405.510) * (-403.586) [-407.135] (-408.059) (-405.522) -- 0:00:11
804500 -- (-403.961) (-404.799) (-405.993) [-404.746] * (-405.104) (-405.428) (-405.514) [-406.668] -- 0:00:11
805000 -- (-403.614) (-404.290) (-404.277) [-404.412] * (-404.904) (-403.974) (-407.708) [-408.212] -- 0:00:11
Average standard deviation of split frequencies: 0.004862
805500 -- (-407.379) (-404.600) [-404.215] (-414.137) * (-405.825) (-406.561) (-406.915) [-404.535] -- 0:00:11
806000 -- (-404.738) (-405.098) [-404.192] (-405.091) * (-405.874) (-405.363) [-405.244] (-403.371) -- 0:00:11
806500 -- (-409.056) (-404.666) [-405.233] (-403.600) * (-403.460) [-403.749] (-405.912) (-406.107) -- 0:00:11
807000 -- (-404.859) (-403.936) [-406.470] (-409.944) * (-403.929) (-403.872) (-406.160) [-405.766] -- 0:00:11
807500 -- (-406.041) (-405.146) [-405.829] (-408.198) * [-404.561] (-409.424) (-406.590) (-405.820) -- 0:00:11
808000 -- (-404.275) (-405.031) (-404.227) [-405.923] * (-407.774) [-407.112] (-405.699) (-407.632) -- 0:00:11
808500 -- (-406.838) (-405.069) (-404.177) [-407.804] * (-405.368) (-404.089) [-407.012] (-405.806) -- 0:00:11
809000 -- (-407.599) [-406.597] (-407.716) (-408.659) * (-405.731) [-403.292] (-404.258) (-407.103) -- 0:00:11
809500 -- (-405.179) (-405.028) (-404.805) [-404.056] * (-403.211) (-404.106) [-406.155] (-405.339) -- 0:00:11
810000 -- (-407.470) (-407.469) [-406.896] (-406.632) * (-405.905) (-407.686) (-403.872) [-403.585] -- 0:00:11
Average standard deviation of split frequencies: 0.004543
810500 -- (-405.131) [-405.700] (-404.733) (-404.876) * (-408.813) (-409.065) [-404.552] (-404.998) -- 0:00:11
811000 -- (-406.201) (-407.655) (-406.676) [-404.863] * (-411.690) (-404.890) (-405.410) [-404.344] -- 0:00:11
811500 -- [-403.514] (-403.811) (-403.801) (-404.310) * (-409.565) (-404.220) (-404.868) [-406.462] -- 0:00:11
812000 -- (-404.173) (-403.578) (-406.700) [-404.300] * (-403.785) (-408.936) [-404.155] (-407.653) -- 0:00:11
812500 -- [-404.182] (-406.114) (-405.080) (-404.224) * (-404.091) (-406.381) [-404.118] (-405.727) -- 0:00:11
813000 -- (-404.894) [-406.732] (-410.448) (-405.774) * (-405.233) (-404.083) [-404.340] (-408.706) -- 0:00:11
813500 -- (-404.996) [-406.521] (-411.091) (-403.923) * (-404.531) [-404.070] (-403.770) (-404.895) -- 0:00:11
814000 -- (-407.443) [-404.291] (-408.590) (-405.518) * (-405.375) [-404.313] (-403.833) (-404.278) -- 0:00:11
814500 -- [-409.362] (-407.238) (-404.249) (-405.380) * [-403.628] (-403.964) (-403.486) (-405.538) -- 0:00:11
815000 -- (-406.899) (-406.982) [-404.241] (-406.225) * [-405.138] (-404.222) (-406.692) (-410.395) -- 0:00:11
Average standard deviation of split frequencies: 0.004730
815500 -- (-406.176) (-408.982) [-403.656] (-404.558) * [-404.014] (-404.713) (-404.648) (-407.224) -- 0:00:11
816000 -- (-410.652) (-405.075) (-406.176) [-404.426] * (-405.115) (-404.087) [-406.317] (-406.584) -- 0:00:11
816500 -- (-409.627) (-405.184) (-404.928) [-404.458] * (-406.384) (-404.223) [-403.459] (-408.549) -- 0:00:11
817000 -- (-404.727) [-403.833] (-403.573) (-404.469) * (-406.844) (-403.631) (-405.434) [-407.274] -- 0:00:11
817500 -- (-404.572) (-405.155) (-404.314) [-406.882] * (-404.320) [-404.635] (-408.961) (-405.680) -- 0:00:11
818000 -- (-406.964) (-408.170) [-404.439] (-405.740) * [-406.325] (-403.204) (-405.219) (-406.216) -- 0:00:11
818500 -- (-408.945) (-406.668) [-403.321] (-411.878) * (-405.001) [-405.556] (-407.075) (-404.961) -- 0:00:11
819000 -- (-404.425) [-406.807] (-405.380) (-406.806) * (-403.464) (-404.981) (-403.672) [-406.912] -- 0:00:11
819500 -- [-406.080] (-405.642) (-404.321) (-405.372) * (-405.467) (-410.740) [-404.519] (-405.619) -- 0:00:11
820000 -- (-405.930) [-408.003] (-404.044) (-405.227) * (-405.836) (-404.415) (-405.415) [-404.982] -- 0:00:10
Average standard deviation of split frequencies: 0.004703
820500 -- (-408.245) (-408.583) (-405.009) [-405.120] * (-404.853) [-403.298] (-406.208) (-404.774) -- 0:00:10
821000 -- (-403.973) [-404.082] (-407.885) (-412.514) * [-405.383] (-405.187) (-406.381) (-404.574) -- 0:00:10
821500 -- (-403.844) (-403.819) [-403.963] (-405.171) * (-404.686) (-404.215) (-404.976) [-404.069] -- 0:00:10
822000 -- (-403.368) (-406.936) (-403.266) [-406.538] * (-404.668) (-405.272) (-408.752) [-404.499] -- 0:00:10
822500 -- (-407.235) [-406.633] (-404.663) (-405.445) * [-403.298] (-403.675) (-406.929) (-403.469) -- 0:00:10
823000 -- (-404.954) (-405.173) (-404.837) [-405.435] * [-404.499] (-403.567) (-407.001) (-406.417) -- 0:00:10
823500 -- (-403.875) (-404.613) (-404.911) [-405.631] * (-406.317) [-405.734] (-407.144) (-406.864) -- 0:00:10
824000 -- [-405.411] (-405.825) (-410.063) (-407.601) * (-404.328) [-408.298] (-405.446) (-409.093) -- 0:00:10
824500 -- (-404.431) [-404.510] (-404.773) (-407.126) * (-403.744) [-407.660] (-406.269) (-403.357) -- 0:00:10
825000 -- (-405.189) (-406.429) [-403.774] (-406.665) * (-404.660) (-408.511) (-405.128) [-404.231] -- 0:00:10
Average standard deviation of split frequencies: 0.004815
825500 -- (-403.253) (-405.965) [-404.089] (-408.600) * (-405.884) [-409.117] (-404.648) (-403.507) -- 0:00:10
826000 -- [-403.253] (-405.061) (-404.829) (-408.393) * (-405.348) [-404.996] (-405.789) (-404.694) -- 0:00:10
826500 -- (-404.636) (-405.262) (-405.175) [-404.778] * (-406.246) (-405.975) (-403.943) [-405.108] -- 0:00:10
827000 -- (-406.349) (-403.825) [-403.896] (-409.659) * [-403.664] (-403.888) (-405.989) (-403.853) -- 0:00:10
827500 -- (-406.734) (-406.624) (-405.036) [-404.536] * (-404.623) (-404.756) [-403.704] (-406.375) -- 0:00:10
828000 -- (-404.641) (-405.456) (-405.039) [-406.283] * (-407.217) (-407.595) (-404.705) [-406.094] -- 0:00:10
828500 -- (-404.512) (-404.254) [-405.027] (-407.334) * (-407.804) (-405.680) [-406.719] (-407.932) -- 0:00:10
829000 -- (-405.667) [-406.969] (-405.754) (-403.489) * [-403.418] (-405.948) (-403.942) (-404.259) -- 0:00:10
829500 -- (-406.930) (-404.620) [-406.409] (-403.957) * (-408.446) (-404.984) (-405.512) [-403.509] -- 0:00:10
830000 -- (-404.863) (-405.752) [-403.070] (-404.133) * [-403.293] (-404.040) (-406.644) (-405.550) -- 0:00:10
Average standard deviation of split frequencies: 0.005214
830500 -- (-405.687) (-416.836) (-405.304) [-404.915] * (-404.794) (-404.175) (-407.934) [-404.982] -- 0:00:10
831000 -- (-405.824) [-406.737] (-407.324) (-404.675) * (-404.115) (-404.518) (-405.384) [-403.377] -- 0:00:10
831500 -- [-406.860] (-406.349) (-408.263) (-411.028) * (-403.577) (-406.977) (-406.302) [-404.858] -- 0:00:10
832000 -- (-404.727) (-407.182) [-403.939] (-406.694) * (-403.527) [-406.372] (-414.606) (-408.331) -- 0:00:10
832500 -- (-409.003) (-409.510) [-405.215] (-406.153) * (-407.303) (-406.912) (-411.183) [-406.521] -- 0:00:10
833000 -- (-406.569) (-404.632) [-406.802] (-409.970) * (-405.193) (-403.640) (-405.070) [-403.852] -- 0:00:10
833500 -- (-406.342) [-405.789] (-404.323) (-410.546) * [-403.431] (-404.365) (-407.148) (-404.915) -- 0:00:10
834000 -- (-406.951) (-404.862) [-404.609] (-404.515) * (-406.338) (-403.162) [-405.416] (-404.382) -- 0:00:10
834500 -- [-405.239] (-410.754) (-403.200) (-407.049) * (-405.176) (-405.629) (-403.753) [-405.260] -- 0:00:10
835000 -- (-404.606) (-405.951) (-405.233) [-408.006] * [-403.123] (-404.973) (-405.401) (-406.895) -- 0:00:10
Average standard deviation of split frequencies: 0.004863
835500 -- (-403.802) [-403.824] (-405.827) (-405.248) * [-404.815] (-406.176) (-407.064) (-404.473) -- 0:00:10
836000 -- (-403.800) [-406.285] (-403.363) (-405.780) * (-405.848) [-409.147] (-403.875) (-405.311) -- 0:00:10
836500 -- [-404.119] (-405.398) (-405.157) (-404.674) * (-405.793) (-406.236) [-404.491] (-404.478) -- 0:00:09
837000 -- [-408.786] (-406.252) (-406.541) (-404.464) * (-403.250) (-405.064) (-404.059) [-404.361] -- 0:00:09
837500 -- (-407.763) (-407.389) (-404.779) [-404.347] * (-406.316) [-407.932] (-405.085) (-404.869) -- 0:00:09
838000 -- (-406.716) [-405.439] (-405.031) (-404.283) * (-403.370) (-405.445) [-407.024] (-408.034) -- 0:00:09
838500 -- [-403.325] (-404.847) (-405.900) (-405.236) * [-404.567] (-411.328) (-405.309) (-405.076) -- 0:00:09
839000 -- (-403.799) (-408.178) (-407.434) [-404.728] * [-403.463] (-405.104) (-404.312) (-405.649) -- 0:00:09
839500 -- [-409.642] (-405.862) (-403.860) (-406.043) * (-403.485) (-404.433) (-404.914) [-405.810] -- 0:00:09
840000 -- (-408.083) (-406.477) (-404.304) [-407.794] * (-406.472) [-403.835] (-407.038) (-406.086) -- 0:00:09
Average standard deviation of split frequencies: 0.004766
840500 -- (-404.376) (-404.782) (-404.475) [-408.433] * (-403.678) [-404.000] (-404.778) (-404.630) -- 0:00:09
841000 -- [-404.682] (-404.937) (-404.976) (-406.930) * [-405.516] (-407.603) (-406.956) (-406.328) -- 0:00:09
841500 -- (-403.872) [-403.530] (-405.983) (-409.550) * (-407.387) (-405.282) [-404.610] (-410.320) -- 0:00:09
842000 -- (-403.782) (-406.163) [-405.551] (-414.110) * [-404.038] (-405.732) (-406.793) (-404.642) -- 0:00:09
842500 -- [-403.745] (-406.192) (-405.559) (-414.441) * (-406.997) [-405.363] (-405.171) (-405.186) -- 0:00:09
843000 -- (-404.280) (-405.830) [-407.558] (-405.691) * [-408.083] (-404.681) (-408.803) (-405.138) -- 0:00:09
843500 -- (-404.744) [-403.746] (-405.541) (-405.710) * [-406.132] (-407.587) (-404.803) (-404.741) -- 0:00:09
844000 -- (-405.516) (-404.112) (-405.506) [-406.814] * (-407.191) (-406.784) (-404.779) [-405.112] -- 0:00:09
844500 -- (-408.500) (-403.417) [-404.526] (-405.265) * [-407.155] (-404.495) (-405.244) (-407.256) -- 0:00:09
845000 -- (-407.461) (-409.154) [-403.886] (-404.133) * (-404.118) (-406.003) [-407.164] (-407.335) -- 0:00:09
Average standard deviation of split frequencies: 0.004876
845500 -- (-406.151) (-404.912) (-410.224) [-406.598] * (-404.203) (-408.551) [-406.186] (-406.175) -- 0:00:09
846000 -- (-405.304) [-404.118] (-405.911) (-405.678) * [-404.684] (-410.619) (-404.162) (-407.288) -- 0:00:09
846500 -- (-407.242) [-405.214] (-406.963) (-407.466) * (-404.646) (-406.821) (-406.339) [-405.113] -- 0:00:09
847000 -- (-406.495) (-406.086) [-406.053] (-409.112) * [-406.027] (-404.803) (-403.437) (-407.485) -- 0:00:09
847500 -- [-404.266] (-406.506) (-406.376) (-406.218) * [-406.527] (-404.450) (-407.518) (-406.979) -- 0:00:09
848000 -- [-404.793] (-406.468) (-404.208) (-408.808) * (-405.587) [-405.164] (-407.003) (-403.969) -- 0:00:09
848500 -- [-404.952] (-404.891) (-404.147) (-410.551) * [-405.489] (-404.768) (-407.416) (-404.588) -- 0:00:09
849000 -- (-404.388) [-404.549] (-404.439) (-405.285) * (-404.655) (-404.708) [-406.200] (-405.857) -- 0:00:09
849500 -- [-404.227] (-407.313) (-406.434) (-406.282) * [-404.959] (-405.026) (-406.306) (-404.320) -- 0:00:09
850000 -- (-407.883) [-403.648] (-407.877) (-406.381) * (-405.758) [-407.558] (-405.346) (-403.922) -- 0:00:09
Average standard deviation of split frequencies: 0.004918
850500 -- (-408.671) [-405.158] (-405.696) (-408.146) * (-404.875) [-406.815] (-403.774) (-404.849) -- 0:00:09
851000 -- (-408.750) (-404.149) (-404.915) [-405.000] * (-412.660) (-407.410) [-404.668] (-405.624) -- 0:00:09
851500 -- [-405.536] (-405.975) (-408.284) (-404.674) * (-419.323) (-406.673) [-405.683] (-404.960) -- 0:00:09
852000 -- (-404.800) (-405.599) (-407.056) [-406.269] * (-423.008) [-404.551] (-404.580) (-404.301) -- 0:00:09
852500 -- [-404.039] (-416.682) (-408.949) (-414.473) * (-407.001) (-404.405) (-407.999) [-404.151] -- 0:00:08
853000 -- [-407.258] (-407.069) (-407.717) (-408.174) * (-403.761) [-405.822] (-404.553) (-407.414) -- 0:00:08
853500 -- [-408.466] (-405.277) (-405.276) (-405.517) * [-406.996] (-404.779) (-404.046) (-405.194) -- 0:00:08
854000 -- (-405.687) (-403.499) (-405.531) [-404.706] * [-406.611] (-406.141) (-410.190) (-404.044) -- 0:00:08
854500 -- [-410.452] (-405.585) (-407.087) (-404.125) * (-404.394) (-411.196) (-406.728) [-404.881] -- 0:00:08
855000 -- (-407.234) (-404.566) (-405.565) [-404.218] * (-404.885) (-411.165) (-403.603) [-408.892] -- 0:00:08
Average standard deviation of split frequencies: 0.004922
855500 -- (-405.311) (-406.365) [-403.993] (-404.779) * (-407.153) (-407.859) [-403.812] (-405.477) -- 0:00:08
856000 -- (-404.938) (-405.734) (-404.265) [-405.032] * (-403.766) (-404.812) (-407.653) [-405.809] -- 0:00:08
856500 -- (-405.032) (-407.876) (-405.852) [-406.905] * (-404.577) (-405.027) [-404.028] (-406.079) -- 0:00:08
857000 -- [-404.464] (-406.378) (-406.662) (-405.822) * (-403.704) [-406.563] (-404.165) (-404.622) -- 0:00:08
857500 -- (-405.921) (-408.553) (-404.356) [-404.665] * (-404.299) (-406.337) [-404.378] (-403.316) -- 0:00:08
858000 -- (-405.667) (-405.914) [-403.405] (-403.955) * (-405.463) (-406.834) [-403.820] (-403.794) -- 0:00:08
858500 -- (-406.051) [-405.963] (-403.572) (-406.158) * (-404.896) (-404.744) [-403.319] (-405.744) -- 0:00:08
859000 -- [-405.814] (-404.054) (-404.039) (-404.294) * (-405.919) (-406.702) (-403.225) [-404.201] -- 0:00:08
859500 -- (-404.436) (-403.506) (-405.024) [-404.739] * [-404.459] (-404.386) (-403.937) (-413.039) -- 0:00:08
860000 -- (-404.824) (-403.933) (-404.021) [-404.111] * [-405.499] (-405.296) (-404.115) (-408.244) -- 0:00:08
Average standard deviation of split frequencies: 0.004827
860500 -- (-404.951) (-404.471) (-405.567) [-404.591] * (-405.252) (-406.038) (-406.161) [-404.967] -- 0:00:08
861000 -- (-407.509) (-405.887) (-408.245) [-405.563] * (-404.742) (-404.919) [-403.366] (-406.386) -- 0:00:08
861500 -- (-409.609) (-408.972) (-410.873) [-405.048] * (-406.145) (-407.604) [-406.879] (-415.497) -- 0:00:08
862000 -- (-406.647) [-403.934] (-404.633) (-404.460) * (-404.439) (-406.853) (-411.230) [-406.555] -- 0:00:08
862500 -- (-406.272) (-404.590) [-404.150] (-406.161) * (-405.132) (-411.385) (-404.269) [-407.609] -- 0:00:08
863000 -- [-404.729] (-408.285) (-403.445) (-408.613) * (-403.525) (-407.992) (-408.665) [-405.127] -- 0:00:08
863500 -- (-409.608) (-412.697) [-404.087] (-405.147) * (-407.394) (-404.984) [-408.398] (-403.947) -- 0:00:08
864000 -- [-404.339] (-406.387) (-406.618) (-404.045) * [-405.210] (-406.038) (-408.227) (-405.977) -- 0:00:08
864500 -- [-404.738] (-405.002) (-404.603) (-407.590) * (-404.553) (-407.170) (-406.314) [-404.533] -- 0:00:08
865000 -- (-405.148) [-404.009] (-403.482) (-407.787) * (-409.624) [-406.595] (-406.585) (-407.816) -- 0:00:08
Average standard deviation of split frequencies: 0.004865
865500 -- (-410.821) (-407.008) [-403.705] (-404.889) * (-406.837) (-404.851) (-406.473) [-404.950] -- 0:00:08
866000 -- (-405.140) (-407.151) (-404.455) [-405.851] * (-407.046) [-404.054] (-405.699) (-407.423) -- 0:00:08
866500 -- (-405.638) [-405.851] (-407.189) (-404.099) * (-411.482) (-404.262) (-408.952) [-404.448] -- 0:00:08
867000 -- [-403.177] (-406.823) (-404.342) (-404.011) * (-403.781) (-403.812) (-409.644) [-405.435] -- 0:00:08
867500 -- (-407.582) (-407.004) [-403.258] (-405.682) * [-403.852] (-404.664) (-408.241) (-408.386) -- 0:00:08
868000 -- (-404.935) (-408.550) [-404.476] (-404.109) * (-403.689) (-404.199) (-406.044) [-403.157] -- 0:00:08
868500 -- [-405.743] (-407.039) (-406.027) (-403.364) * (-404.328) (-405.453) (-405.271) [-406.397] -- 0:00:08
869000 -- (-406.540) (-406.115) [-405.236] (-404.373) * (-408.565) (-406.828) (-403.861) [-406.622] -- 0:00:07
869500 -- [-404.544] (-407.133) (-405.067) (-405.428) * (-409.643) (-406.496) (-405.983) [-404.444] -- 0:00:07
870000 -- (-410.735) (-406.362) [-406.810] (-404.516) * (-404.622) [-406.375] (-406.202) (-405.767) -- 0:00:07
Average standard deviation of split frequencies: 0.004839
870500 -- [-404.062] (-407.370) (-404.584) (-403.636) * [-406.069] (-404.145) (-405.766) (-410.092) -- 0:00:07
871000 -- [-407.538] (-407.600) (-404.210) (-404.018) * [-404.277] (-404.869) (-405.842) (-404.986) -- 0:00:07
871500 -- (-404.902) (-405.099) [-403.366] (-405.359) * (-404.069) (-404.787) (-405.532) [-404.182] -- 0:00:07
872000 -- (-406.345) (-403.725) [-406.995] (-408.805) * (-403.762) [-405.399] (-406.653) (-405.601) -- 0:00:07
872500 -- [-405.592] (-403.794) (-408.693) (-404.098) * (-406.641) (-406.947) (-409.608) [-403.916] -- 0:00:07
873000 -- (-404.183) (-403.830) [-408.212] (-408.403) * (-405.502) (-405.458) [-405.973] (-404.620) -- 0:00:07
873500 -- [-405.479] (-412.206) (-404.963) (-405.394) * (-405.071) [-403.286] (-404.353) (-407.551) -- 0:00:07
874000 -- (-409.537) (-403.990) (-407.212) [-404.170] * (-406.719) [-405.477] (-405.133) (-405.284) -- 0:00:07
874500 -- [-407.438] (-404.260) (-407.054) (-406.671) * (-404.598) (-406.724) (-409.247) [-406.704] -- 0:00:07
875000 -- [-407.100] (-406.011) (-405.596) (-406.966) * (-408.188) [-404.406] (-405.510) (-410.956) -- 0:00:07
Average standard deviation of split frequencies: 0.004574
875500 -- (-404.177) (-408.282) (-406.809) [-403.984] * (-403.805) (-408.763) [-404.398] (-405.502) -- 0:00:07
876000 -- (-404.954) (-407.806) [-405.152] (-403.910) * (-405.851) [-406.045] (-403.580) (-405.782) -- 0:00:07
876500 -- [-406.478] (-409.446) (-405.056) (-405.528) * [-405.882] (-408.983) (-404.244) (-405.324) -- 0:00:07
877000 -- (-405.419) (-406.351) [-405.028] (-405.867) * (-410.370) (-404.885) (-408.468) [-408.063] -- 0:00:07
877500 -- (-405.738) (-403.338) [-404.647] (-405.284) * (-410.853) (-403.389) [-404.680] (-409.286) -- 0:00:07
878000 -- (-405.184) (-406.877) [-404.577] (-406.025) * (-406.526) (-405.853) [-403.749] (-411.203) -- 0:00:07
878500 -- (-405.925) [-407.826] (-403.524) (-404.024) * (-406.206) [-406.035] (-403.979) (-409.144) -- 0:00:07
879000 -- (-406.524) [-403.596] (-406.919) (-405.717) * (-409.092) (-405.628) [-404.169] (-405.319) -- 0:00:07
879500 -- (-407.071) (-405.848) (-404.631) [-405.050] * (-406.347) (-406.169) [-409.671] (-405.869) -- 0:00:07
880000 -- [-404.913] (-404.853) (-405.571) (-408.706) * (-405.805) (-407.603) (-403.592) [-408.619] -- 0:00:07
Average standard deviation of split frequencies: 0.004516
880500 -- (-404.674) [-406.700] (-405.378) (-403.575) * (-404.615) (-405.755) [-403.982] (-404.312) -- 0:00:07
881000 -- (-403.389) (-406.822) [-404.954] (-407.674) * (-408.347) (-406.706) (-404.852) [-403.468] -- 0:00:07
881500 -- (-405.957) (-407.627) [-404.385] (-407.881) * (-405.074) (-403.812) (-405.321) [-404.343] -- 0:00:07
882000 -- (-404.162) (-405.264) [-411.148] (-405.732) * [-404.675] (-404.727) (-406.447) (-404.451) -- 0:00:07
882500 -- [-405.381] (-409.372) (-404.471) (-407.134) * [-404.565] (-404.760) (-406.122) (-403.907) -- 0:00:07
883000 -- (-404.004) (-407.707) [-405.813] (-404.180) * [-404.165] (-403.609) (-404.668) (-405.790) -- 0:00:07
883500 -- (-410.154) (-406.643) [-405.203] (-406.749) * [-405.465] (-404.538) (-406.916) (-405.374) -- 0:00:07
884000 -- (-405.979) (-406.244) [-404.180] (-405.238) * (-405.946) (-410.344) [-406.810] (-404.861) -- 0:00:07
884500 -- (-412.516) (-404.259) (-405.599) [-406.233] * (-406.037) (-408.230) [-404.337] (-404.566) -- 0:00:07
885000 -- (-410.569) (-403.708) [-406.236] (-404.876) * (-405.362) (-406.222) [-403.444] (-404.496) -- 0:00:07
Average standard deviation of split frequencies: 0.004855
885500 -- [-408.199] (-404.084) (-405.063) (-403.323) * [-404.947] (-407.307) (-403.585) (-404.426) -- 0:00:06
886000 -- (-405.276) (-404.315) (-405.149) [-403.320] * [-405.151] (-405.673) (-404.029) (-409.575) -- 0:00:06
886500 -- [-410.702] (-411.190) (-404.699) (-403.413) * (-406.145) (-406.334) [-404.853] (-404.969) -- 0:00:06
887000 -- [-411.717] (-407.330) (-405.115) (-403.593) * (-407.422) [-407.502] (-406.352) (-407.080) -- 0:00:06
887500 -- (-405.064) (-407.685) (-406.442) [-405.309] * (-407.837) [-404.438] (-404.971) (-404.810) -- 0:00:06
888000 -- (-407.273) [-404.524] (-404.099) (-403.987) * (-408.632) [-404.926] (-407.119) (-405.562) -- 0:00:06
888500 -- [-406.221] (-405.778) (-405.663) (-407.684) * (-405.623) [-403.969] (-407.039) (-404.933) -- 0:00:06
889000 -- [-408.169] (-404.898) (-405.967) (-404.733) * (-405.790) (-407.101) (-407.422) [-403.012] -- 0:00:06
889500 -- [-404.556] (-405.062) (-406.414) (-405.193) * (-404.031) (-407.538) (-404.479) [-405.343] -- 0:00:06
890000 -- (-406.243) [-405.218] (-403.639) (-410.162) * (-404.807) (-404.125) [-406.591] (-403.521) -- 0:00:06
Average standard deviation of split frequencies: 0.004598
890500 -- (-403.467) (-404.556) (-404.934) [-403.416] * (-405.017) (-405.325) [-404.383] (-406.635) -- 0:00:06
891000 -- (-406.381) (-405.771) (-405.302) [-404.241] * (-405.934) (-403.438) [-406.343] (-404.755) -- 0:00:06
891500 -- (-406.468) (-406.710) (-410.880) [-405.880] * (-404.553) (-406.905) (-404.213) [-404.917] -- 0:00:06
892000 -- [-403.197] (-404.898) (-409.274) (-407.199) * [-404.194] (-405.813) (-404.777) (-410.247) -- 0:00:06
892500 -- (-411.244) (-405.201) [-408.781] (-405.264) * (-404.509) (-404.872) [-405.074] (-407.518) -- 0:00:06
893000 -- (-414.657) [-406.329] (-403.634) (-407.477) * (-405.887) [-403.792] (-403.772) (-405.798) -- 0:00:06
893500 -- (-404.998) (-404.438) [-408.934] (-404.496) * [-406.054] (-403.893) (-404.123) (-403.960) -- 0:00:06
894000 -- (-405.658) (-405.102) (-404.259) [-403.233] * [-406.014] (-403.822) (-409.816) (-404.502) -- 0:00:06
894500 -- (-404.786) [-403.699] (-407.170) (-406.418) * (-407.740) (-405.150) (-403.766) [-403.177] -- 0:00:06
895000 -- (-404.701) (-405.800) (-405.448) [-405.982] * (-405.760) [-406.961] (-405.374) (-405.491) -- 0:00:06
Average standard deviation of split frequencies: 0.004538
895500 -- (-409.277) [-404.618] (-406.574) (-408.391) * (-406.346) (-404.840) [-405.264] (-404.733) -- 0:00:06
896000 -- [-404.649] (-406.728) (-405.820) (-406.058) * (-406.197) [-405.787] (-403.916) (-407.079) -- 0:00:06
896500 -- (-406.389) (-406.015) [-404.297] (-412.020) * [-409.398] (-405.191) (-403.703) (-405.784) -- 0:00:06
897000 -- (-406.886) (-405.422) [-408.038] (-408.032) * [-405.239] (-404.310) (-405.386) (-406.147) -- 0:00:06
897500 -- (-406.375) (-404.181) (-407.819) [-405.912] * (-405.229) (-406.164) [-404.429] (-407.720) -- 0:00:06
898000 -- (-405.328) [-403.976] (-404.871) (-403.186) * (-405.969) (-406.041) (-406.259) [-404.350] -- 0:00:06
898500 -- (-404.972) (-406.444) [-403.891] (-403.828) * (-403.952) (-406.966) (-405.965) [-405.086] -- 0:00:06
899000 -- (-405.572) [-408.394] (-404.678) (-404.372) * [-404.721] (-409.853) (-406.632) (-407.992) -- 0:00:06
899500 -- [-405.717] (-406.532) (-411.990) (-405.037) * (-407.597) (-406.052) (-409.484) [-404.616] -- 0:00:06
900000 -- (-408.720) (-407.473) (-406.629) [-408.137] * (-405.837) [-406.144] (-406.804) (-405.729) -- 0:00:06
Average standard deviation of split frequencies: 0.004711
900500 -- (-403.998) (-405.817) (-405.963) [-406.645] * (-406.058) (-406.228) [-404.886] (-404.902) -- 0:00:06
901000 -- (-406.330) (-404.735) [-405.742] (-407.103) * (-409.159) (-408.625) [-405.251] (-404.684) -- 0:00:06
901500 -- (-406.397) (-407.820) (-405.575) [-408.578] * (-409.999) (-404.756) [-407.058] (-405.535) -- 0:00:06
902000 -- (-413.002) (-404.485) [-405.621] (-408.676) * (-404.910) (-404.052) [-405.487] (-404.273) -- 0:00:05
902500 -- [-406.778] (-406.133) (-410.426) (-409.022) * [-404.164] (-405.097) (-406.441) (-404.484) -- 0:00:05
903000 -- [-404.926] (-405.878) (-404.674) (-408.638) * (-405.570) (-404.323) [-403.340] (-406.587) -- 0:00:05
903500 -- [-403.976] (-410.972) (-405.334) (-406.435) * (-406.747) [-406.289] (-404.194) (-403.682) -- 0:00:05
904000 -- [-403.400] (-405.341) (-404.924) (-405.467) * (-404.187) [-406.653] (-405.789) (-403.113) -- 0:00:05
904500 -- [-406.049] (-409.615) (-405.557) (-404.450) * (-404.995) [-406.211] (-405.849) (-406.570) -- 0:00:05
905000 -- (-408.248) (-403.811) (-406.792) [-404.615] * (-404.002) (-404.941) [-403.567] (-406.210) -- 0:00:05
Average standard deviation of split frequencies: 0.004228
905500 -- (-405.582) [-404.931] (-403.194) (-405.495) * (-404.658) [-404.886] (-406.161) (-406.241) -- 0:00:05
906000 -- (-404.692) [-408.444] (-405.313) (-405.799) * (-407.567) [-410.136] (-406.441) (-408.332) -- 0:00:05
906500 -- (-405.778) (-404.966) [-411.355] (-409.076) * (-406.491) (-405.100) (-405.641) [-405.802] -- 0:00:05
907000 -- (-406.047) (-405.387) [-404.380] (-410.631) * (-404.562) (-406.993) [-404.692] (-406.447) -- 0:00:05
907500 -- (-404.105) (-410.339) [-405.610] (-407.861) * (-405.573) (-410.823) [-405.986] (-412.094) -- 0:00:05
908000 -- (-406.777) (-404.627) (-407.839) [-407.366] * [-405.338] (-409.598) (-406.832) (-407.740) -- 0:00:05
908500 -- (-406.641) (-405.492) [-407.027] (-407.720) * (-406.311) (-410.655) [-408.451] (-403.565) -- 0:00:05
909000 -- (-409.180) [-403.107] (-404.195) (-409.028) * (-408.220) (-404.605) [-406.407] (-409.265) -- 0:00:05
909500 -- (-404.969) [-406.164] (-404.513) (-405.261) * (-408.325) (-405.313) [-404.595] (-404.994) -- 0:00:05
910000 -- (-405.415) (-403.912) (-405.218) [-403.995] * (-403.754) (-404.833) [-404.708] (-406.757) -- 0:00:05
Average standard deviation of split frequencies: 0.004626
910500 -- [-405.223] (-405.271) (-406.148) (-404.800) * (-404.586) (-404.138) (-404.448) [-404.985] -- 0:00:05
911000 -- [-406.663] (-405.299) (-409.094) (-409.089) * (-406.651) [-404.973] (-405.568) (-406.569) -- 0:00:05
911500 -- [-406.402] (-405.879) (-405.176) (-406.838) * [-404.039] (-405.400) (-410.569) (-403.348) -- 0:00:05
912000 -- (-404.731) (-405.765) (-408.753) [-405.013] * (-403.978) (-405.603) (-406.672) [-404.545] -- 0:00:05
912500 -- (-403.707) (-405.439) [-406.146] (-406.640) * (-404.342) (-406.771) (-407.049) [-406.735] -- 0:00:05
913000 -- (-407.237) (-404.733) [-406.832] (-407.470) * [-403.774] (-404.909) (-405.871) (-404.754) -- 0:00:05
913500 -- [-407.329] (-403.738) (-403.848) (-405.452) * (-403.880) [-403.951] (-405.124) (-406.422) -- 0:00:05
914000 -- (-411.172) (-403.805) [-405.194] (-404.898) * [-403.423] (-404.493) (-405.794) (-406.479) -- 0:00:05
914500 -- (-406.554) [-404.580] (-405.427) (-404.113) * (-403.898) (-407.032) (-410.158) [-406.461] -- 0:00:05
915000 -- (-406.727) [-404.845] (-404.572) (-407.629) * (-404.916) [-406.340] (-406.251) (-407.737) -- 0:00:05
Average standard deviation of split frequencies: 0.004503
915500 -- [-406.100] (-405.722) (-404.570) (-404.887) * (-408.583) [-404.956] (-405.475) (-406.949) -- 0:00:05
916000 -- (-403.966) (-405.827) [-410.590] (-411.672) * [-407.821] (-410.929) (-408.503) (-404.234) -- 0:00:05
916500 -- (-408.926) (-408.816) (-409.951) [-403.486] * [-406.322] (-404.200) (-406.608) (-404.262) -- 0:00:05
917000 -- (-405.087) (-407.343) (-407.817) [-404.434] * (-405.207) (-403.606) [-405.858] (-404.234) -- 0:00:05
917500 -- (-406.383) [-407.363] (-409.557) (-407.524) * (-405.511) [-406.249] (-406.453) (-404.056) -- 0:00:05
918000 -- (-412.350) [-408.286] (-405.317) (-408.256) * (-407.896) [-403.793] (-405.626) (-406.350) -- 0:00:05
918500 -- (-404.865) (-405.093) (-405.942) [-407.012] * (-406.749) [-404.557] (-403.405) (-408.103) -- 0:00:04
919000 -- (-408.810) (-406.813) (-406.282) [-404.723] * (-403.901) [-405.824] (-403.376) (-405.190) -- 0:00:04
919500 -- (-404.052) (-408.011) [-405.832] (-407.296) * (-404.266) [-410.098] (-403.184) (-403.437) -- 0:00:04
920000 -- [-404.614] (-404.728) (-406.686) (-404.949) * (-406.806) [-409.311] (-407.212) (-403.669) -- 0:00:04
Average standard deviation of split frequencies: 0.004672
920500 -- (-407.522) [-406.802] (-406.317) (-406.070) * (-406.650) (-407.307) (-404.056) [-404.606] -- 0:00:04
921000 -- (-407.219) (-405.808) [-407.323] (-408.920) * (-403.307) (-405.345) (-404.245) [-406.027] -- 0:00:04
921500 -- (-406.344) [-408.303] (-408.014) (-404.708) * (-407.098) [-405.485] (-404.901) (-405.042) -- 0:00:04
922000 -- (-407.940) [-404.498] (-405.022) (-404.191) * (-405.017) [-406.852] (-406.638) (-406.709) -- 0:00:04
922500 -- [-405.336] (-406.385) (-405.334) (-403.359) * (-404.870) [-405.232] (-405.099) (-407.064) -- 0:00:04
923000 -- (-406.619) (-406.322) (-403.618) [-403.226] * (-409.360) [-403.134] (-407.671) (-407.319) -- 0:00:04
923500 -- (-405.412) (-410.080) [-406.182] (-404.446) * [-404.640] (-404.559) (-408.449) (-404.879) -- 0:00:04
924000 -- [-405.808] (-406.189) (-408.508) (-403.720) * (-403.525) (-406.638) [-407.908] (-405.027) -- 0:00:04
924500 -- (-410.386) (-403.778) [-404.965] (-407.179) * (-407.377) [-404.562] (-407.701) (-406.307) -- 0:00:04
925000 -- (-404.169) [-403.877] (-403.910) (-408.015) * (-410.001) (-404.938) [-407.207] (-410.497) -- 0:00:04
Average standard deviation of split frequencies: 0.004709
925500 -- [-404.018] (-403.697) (-407.465) (-403.983) * (-405.631) [-406.618] (-404.908) (-404.580) -- 0:00:04
926000 -- [-404.568] (-404.701) (-403.926) (-406.827) * [-404.056] (-404.071) (-403.536) (-407.148) -- 0:00:04
926500 -- (-403.626) (-408.268) (-407.495) [-407.999] * (-403.353) [-404.259] (-404.054) (-408.959) -- 0:00:04
927000 -- (-403.797) [-408.174] (-410.148) (-403.922) * [-404.016] (-407.719) (-404.480) (-407.424) -- 0:00:04
927500 -- [-404.148] (-404.559) (-410.121) (-408.554) * (-406.580) (-406.999) [-406.611] (-406.113) -- 0:00:04
928000 -- (-405.515) (-405.131) (-406.666) [-404.825] * (-406.445) [-403.555] (-403.098) (-407.024) -- 0:00:04
928500 -- (-404.824) (-406.539) (-405.474) [-410.120] * (-408.818) (-404.749) [-406.511] (-403.751) -- 0:00:04
929000 -- (-405.425) [-404.878] (-407.070) (-407.260) * (-407.311) [-404.096] (-403.530) (-406.127) -- 0:00:04
929500 -- (-404.458) [-406.304] (-406.191) (-409.003) * [-407.333] (-407.012) (-406.237) (-405.205) -- 0:00:04
930000 -- (-408.641) [-408.934] (-407.507) (-405.249) * (-406.699) (-404.894) [-408.482] (-405.510) -- 0:00:04
Average standard deviation of split frequencies: 0.004495
930500 -- (-409.311) [-404.575] (-404.147) (-406.098) * (-406.662) (-404.475) (-409.184) [-403.304] -- 0:00:04
931000 -- (-408.477) (-405.120) [-403.579] (-405.035) * (-403.739) [-406.999] (-406.920) (-408.981) -- 0:00:04
931500 -- [-406.925] (-403.966) (-404.583) (-404.063) * (-404.885) [-404.306] (-413.532) (-404.357) -- 0:00:04
932000 -- (-406.234) (-406.126) [-408.037] (-406.715) * (-406.142) (-405.834) [-405.744] (-403.581) -- 0:00:04
932500 -- [-406.886] (-408.229) (-411.872) (-406.951) * (-404.677) [-406.783] (-406.123) (-403.631) -- 0:00:04
933000 -- [-403.943] (-407.364) (-405.759) (-406.320) * [-404.928] (-404.919) (-403.495) (-409.351) -- 0:00:04
933500 -- (-404.482) [-406.593] (-404.403) (-405.795) * (-403.568) (-403.506) [-403.985] (-412.380) -- 0:00:04
934000 -- [-406.859] (-405.247) (-406.945) (-407.087) * (-406.225) [-404.645] (-409.859) (-405.013) -- 0:00:04
934500 -- (-406.169) (-404.600) (-406.114) [-406.326] * [-408.022] (-404.568) (-405.186) (-405.112) -- 0:00:03
935000 -- [-404.427] (-405.040) (-404.490) (-407.270) * (-406.262) (-407.636) [-406.326] (-404.781) -- 0:00:03
Average standard deviation of split frequencies: 0.004312
935500 -- (-410.219) (-405.715) [-403.324] (-404.818) * [-405.727] (-407.532) (-411.234) (-405.675) -- 0:00:03
936000 -- (-405.163) [-405.533] (-405.246) (-403.886) * (-406.218) (-406.219) [-403.672] (-403.453) -- 0:00:03
936500 -- [-405.835] (-406.077) (-411.250) (-405.246) * (-405.606) [-404.619] (-404.176) (-407.500) -- 0:00:03
937000 -- [-405.895] (-406.425) (-406.437) (-404.564) * (-405.150) (-405.495) [-407.754] (-403.220) -- 0:00:03
937500 -- (-405.203) [-406.182] (-404.333) (-407.565) * (-404.943) (-404.812) (-405.732) [-406.574] -- 0:00:03
938000 -- (-410.256) [-406.487] (-407.099) (-406.012) * (-406.991) (-405.397) [-406.651] (-403.605) -- 0:00:03
938500 -- (-403.817) [-404.978] (-406.424) (-406.196) * (-406.229) (-406.768) [-406.507] (-404.583) -- 0:00:03
939000 -- (-406.315) (-405.123) [-410.378] (-405.362) * [-404.174] (-404.198) (-403.797) (-407.735) -- 0:00:03
939500 -- (-404.470) [-404.736] (-406.119) (-405.477) * (-405.944) [-404.307] (-405.446) (-403.636) -- 0:00:03
940000 -- (-405.047) (-408.123) [-404.305] (-411.299) * (-404.863) (-406.475) [-413.216] (-403.791) -- 0:00:03
Average standard deviation of split frequencies: 0.004385
940500 -- (-406.025) (-406.315) (-405.467) [-407.241] * (-407.905) (-404.885) (-407.926) [-405.329] -- 0:00:03
941000 -- [-404.435] (-407.450) (-403.386) (-405.823) * (-405.848) [-405.054] (-408.380) (-408.444) -- 0:00:03
941500 -- (-406.914) (-408.703) [-404.512] (-404.429) * (-404.253) (-404.960) (-406.647) [-407.593] -- 0:00:03
942000 -- [-407.091] (-405.457) (-406.771) (-406.308) * (-404.760) (-403.643) [-407.785] (-404.254) -- 0:00:03
942500 -- [-409.198] (-406.244) (-407.013) (-403.924) * [-405.836] (-403.913) (-408.023) (-406.631) -- 0:00:03
943000 -- (-407.085) (-404.515) [-408.352] (-411.110) * [-407.500] (-406.448) (-404.664) (-405.983) -- 0:00:03
943500 -- (-407.509) [-404.720] (-408.358) (-406.717) * [-404.455] (-406.152) (-406.061) (-405.269) -- 0:00:03
944000 -- [-405.779] (-406.341) (-405.649) (-409.989) * (-403.957) (-409.501) [-403.615] (-403.876) -- 0:00:03
944500 -- (-405.686) (-405.740) (-405.049) [-407.368] * (-405.278) (-410.407) [-404.664] (-406.080) -- 0:00:03
945000 -- (-405.945) (-406.339) (-404.897) [-404.471] * [-405.506] (-405.269) (-407.195) (-404.632) -- 0:00:03
Average standard deviation of split frequencies: 0.004205
945500 -- (-410.413) (-404.246) [-406.401] (-406.863) * (-408.427) (-407.343) [-404.800] (-406.111) -- 0:00:03
946000 -- (-406.804) (-403.217) [-404.589] (-408.606) * (-405.132) [-405.866] (-406.271) (-405.333) -- 0:00:03
946500 -- (-404.376) [-405.383] (-404.290) (-404.823) * (-409.295) (-405.520) [-404.147] (-405.138) -- 0:00:03
947000 -- (-404.431) (-404.668) [-404.197] (-405.291) * (-406.957) [-404.388] (-405.526) (-407.497) -- 0:00:03
947500 -- [-406.170] (-406.761) (-403.934) (-405.595) * (-404.361) (-407.366) [-403.875] (-404.433) -- 0:00:03
948000 -- (-409.056) (-405.831) [-405.028] (-406.887) * (-403.537) (-405.429) [-404.837] (-406.562) -- 0:00:03
948500 -- (-405.893) (-405.806) [-404.273] (-410.958) * (-403.198) [-409.828] (-406.397) (-408.889) -- 0:00:03
949000 -- (-404.617) (-405.149) (-408.466) [-404.280] * (-404.239) (-405.968) (-406.525) [-405.489] -- 0:00:03
949500 -- (-405.418) (-405.727) (-404.274) [-410.891] * (-404.286) [-405.670] (-404.093) (-409.198) -- 0:00:03
950000 -- (-405.051) (-404.839) [-403.552] (-410.371) * [-404.985] (-406.849) (-404.314) (-404.792) -- 0:00:03
Average standard deviation of split frequencies: 0.004091
950500 -- (-405.942) (-406.434) [-403.439] (-409.504) * [-404.818] (-408.738) (-405.630) (-404.115) -- 0:00:03
951000 -- [-405.334] (-404.761) (-403.320) (-411.517) * [-405.761] (-404.205) (-403.525) (-411.042) -- 0:00:02
951500 -- (-405.563) (-405.376) (-404.281) [-405.435] * [-403.200] (-405.708) (-406.046) (-405.081) -- 0:00:02
952000 -- (-404.503) (-410.209) [-405.136] (-407.843) * [-403.157] (-405.608) (-407.192) (-405.512) -- 0:00:02
952500 -- (-407.233) (-404.941) (-406.028) [-403.349] * [-405.097] (-407.158) (-408.398) (-406.344) -- 0:00:02
953000 -- (-403.851) (-405.465) (-405.435) [-403.793] * (-405.375) (-403.774) [-403.775] (-408.749) -- 0:00:02
953500 -- (-405.314) (-404.390) [-404.296] (-406.852) * [-405.812] (-409.044) (-404.287) (-405.111) -- 0:00:02
954000 -- [-405.519] (-404.762) (-405.542) (-406.048) * [-404.449] (-407.983) (-407.290) (-405.917) -- 0:00:02
954500 -- (-405.149) [-404.931] (-404.486) (-406.644) * (-405.017) (-406.919) [-405.065] (-405.952) -- 0:00:02
955000 -- [-404.944] (-405.322) (-406.305) (-407.438) * [-404.596] (-407.479) (-405.730) (-404.350) -- 0:00:02
Average standard deviation of split frequencies: 0.004161
955500 -- (-405.725) (-404.809) (-405.902) [-405.464] * [-406.535] (-408.132) (-405.966) (-405.626) -- 0:00:02
956000 -- (-404.751) (-405.674) (-404.936) [-404.748] * [-405.883] (-404.540) (-403.778) (-405.107) -- 0:00:02
956500 -- (-407.134) (-408.730) [-405.820] (-407.578) * (-411.201) [-404.466] (-404.651) (-406.829) -- 0:00:02
957000 -- (-406.313) (-407.119) [-406.189] (-410.978) * (-408.648) [-403.290] (-406.653) (-404.850) -- 0:00:02
957500 -- [-405.468] (-408.256) (-405.679) (-409.774) * (-404.677) [-408.014] (-404.463) (-406.923) -- 0:00:02
958000 -- (-405.427) (-404.058) [-404.486] (-405.087) * (-403.850) (-405.883) (-407.050) [-404.437] -- 0:00:02
958500 -- [-406.538] (-404.026) (-404.775) (-404.190) * (-404.385) (-405.214) [-403.968] (-406.041) -- 0:00:02
959000 -- (-407.860) [-404.545] (-403.932) (-404.905) * (-407.092) [-405.429] (-409.313) (-408.953) -- 0:00:02
959500 -- (-405.069) (-408.254) (-404.166) [-404.057] * (-405.171) (-406.022) (-406.067) [-405.594] -- 0:00:02
960000 -- (-404.694) (-405.594) [-404.360] (-404.253) * (-407.709) (-408.309) (-403.944) [-404.861] -- 0:00:02
Average standard deviation of split frequencies: 0.004478
960500 -- [-404.027] (-404.585) (-409.330) (-404.416) * [-405.361] (-406.064) (-404.430) (-405.697) -- 0:00:02
961000 -- (-404.362) (-404.897) [-406.004] (-409.406) * [-405.663] (-404.221) (-405.426) (-406.126) -- 0:00:02
961500 -- (-404.106) (-404.540) (-405.373) [-408.465] * [-409.218] (-404.721) (-407.110) (-403.848) -- 0:00:02
962000 -- [-405.290] (-403.801) (-404.801) (-407.022) * (-407.260) [-406.981] (-405.053) (-405.697) -- 0:00:02
962500 -- (-404.918) [-404.792] (-403.749) (-409.818) * (-405.308) [-407.624] (-404.160) (-404.298) -- 0:00:02
963000 -- (-403.421) (-405.362) (-403.918) [-404.272] * (-405.624) (-405.972) (-404.522) [-404.533] -- 0:00:02
963500 -- [-406.456] (-404.157) (-404.672) (-404.105) * [-405.576] (-405.609) (-403.939) (-405.410) -- 0:00:02
964000 -- (-405.027) (-403.996) (-404.945) [-406.044] * (-405.714) (-404.137) [-406.177] (-403.860) -- 0:00:02
964500 -- (-404.916) (-407.789) [-408.871] (-408.962) * [-404.410] (-403.634) (-405.815) (-404.217) -- 0:00:02
965000 -- (-408.077) (-408.119) [-404.174] (-404.634) * (-404.984) [-405.295] (-410.675) (-405.753) -- 0:00:02
Average standard deviation of split frequencies: 0.004971
965500 -- (-405.158) (-406.619) [-403.233] (-405.179) * [-403.881] (-404.239) (-407.492) (-404.306) -- 0:00:02
966000 -- (-405.084) (-404.965) [-404.122] (-403.567) * (-405.461) (-406.141) [-404.824] (-405.383) -- 0:00:02
966500 -- (-405.251) (-405.006) [-408.559] (-404.579) * (-404.169) [-405.876] (-403.674) (-404.757) -- 0:00:02
967000 -- (-408.641) [-404.771] (-405.091) (-407.017) * (-409.722) (-403.478) [-405.424] (-403.746) -- 0:00:02
967500 -- [-405.665] (-403.241) (-405.535) (-404.949) * (-410.419) [-405.938] (-404.538) (-406.377) -- 0:00:01
968000 -- (-405.065) (-404.291) [-403.809] (-403.286) * (-404.240) (-406.439) (-409.333) [-407.036] -- 0:00:01
968500 -- [-403.477] (-404.719) (-406.341) (-407.847) * [-404.797] (-404.489) (-404.849) (-406.412) -- 0:00:01
969000 -- [-403.168] (-405.302) (-409.502) (-404.746) * (-405.339) [-405.978] (-408.069) (-407.894) -- 0:00:01
969500 -- [-405.529] (-404.291) (-404.047) (-404.020) * (-404.511) (-406.378) (-405.926) [-406.598] -- 0:00:01
970000 -- (-408.332) (-405.125) [-409.502] (-403.994) * (-407.233) (-406.277) [-403.916] (-404.108) -- 0:00:01
Average standard deviation of split frequencies: 0.004705
970500 -- (-409.530) (-408.167) (-407.188) [-403.772] * (-411.048) (-403.883) [-408.893] (-403.375) -- 0:00:01
971000 -- (-404.971) (-404.827) (-405.642) [-404.560] * (-409.566) [-404.737] (-409.479) (-405.494) -- 0:00:01
971500 -- (-407.727) (-404.867) (-405.019) [-403.565] * (-410.235) [-403.848] (-410.450) (-407.124) -- 0:00:01
972000 -- (-403.549) (-407.249) (-405.159) [-405.235] * (-405.854) [-405.071] (-408.119) (-405.927) -- 0:00:01
972500 -- (-406.069) (-405.145) (-408.922) [-404.202] * (-406.789) [-407.013] (-406.242) (-405.772) -- 0:00:01
973000 -- (-405.554) (-403.818) (-408.128) [-404.939] * (-405.566) (-407.971) (-408.668) [-405.973] -- 0:00:01
973500 -- (-404.137) (-405.455) (-410.251) [-405.892] * (-413.511) (-405.619) (-409.016) [-407.937] -- 0:00:01
974000 -- (-404.589) (-405.644) [-404.045] (-404.038) * (-411.642) (-405.359) (-408.670) [-405.099] -- 0:00:01
974500 -- (-404.539) (-405.791) (-405.301) [-404.186] * (-405.544) [-405.464] (-406.168) (-407.982) -- 0:00:01
975000 -- (-405.162) [-403.816] (-404.418) (-407.797) * [-405.871] (-404.179) (-404.284) (-404.921) -- 0:00:01
Average standard deviation of split frequencies: 0.004860
975500 -- (-407.422) (-407.295) (-408.508) [-404.996] * (-407.149) [-404.741] (-403.241) (-404.025) -- 0:00:01
976000 -- (-406.852) (-408.325) [-405.539] (-404.746) * [-405.785] (-410.940) (-404.432) (-406.040) -- 0:00:01
976500 -- [-411.110] (-405.511) (-404.428) (-405.847) * (-406.951) (-404.530) [-403.710] (-406.274) -- 0:00:01
977000 -- (-406.787) (-404.203) [-406.774] (-403.801) * (-404.963) (-405.446) (-404.044) [-404.892] -- 0:00:01
977500 -- (-406.883) (-405.138) [-405.410] (-404.055) * (-405.749) (-408.160) [-403.517] (-405.237) -- 0:00:01
978000 -- (-405.358) (-404.267) [-406.356] (-405.999) * (-404.342) [-404.836] (-403.300) (-405.654) -- 0:00:01
978500 -- [-404.993] (-408.057) (-407.270) (-408.234) * (-403.769) (-407.114) (-404.089) [-403.535] -- 0:00:01
979000 -- (-404.813) (-406.402) [-406.341] (-406.531) * (-407.840) [-404.422] (-404.853) (-406.057) -- 0:00:01
979500 -- (-405.884) [-403.907] (-405.449) (-406.897) * (-404.031) [-405.585] (-404.481) (-407.347) -- 0:00:01
980000 -- (-410.886) [-407.531] (-410.739) (-407.843) * (-403.869) (-406.712) (-403.960) [-404.403] -- 0:00:01
Average standard deviation of split frequencies: 0.004897
980500 -- (-405.722) (-407.009) (-410.990) [-409.251] * [-404.798] (-409.820) (-403.642) (-404.823) -- 0:00:01
981000 -- (-404.349) (-404.142) [-405.356] (-404.669) * (-404.749) [-408.682] (-404.276) (-405.700) -- 0:00:01
981500 -- [-403.972] (-405.519) (-405.684) (-411.724) * (-405.230) (-409.408) [-404.457] (-408.229) -- 0:00:01
982000 -- (-406.631) (-406.068) [-406.674] (-404.196) * (-404.977) (-406.479) [-404.179] (-408.821) -- 0:00:01
982500 -- [-404.330] (-410.085) (-405.124) (-406.993) * (-404.859) (-404.197) (-403.861) [-405.269] -- 0:00:01
983000 -- [-404.499] (-408.313) (-404.611) (-404.965) * (-407.253) (-404.455) [-407.418] (-403.993) -- 0:00:01
983500 -- (-404.870) [-405.242] (-403.963) (-404.700) * [-403.501] (-406.029) (-405.429) (-403.551) -- 0:00:01
984000 -- [-404.522] (-405.757) (-405.766) (-404.591) * [-406.695] (-409.123) (-405.030) (-406.152) -- 0:00:00
984500 -- (-404.189) [-405.318] (-407.044) (-406.077) * [-406.857] (-404.877) (-408.850) (-407.798) -- 0:00:00
985000 -- (-405.420) (-403.924) (-407.125) [-405.204] * [-403.784] (-406.113) (-407.028) (-404.315) -- 0:00:00
Average standard deviation of split frequencies: 0.004811
985500 -- (-406.604) [-406.152] (-403.831) (-405.020) * (-406.724) (-406.175) (-404.880) [-406.258] -- 0:00:00
986000 -- [-404.158] (-404.477) (-405.335) (-407.503) * [-405.987] (-405.380) (-405.133) (-408.199) -- 0:00:00
986500 -- (-407.643) (-406.591) (-404.127) [-403.778] * (-403.986) (-405.054) [-403.744] (-403.973) -- 0:00:00
987000 -- [-408.153] (-405.256) (-404.522) (-403.759) * (-404.207) [-405.999] (-406.215) (-406.329) -- 0:00:00
987500 -- (-406.321) (-404.666) (-405.460) [-404.762] * (-410.400) (-404.047) [-407.748] (-408.899) -- 0:00:00
988000 -- (-405.770) (-406.161) [-405.301] (-404.858) * (-405.859) (-406.016) [-403.859] (-405.459) -- 0:00:00
988500 -- (-407.295) [-407.522] (-407.134) (-404.340) * [-403.366] (-404.773) (-404.971) (-412.462) -- 0:00:00
989000 -- (-406.329) (-403.449) (-405.593) [-404.461] * [-403.772] (-403.789) (-405.911) (-407.000) -- 0:00:00
989500 -- (-404.172) (-405.367) [-404.345] (-405.898) * (-408.511) (-403.937) (-405.350) [-404.068] -- 0:00:00
990000 -- [-403.424] (-408.177) (-404.801) (-403.985) * [-404.452] (-405.499) (-405.398) (-406.235) -- 0:00:00
Average standard deviation of split frequencies: 0.004699
990500 -- [-405.341] (-406.745) (-404.361) (-405.178) * (-404.586) (-406.852) (-406.207) [-404.598] -- 0:00:00
991000 -- (-403.207) (-403.441) [-403.844] (-403.554) * (-406.308) (-409.658) (-404.431) [-405.470] -- 0:00:00
991500 -- (-404.479) (-403.617) (-404.709) [-406.535] * (-407.238) (-404.335) [-405.461] (-405.973) -- 0:00:00
992000 -- (-406.865) [-405.298] (-407.402) (-405.794) * [-405.737] (-404.549) (-406.327) (-405.582) -- 0:00:00
992500 -- (-407.308) [-405.294] (-404.456) (-405.362) * (-404.649) [-405.094] (-406.496) (-404.906) -- 0:00:00
993000 -- (-404.503) [-404.728] (-404.032) (-404.586) * (-404.987) [-404.462] (-405.830) (-405.549) -- 0:00:00
993500 -- (-404.864) (-405.153) [-403.648] (-408.181) * (-403.597) [-407.721] (-404.274) (-407.350) -- 0:00:00
994000 -- (-407.825) (-408.727) [-407.554] (-404.323) * (-405.413) (-408.170) [-403.891] (-404.694) -- 0:00:00
994500 -- [-405.240] (-407.682) (-407.488) (-403.530) * (-405.523) [-405.132] (-404.298) (-405.239) -- 0:00:00
995000 -- (-406.942) (-405.685) (-410.096) [-404.003] * (-406.426) (-407.944) [-403.876] (-405.962) -- 0:00:00
Average standard deviation of split frequencies: 0.004615
995500 -- (-403.086) (-404.682) (-407.708) [-403.639] * (-406.784) [-405.944] (-409.242) (-404.014) -- 0:00:00
996000 -- (-406.561) (-404.761) (-406.667) [-403.327] * (-406.289) (-408.137) [-403.806] (-406.870) -- 0:00:00
996500 -- [-404.693] (-408.155) (-406.924) (-404.139) * [-404.024] (-405.821) (-403.447) (-404.831) -- 0:00:00
997000 -- (-405.365) (-406.009) (-406.159) [-404.873] * (-404.561) (-405.712) (-403.909) [-405.505] -- 0:00:00
997500 -- (-406.353) (-405.078) (-406.753) [-403.959] * (-404.130) (-405.374) [-409.476] (-405.638) -- 0:00:00
998000 -- (-405.486) (-407.177) (-405.314) [-403.244] * (-404.296) [-407.784] (-411.677) (-405.359) -- 0:00:00
998500 -- (-405.256) (-405.159) (-405.110) [-404.915] * (-406.600) (-408.262) [-407.014] (-404.619) -- 0:00:00
999000 -- (-405.117) (-405.149) (-404.413) [-403.835] * (-405.859) (-406.115) [-403.648] (-404.311) -- 0:00:00
999500 -- (-406.977) (-404.752) (-404.284) [-404.165] * [-404.167] (-408.422) (-404.058) (-403.343) -- 0:00:00
1000000 -- [-406.239] (-404.960) (-405.657) (-408.158) * (-404.955) (-405.332) [-405.247] (-403.778) -- 0:00:00
Average standard deviation of split frequencies: 0.004888
Analysis completed in 1 mins 1 seconds
Analysis used 59.78 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -402.97
Likelihood of best state for "cold" chain of run 2 was -402.97
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.8 % ( 62 %) Dirichlet(Revmat{all})
100.0 % ( 99 %) Slider(Revmat{all})
39.7 % ( 36 %) Dirichlet(Pi{all})
38.3 % ( 34 %) Slider(Pi{all})
79.4 % ( 62 %) Multiplier(Alpha{1,2})
77.5 % ( 42 %) Multiplier(Alpha{3})
25.5 % ( 28 %) Slider(Pinvar{all})
98.7 % (100 %) ExtSPR(Tau{all},V{all})
70.2 % ( 61 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 30 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.2 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.7 % ( 64 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
39.8 % ( 23 %) Dirichlet(Pi{all})
39.6 % ( 30 %) Slider(Pi{all})
78.8 % ( 55 %) Multiplier(Alpha{1,2})
77.1 % ( 53 %) Multiplier(Alpha{3})
25.6 % ( 30 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.0 % ( 73 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 88 %) ParsSPR(Tau{all},V{all})
28.2 % ( 29 %) Multiplier(V{all})
97.5 % ( 98 %) Nodeslider(V{all})
30.3 % ( 33 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166568 0.83 0.67
3 | 166366 166602 0.84
4 | 166724 166999 166741
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166403 0.82 0.67
3 | 167003 166317 0.84
4 | 166817 166546 166914
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -404.65
| 1 |
| 1 1|
| |
| 1 2 2 1 |
| 2 1 2 1 2 1 |
| 2 *1 22 1 1 2 2 2 22|
| 1 2 1 2 1 112 |
| * 1 1 2 1 1 1 1 111 2 2 |
|1 21 2 2 21 1 21 * 1 2 1 |
| 1 2 1 21 2 211 2 21 11 2 2 2 |
|2 1 2 1 211 2 22 22 2 2 |
| 2 1 2 122 2 1 2 2 2 1 |
| 1 12 1 2 12 |
| 2 1 2 1 |
| 1 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -406.10
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -404.69 -408.39
2 -404.73 -407.70
--------------------------------------
TOTAL -404.71 -408.10
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897493 0.086567 0.379119 1.483864 0.875017 1501.00 1501.00 1.001
r(A<->C){all} 0.155185 0.018628 0.000107 0.441153 0.118870 105.13 195.16 1.000
r(A<->G){all} 0.154076 0.017788 0.000028 0.422187 0.119865 306.01 319.93 1.008
r(A<->T){all} 0.178374 0.021757 0.000127 0.468992 0.141893 207.03 245.14 1.005
r(C<->G){all} 0.160619 0.017722 0.000022 0.424132 0.129587 149.01 204.64 1.000
r(C<->T){all} 0.178724 0.022177 0.000149 0.485512 0.140349 247.84 270.82 1.011
r(G<->T){all} 0.173021 0.021971 0.000110 0.473227 0.133214 180.29 196.82 1.002
pi(A){all} 0.194281 0.000532 0.145992 0.234832 0.193589 1242.35 1371.67 1.000
pi(C){all} 0.271482 0.000639 0.218495 0.319639 0.270461 1315.84 1329.91 1.000
pi(G){all} 0.309079 0.000731 0.254783 0.357894 0.308441 1259.51 1287.48 1.000
pi(T){all} 0.225159 0.000581 0.180114 0.273871 0.223979 1062.96 1196.19 1.000
alpha{1,2} 0.418977 0.238859 0.000103 1.390746 0.252686 1102.44 1256.52 1.000
alpha{3} 0.441686 0.219337 0.000123 1.365005 0.280295 1313.54 1407.27 1.000
pinvar{all} 0.994494 0.000043 0.982160 0.999992 0.996684 1174.35 1256.24 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.*..
8 -- .*.***
9 -- .*..*.
10 -- ...*.*
11 -- ...**.
12 -- .****.
13 -- .***.*
14 -- ..*.*.
15 -- .**...
16 -- ..*..*
17 -- ....**
18 -- ..**..
19 -- .*...*
20 -- .**.**
21 -- ..****
22 -- .*.**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 486 0.161892 0.012248 0.153231 0.170553 2
8 482 0.160560 0.000942 0.159893 0.161226 2
9 446 0.148568 0.004711 0.145237 0.151899 2
10 445 0.148235 0.002355 0.146569 0.149900 2
11 443 0.147568 0.009893 0.140573 0.154564 2
12 426 0.141905 0.006595 0.137242 0.146569 2
13 421 0.140240 0.001413 0.139241 0.141239 2
14 420 0.139907 0.001884 0.138574 0.141239 2
15 418 0.139241 0.009422 0.132578 0.145903 2
16 415 0.138241 0.005182 0.134577 0.141905 2
17 415 0.138241 0.004240 0.135243 0.141239 2
18 411 0.136909 0.002355 0.135243 0.138574 2
19 408 0.135909 0.004711 0.132578 0.139241 2
20 395 0.131579 0.003298 0.129247 0.133911 2
21 385 0.128248 0.008009 0.122585 0.133911 2
22 304 0.101266 0.000942 0.100600 0.101932 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098711 0.009970 0.000031 0.295871 0.067486 1.000 2
length{all}[2] 0.099251 0.009683 0.000013 0.291523 0.070376 1.000 2
length{all}[3] 0.101395 0.010200 0.000003 0.302707 0.070807 1.000 2
length{all}[4] 0.101236 0.010135 0.000070 0.297950 0.070468 1.000 2
length{all}[5] 0.098507 0.010279 0.000012 0.301772 0.065861 1.000 2
length{all}[6] 0.099845 0.009573 0.000038 0.302871 0.068928 1.002 2
length{all}[7] 0.098831 0.009532 0.000506 0.291426 0.067528 1.001 2
length{all}[8] 0.097099 0.009768 0.000018 0.321999 0.064689 0.998 2
length{all}[9] 0.098735 0.008762 0.000145 0.274004 0.071890 0.999 2
length{all}[10] 0.103973 0.011651 0.000211 0.308033 0.067185 1.000 2
length{all}[11] 0.097737 0.008460 0.000341 0.256555 0.069488 0.998 2
length{all}[12] 0.099212 0.009112 0.000015 0.305307 0.072851 0.999 2
length{all}[13] 0.096098 0.009873 0.000252 0.298739 0.065947 1.006 2
length{all}[14] 0.100512 0.010432 0.000121 0.308074 0.073188 0.999 2
length{all}[15] 0.104825 0.012100 0.000130 0.298754 0.071620 0.998 2
length{all}[16] 0.107486 0.010421 0.000601 0.297495 0.075488 1.008 2
length{all}[17] 0.092209 0.008277 0.000100 0.291934 0.060427 0.998 2
length{all}[18] 0.096004 0.008326 0.001055 0.258925 0.068785 1.008 2
length{all}[19] 0.101386 0.010429 0.000529 0.295991 0.072784 1.000 2
length{all}[20] 0.092387 0.007051 0.000068 0.256223 0.066296 0.998 2
length{all}[21] 0.103791 0.009173 0.000142 0.283110 0.071960 0.998 2
length{all}[22] 0.099564 0.008980 0.000036 0.297308 0.072992 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004888
Maximum standard deviation of split frequencies = 0.012248
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------- C5 (5)
|
\---------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 294
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 40 patterns at 98 / 98 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 40 patterns at 98 / 98 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
39040 bytes for conP
3520 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.045227 0.103159 0.013863 0.089318 0.049462 0.078756 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -410.736372
Iterating by ming2
Initial: fx= 410.736372
x= 0.04523 0.10316 0.01386 0.08932 0.04946 0.07876 0.30000 1.30000
1 h-m-p 0.0000 0.0001 237.0238 ++ 402.765373 m 0.0001 13 | 1/8
2 h-m-p 0.0160 8.0000 38.2734 -------------.. | 1/8
3 h-m-p 0.0000 0.0003 216.5545 +++ 387.573315 m 0.0003 47 | 2/8
4 h-m-p 0.0160 8.0000 35.3061 -------------.. | 2/8
5 h-m-p 0.0000 0.0000 194.7320 ++ 385.918129 m 0.0000 80 | 3/8
6 h-m-p 0.0160 8.0000 30.5961 -------------.. | 3/8
7 h-m-p 0.0000 0.0003 168.4163 +++ 377.273288 m 0.0003 114 | 4/8
8 h-m-p 0.0160 8.0000 24.1002 -------------.. | 4/8
9 h-m-p 0.0000 0.0001 138.2258 ++ 375.173082 m 0.0001 147 | 5/8
10 h-m-p 0.0160 8.0000 17.6685 -------------.. | 5/8
11 h-m-p 0.0000 0.0001 97.8187 ++ 373.789958 m 0.0001 180 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ++ 373.789958 m 8.0000 191 | 6/8
13 h-m-p 0.0376 8.0000 0.0000 ----N 373.789958 0 0.0000 208
Out..
lnL = -373.789958
209 lfun, 209 eigenQcodon, 1254 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.052236 0.077792 0.026883 0.012887 0.021169 0.016363 0.300334 0.820657 0.460831
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.139200
np = 9
lnL0 = -393.910613
Iterating by ming2
Initial: fx= 393.910613
x= 0.05224 0.07779 0.02688 0.01289 0.02117 0.01636 0.30033 0.82066 0.46083
1 h-m-p 0.0000 0.0001 235.6981 ++ 386.484935 m 0.0001 14 | 1/9
2 h-m-p 0.0001 0.0005 68.3548 ++ 384.772126 m 0.0005 26 | 2/9
3 h-m-p 0.0000 0.0001 200.8080 ++ 383.262816 m 0.0001 38 | 3/9
4 h-m-p 0.0000 0.0001 589.5203 ++ 381.397334 m 0.0001 50 | 4/9
5 h-m-p 0.0000 0.0001 2383.8949 ++ 376.097242 m 0.0001 62 | 5/9
6 h-m-p 0.0000 0.0001 1589.6046 ++ 373.789965 m 0.0001 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0000 ++ 373.789965 m 8.0000 86 | 6/9
8 h-m-p 0.0215 7.4166 0.0163 ---------C 373.789965 0 0.0000 110 | 6/9
9 h-m-p 0.0160 8.0000 0.0000 +++++ 373.789965 m 8.0000 128 | 6/9
10 h-m-p 0.0020 0.9973 0.3907 --------C 373.789965 0 0.0000 151 | 6/9
11 h-m-p 0.0160 8.0000 0.0033 +++++ 373.789965 m 8.0000 169 | 6/9
12 h-m-p 0.0588 0.9856 0.4540 -----------N 373.789965 0 0.0000 195 | 6/9
13 h-m-p 0.0160 8.0000 0.0000 ---Y 373.789965 0 0.0001 213 | 6/9
14 h-m-p 0.0160 8.0000 0.0000 +++++ 373.789965 m 8.0000 231 | 6/9
15 h-m-p 0.0015 0.7466 0.6009 +++++ 373.789956 m 0.7466 249 | 6/9
16 h-m-p 0.0801 0.4007 2.0288 ------------C 373.789956 0 0.0000 276 | 6/9
17 h-m-p 0.0160 8.0000 0.0000 ---C 373.789956 0 0.0001 291 | 6/9
18 h-m-p 0.0000 0.0003 0.0000 --------.. | 6/9
19 h-m-p 0.0160 8.0000 0.0000 +++++ 373.789956 m 8.0000 330 | 6/9
20 h-m-p 0.0000 0.0001 1.9105 ---------.. | 6/9
21 h-m-p 0.0160 8.0000 0.0000 +++++ 373.789956 m 8.0000 367 | 6/9
22 h-m-p 0.0160 8.0000 0.0208 +++++ 373.789951 m 8.0000 385 | 6/9
23 h-m-p 0.0042 0.0211 22.4903 ++ 373.789935 m 0.0211 400 | 7/9
24 h-m-p 0.1808 3.4857 2.4157 +++ 373.789878 m 3.4857 413 | 7/9
25 h-m-p 0.0000 0.0000 0.6308
h-m-p: 3.17190514e-16 1.58595257e-15 6.30761576e-01 373.789878
.. | 8/9
26 h-m-p 0.0160 8.0000 0.0000 N 373.789878 0 0.0080 436
Out..
lnL = -373.789878
437 lfun, 1311 eigenQcodon, 5244 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.063488 0.104035 0.017381 0.108302 0.108443 0.039577 9.398277 1.000580 0.516950 0.358785 1.558237
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 1.674369
np = 11
lnL0 = -413.641800
Iterating by ming2
Initial: fx= 413.641800
x= 0.06349 0.10404 0.01738 0.10830 0.10844 0.03958 9.39828 1.00058 0.51695 0.35878 1.55824
1 h-m-p 0.0000 0.0002 211.4864 +++ 404.748903 m 0.0002 17 | 1/11
2 h-m-p 0.0004 0.0019 85.4208 ++ 393.573825 m 0.0019 31 | 2/11
3 h-m-p 0.0000 0.0002 524.1148 ++ 385.473555 m 0.0002 45 | 3/11
4 h-m-p 0.0002 0.0009 173.2855 ++ 380.569563 m 0.0009 59 | 4/11
5 h-m-p 0.0160 8.0000 5.8862 -------------.. | 4/11
6 h-m-p 0.0000 0.0002 158.5175 +++ 374.472681 m 0.0002 99 | 5/11
7 h-m-p 0.0160 8.0000 2.9753 -------------.. | 5/11
8 h-m-p 0.0000 0.0000 135.0970 ++ 373.801043 m 0.0000 138 | 6/11
9 h-m-p 0.0160 8.0000 2.2985 -------------.. | 6/11
10 h-m-p 0.0000 0.0000 96.0441 ++ 373.789909 m 0.0000 177 | 7/11
11 h-m-p 0.0160 8.0000 0.0000 N 373.789909 0 0.0020 191 | 6/11
12 h-m-p 0.0160 8.0000 0.0001 +++++ 373.789909 m 8.0000 212 | 6/11
13 h-m-p 0.0136 6.8051 0.1627 +++++ 373.789868 m 6.8051 234 | 7/11
14 h-m-p 0.5604 2.8018 0.4671 ----------------.. | 7/11
15 h-m-p 0.0160 8.0000 0.0000 +++++ 373.789868 m 8.0000 288 | 7/11
16 h-m-p 0.0029 1.4584 0.8995 --------Y 373.789868 0 0.0000 314 | 7/11
17 h-m-p 0.0160 8.0000 0.0001 --------N 373.789868 0 0.0000 340 | 7/11
18 h-m-p 0.0160 8.0000 0.0002 +++++ 373.789868 m 8.0000 361 | 7/11
19 h-m-p 0.0018 0.8918 1.8584 ------------.. | 7/11
20 h-m-p 0.0160 8.0000 0.0000 +++++ 373.789868 m 8.0000 406 | 7/11
21 h-m-p 0.0160 8.0000 0.1182 ---------Y 373.789868 0 0.0000 433 | 7/11
22 h-m-p 0.0160 8.0000 0.0053 +++++ 373.789867 m 8.0000 454 | 7/11
23 h-m-p 0.0112 0.3630 3.7832 ----------Y 373.789867 0 0.0000 482 | 7/11
24 h-m-p 0.0160 8.0000 0.0073 +++++ 373.789867 m 8.0000 499 | 7/11
25 h-m-p 0.0141 0.3453 4.1221 -------------.. | 7/11
26 h-m-p 0.0160 8.0000 0.0000 +++++ 373.789867 m 8.0000 545 | 7/11
27 h-m-p 0.0160 8.0000 0.0113 ------C 373.789867 0 0.0000 569 | 7/11
28 h-m-p 0.0160 8.0000 0.0003 +++++ 373.789867 m 8.0000 590 | 7/11
29 h-m-p 0.0007 0.3275 4.3566 -----------.. | 7/11
30 h-m-p 0.0160 8.0000 0.0000 +++++ 373.789867 m 8.0000 634 | 7/11
31 h-m-p 0.0160 8.0000 0.0131 ---------Y 373.789867 0 0.0000 661 | 7/11
32 h-m-p 0.0160 8.0000 0.0000 +++++ 373.789866 m 8.0000 682 | 7/11
33 h-m-p 0.0004 0.2227 8.3066 --------Y 373.789866 0 0.0000 708 | 7/11
34 h-m-p 0.0160 8.0000 0.0001 +++++ 373.789866 m 8.0000 725 | 7/11
35 h-m-p 0.0160 8.0000 3.9409 +++++ 373.789791 m 8.0000 746 | 7/11
36 h-m-p 1.6000 8.0000 1.8849 ++ 373.789785 m 8.0000 760 | 7/11
37 h-m-p 0.7130 5.4678 21.1487 ++ 373.789769 m 5.4678 774 | 7/11
38 h-m-p -0.0000 -0.0000 35.2662
h-m-p: -0.00000000e+00 -0.00000000e+00 3.52661893e+01 373.789769
.. | 7/11
39 h-m-p 0.0160 8.0000 0.0000 N 373.789769 0 0.0040 799 | 7/11
40 h-m-p 0.0160 8.0000 0.0000 C 373.789769 0 0.0040 817
Out..
lnL = -373.789769
818 lfun, 3272 eigenQcodon, 14724 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -373.787653 S = -373.787612 -0.000016
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 40 patterns 0:06
did 20 / 40 patterns 0:06
did 30 / 40 patterns 0:07
did 40 / 40 patterns 0:07
Time used: 0:07
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.044164 0.084804 0.014247 0.038068 0.048743 0.080604 29.923803 0.494451 1.418152
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 1.072058
np = 9
lnL0 = -403.043230
Iterating by ming2
Initial: fx= 403.043230
x= 0.04416 0.08480 0.01425 0.03807 0.04874 0.08060 29.92380 0.49445 1.41815
1 h-m-p 0.0000 0.0002 222.3942 ++ 395.416740 m 0.0002 14 | 1/9
2 h-m-p 0.0025 0.1438 12.1345 ------------.. | 1/9
3 h-m-p 0.0000 0.0003 206.2521 +++ 384.300733 m 0.0003 49 | 2/9
4 h-m-p 0.0040 0.1874 11.7215 ------------.. | 2/9
5 h-m-p 0.0000 0.0001 190.1678 ++ 381.942734 m 0.0001 83 | 3/9
6 h-m-p 0.0009 0.2416 11.5399 -----------.. | 3/9
7 h-m-p 0.0000 0.0000 165.1691 ++ 380.608387 m 0.0000 116 | 4/9
8 h-m-p 0.0007 0.3069 9.5459 -----------.. | 4/9
9 h-m-p 0.0000 0.0003 134.3989 +++ 374.229209 m 0.0003 150 | 5/9
10 h-m-p 0.0041 0.4353 7.9926 ------------.. | 5/9
11 h-m-p 0.0000 0.0000 98.2137 ++ 373.789970 m 0.0000 184 | 6/9
12 h-m-p 1.4225 8.0000 0.0000 ++ 373.789970 m 8.0000 196 | 6/9
13 h-m-p 0.0699 8.0000 0.0001 ++++ 373.789970 m 8.0000 213 | 6/9
14 h-m-p 0.0160 8.0000 0.3942 +++++ 373.789968 m 8.0000 231 | 6/9
15 h-m-p 1.6000 8.0000 0.6229 ++ 373.789967 m 8.0000 246 | 6/9
16 h-m-p 1.6000 8.0000 2.0290 ++ 373.789967 m 8.0000 261 | 6/9
17 h-m-p 0.6914 3.4572 23.0172 ++ 373.789967 m 3.4572 273 | 6/9
18 h-m-p 1.6000 8.0000 1.2382 -------C 373.789967 0 0.0000 292 | 6/9
19 h-m-p 0.0025 0.0124 0.0024 N 373.789967 0 0.0006 304 | 6/9
20 h-m-p 1.6000 8.0000 0.0000 -----Y 373.789967 0 0.0004 324
Out..
lnL = -373.789967
325 lfun, 3575 eigenQcodon, 19500 P(t)
Time used: 0:12
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.041872 0.061420 0.050307 0.075267 0.028623 0.109731 29.734001 0.900000 0.643086 1.530520 1.300033
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.893322
np = 11
lnL0 = -407.208398
Iterating by ming2
Initial: fx= 407.208398
x= 0.04187 0.06142 0.05031 0.07527 0.02862 0.10973 29.73400 0.90000 0.64309 1.53052 1.30003
1 h-m-p 0.0000 0.0003 211.1309 +++ 392.343450 m 0.0003 17 | 1/11
2 h-m-p 0.0002 0.0010 88.7696 ++ 385.766484 m 0.0010 31 | 2/11
3 h-m-p 0.0000 0.0001 281.9441 ++ 382.363780 m 0.0001 45 | 3/11
4 h-m-p 0.0003 0.0014 53.3222 ++ 380.323663 m 0.0014 59 | 4/11
5 h-m-p 0.0000 0.0002 246.5152 ++ 378.298516 m 0.0002 73 | 5/11
6 h-m-p 0.0000 0.0001 3318.4614 ++ 373.789873 m 0.0001 87 | 6/11
7 h-m-p 1.6000 8.0000 0.0001 ++ 373.789873 m 8.0000 101 | 6/11
8 h-m-p 0.0005 0.2588 2.1452 +++++ 373.789831 m 0.2588 123 | 7/11
9 h-m-p 0.1522 0.7610 1.4950 ++ 373.789811 m 0.7610 137 | 7/11
10 h-m-p 0.0000 0.0000 0.8879
h-m-p: 2.59294351e-18 1.29647176e-17 8.87929351e-01 373.789811
.. | 7/11
11 h-m-p 0.0160 8.0000 0.0000 +++++ 373.789811 m 8.0000 169 | 7/11
12 h-m-p 0.0160 8.0000 5.7544 +++++ 373.789771 m 8.0000 190 | 7/11
13 h-m-p 1.6000 8.0000 0.2435 ++ 373.789770 m 8.0000 204 | 7/11
14 h-m-p 0.0741 8.0000 26.3052 ++++ 373.789766 m 8.0000 224 | 7/11
15 h-m-p 1.6000 8.0000 47.2043 ++ 373.789763 m 8.0000 238 | 7/11
16 h-m-p 0.2330 1.1650 309.5059 ++ 373.789761 m 1.1650 252 | 7/11
17 h-m-p 0.0000 0.0000 1085.3339
h-m-p: 0.00000000e+00 0.00000000e+00 1.08533391e+03 373.789761
.. | 7/11
18 h-m-p 0.0160 8.0000 0.0000 C 373.789761 0 0.0059 277 | 8/11
19 h-m-p 0.0160 8.0000 0.0000 +Y 373.789761 0 0.0640 296
Out..
lnL = -373.789761
297 lfun, 3564 eigenQcodon, 19602 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -373.787611 S = -373.787604 -0.000003
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 40 patterns 0:18
did 20 / 40 patterns 0:18
did 30 / 40 patterns 0:18
did 40 / 40 patterns 0:18
Time used: 0:18
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=98
NC_011896_1_WP_010908946_1_2704_MLBR_RS12860 VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
NC_002677_1_NP_302627_1_1499_ML2532 VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
NZ_LVXE01000003_1_WP_010908946_1_1365_A3216_RS02500 VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
NZ_LYPH01000044_1_WP_010908946_1_1698_A8144_RS08095 VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
NZ_CP029543_1_WP_010908946_1_2735_DIJ64_RS13930 VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
NZ_AP014567_1_WP_010908946_1_2801_JK2ML_RS14260 VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
**************************************************
NC_011896_1_WP_010908946_1_2704_MLBR_RS12860 FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
NC_002677_1_NP_302627_1_1499_ML2532 FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
NZ_LVXE01000003_1_WP_010908946_1_1365_A3216_RS02500 FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
NZ_LYPH01000044_1_WP_010908946_1_1698_A8144_RS08095 FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
NZ_CP029543_1_WP_010908946_1_2735_DIJ64_RS13930 FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
NZ_AP014567_1_WP_010908946_1_2801_JK2ML_RS14260 FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
************************************************
>NC_011896_1_WP_010908946_1_2704_MLBR_RS12860 GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG >NC_002677_1_NP_302627_1_1499_ML2532 GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG >NZ_LVXE01000003_1_WP_010908946_1_1365_A3216_RS02500 GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG >NZ_LYPH01000044_1_WP_010908946_1_1698_A8144_RS08095 GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG >NZ_CP029543_1_WP_010908946_1_2735_DIJ64_RS13930 GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG >NZ_AP014567_1_WP_010908946_1_2801_JK2ML_RS14260 GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG
>NC_011896_1_WP_010908946_1_2704_MLBR_RS12860 VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL >NC_002677_1_NP_302627_1_1499_ML2532 VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL >NZ_LVXE01000003_1_WP_010908946_1_1365_A3216_RS02500 VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL >NZ_LYPH01000044_1_WP_010908946_1_1698_A8144_RS08095 VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL >NZ_CP029543_1_WP_010908946_1_2735_DIJ64_RS13930 VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL >NZ_AP014567_1_WP_010908946_1_2801_JK2ML_RS14260 VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
#NEXUS
[ID: 5610351917]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908946_1_2704_MLBR_RS12860
NC_002677_1_NP_302627_1_1499_ML2532
NZ_LVXE01000003_1_WP_010908946_1_1365_A3216_RS02500
NZ_LYPH01000044_1_WP_010908946_1_1698_A8144_RS08095
NZ_CP029543_1_WP_010908946_1_2735_DIJ64_RS13930
NZ_AP014567_1_WP_010908946_1_2801_JK2ML_RS14260
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908946_1_2704_MLBR_RS12860,
2 NC_002677_1_NP_302627_1_1499_ML2532,
3 NZ_LVXE01000003_1_WP_010908946_1_1365_A3216_RS02500,
4 NZ_LYPH01000044_1_WP_010908946_1_1698_A8144_RS08095,
5 NZ_CP029543_1_WP_010908946_1_2735_DIJ64_RS13930,
6 NZ_AP014567_1_WP_010908946_1_2801_JK2ML_RS14260
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.0674862,2:0.0703758,3:0.07080744,4:0.07046762,5:0.06586075,6:0.06892842);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.0674862,2:0.0703758,3:0.07080744,4:0.07046762,5:0.06586075,6:0.06892842);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -404.69 -408.39
2 -404.73 -407.70
--------------------------------------
TOTAL -404.71 -408.10
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897493 0.086567 0.379119 1.483864 0.875017 1501.00 1501.00 1.001
r(A<->C){all} 0.155185 0.018628 0.000107 0.441153 0.118870 105.13 195.16 1.000
r(A<->G){all} 0.154076 0.017788 0.000028 0.422187 0.119865 306.01 319.93 1.008
r(A<->T){all} 0.178374 0.021757 0.000127 0.468992 0.141893 207.03 245.14 1.005
r(C<->G){all} 0.160619 0.017722 0.000022 0.424132 0.129587 149.01 204.64 1.000
r(C<->T){all} 0.178724 0.022177 0.000149 0.485512 0.140349 247.84 270.82 1.011
r(G<->T){all} 0.173021 0.021971 0.000110 0.473227 0.133214 180.29 196.82 1.002
pi(A){all} 0.194281 0.000532 0.145992 0.234832 0.193589 1242.35 1371.67 1.000
pi(C){all} 0.271482 0.000639 0.218495 0.319639 0.270461 1315.84 1329.91 1.000
pi(G){all} 0.309079 0.000731 0.254783 0.357894 0.308441 1259.51 1287.48 1.000
pi(T){all} 0.225159 0.000581 0.180114 0.273871 0.223979 1062.96 1196.19 1.000
alpha{1,2} 0.418977 0.238859 0.000103 1.390746 0.252686 1102.44 1256.52 1.000
alpha{3} 0.441686 0.219337 0.000123 1.365005 0.280295 1313.54 1407.27 1.000
pinvar{all} 0.994494 0.000043 0.982160 0.999992 0.996684 1174.35 1256.24 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2532/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 98
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 1 1 1 1 1 1
TTC 1 1 1 1 1 1 | TCC 2 2 2 2 2 2 | TAC 1 1 1 1 1 1 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 3 3 3 3 3 3 | Arg CGT 0 0 0 0 0 0
CTC 1 1 1 1 1 1 | CCC 0 0 0 0 0 0 | CAC 1 1 1 1 1 1 | CGC 1 1 1 1 1 1
CTA 0 0 0 0 0 0 | CCA 1 1 1 1 1 1 | Gln CAA 1 1 1 1 1 1 | CGA 0 0 0 0 0 0
CTG 3 3 3 3 3 3 | CCG 0 0 0 0 0 0 | CAG 8 8 8 8 8 8 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 1 1 1 1 1 1 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 3 3 3 3 3 3 | ACC 4 4 4 4 4 4 | AAC 1 1 1 1 1 1 | AGC 2 2 2 2 2 2
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 1 1 1 1 1 1 | ACG 2 2 2 2 2 2 | AAG 1 1 1 1 1 1 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 8 8 8 8 8 8 | Asp GAT 3 3 3 3 3 3 | Gly GGT 1 1 1 1 1 1
GTC 2 2 2 2 2 2 | GCC 3 3 3 3 3 3 | GAC 0 0 0 0 0 0 | GGC 0 0 0 0 0 0
GTA 0 0 0 0 0 0 | GCA 5 5 5 5 5 5 | Glu GAA 0 0 0 0 0 0 | GGA 0 0 0 0 0 0
GTG 2 2 2 2 2 2 | GCG 8 8 8 8 8 8 | GAG 7 7 7 7 7 7 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908946_1_2704_MLBR_RS12860
position 1: T:0.16327 C:0.20408 A:0.20408 G:0.42857
position 2: T:0.23469 C:0.38776 A:0.29592 G:0.08163
position 3: T:0.27551 C:0.22449 A:0.08163 G:0.41837
Average T:0.22449 C:0.27211 A:0.19388 G:0.30952
#2: NC_002677_1_NP_302627_1_1499_ML2532
position 1: T:0.16327 C:0.20408 A:0.20408 G:0.42857
position 2: T:0.23469 C:0.38776 A:0.29592 G:0.08163
position 3: T:0.27551 C:0.22449 A:0.08163 G:0.41837
Average T:0.22449 C:0.27211 A:0.19388 G:0.30952
#3: NZ_LVXE01000003_1_WP_010908946_1_1365_A3216_RS02500
position 1: T:0.16327 C:0.20408 A:0.20408 G:0.42857
position 2: T:0.23469 C:0.38776 A:0.29592 G:0.08163
position 3: T:0.27551 C:0.22449 A:0.08163 G:0.41837
Average T:0.22449 C:0.27211 A:0.19388 G:0.30952
#4: NZ_LYPH01000044_1_WP_010908946_1_1698_A8144_RS08095
position 1: T:0.16327 C:0.20408 A:0.20408 G:0.42857
position 2: T:0.23469 C:0.38776 A:0.29592 G:0.08163
position 3: T:0.27551 C:0.22449 A:0.08163 G:0.41837
Average T:0.22449 C:0.27211 A:0.19388 G:0.30952
#5: NZ_CP029543_1_WP_010908946_1_2735_DIJ64_RS13930
position 1: T:0.16327 C:0.20408 A:0.20408 G:0.42857
position 2: T:0.23469 C:0.38776 A:0.29592 G:0.08163
position 3: T:0.27551 C:0.22449 A:0.08163 G:0.41837
Average T:0.22449 C:0.27211 A:0.19388 G:0.30952
#6: NZ_AP014567_1_WP_010908946_1_2801_JK2ML_RS14260
position 1: T:0.16327 C:0.20408 A:0.20408 G:0.42857
position 2: T:0.23469 C:0.38776 A:0.29592 G:0.08163
position 3: T:0.27551 C:0.22449 A:0.08163 G:0.41837
Average T:0.22449 C:0.27211 A:0.19388 G:0.30952
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 18 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 6
TTC 6 | TCC 12 | TAC 6 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 24 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 18 | Arg R CGT 0
CTC 6 | CCC 0 | CAC 6 | CGC 6
CTA 0 | CCA 6 | Gln Q CAA 6 | CGA 0
CTG 18 | CCG 0 | CAG 48 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 6 | Asn N AAT 6 | Ser S AGT 6
ATC 18 | ACC 24 | AAC 6 | AGC 12
ATA 0 | ACA 0 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 6 | ACG 12 | AAG 6 | AGG 0
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 48 | Asp D GAT 18 | Gly G GGT 6
GTC 12 | GCC 18 | GAC 0 | GGC 0
GTA 0 | GCA 30 | Glu E GAA 0 | GGA 0
GTG 12 | GCG 48 | GAG 42 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.16327 C:0.20408 A:0.20408 G:0.42857
position 2: T:0.23469 C:0.38776 A:0.29592 G:0.08163
position 3: T:0.27551 C:0.22449 A:0.08163 G:0.41837
Average T:0.22449 C:0.27211 A:0.19388 G:0.30952
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -373.789958 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300334 1.300033
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908946_1_2704_MLBR_RS12860: 0.000004, NC_002677_1_NP_302627_1_1499_ML2532: 0.000004, NZ_LVXE01000003_1_WP_010908946_1_1365_A3216_RS02500: 0.000004, NZ_LYPH01000044_1_WP_010908946_1_1698_A8144_RS08095: 0.000004, NZ_CP029543_1_WP_010908946_1_2735_DIJ64_RS13930: 0.000004, NZ_AP014567_1_WP_010908946_1_2801_JK2ML_RS14260: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30033
omega (dN/dS) = 1.30003
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 221.9 72.1 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 221.9 72.1 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 221.9 72.1 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 221.9 72.1 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 221.9 72.1 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 221.9 72.1 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -373.789878 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 9.398277 0.000010 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908946_1_2704_MLBR_RS12860: 0.000004, NC_002677_1_NP_302627_1_1499_ML2532: 0.000004, NZ_LVXE01000003_1_WP_010908946_1_1365_A3216_RS02500: 0.000004, NZ_LYPH01000044_1_WP_010908946_1_1698_A8144_RS08095: 0.000004, NZ_CP029543_1_WP_010908946_1_2735_DIJ64_RS13930: 0.000004, NZ_AP014567_1_WP_010908946_1_2801_JK2ML_RS14260: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 9.39828
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 210.5 83.5 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 210.5 83.5 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 210.5 83.5 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 210.5 83.5 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 210.5 83.5 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 210.5 83.5 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -373.789769 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 29.923803 0.000003 0.000000 1.000000 128.117322
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908946_1_2704_MLBR_RS12860: 0.000004, NC_002677_1_NP_302627_1_1499_ML2532: 0.000004, NZ_LVXE01000003_1_WP_010908946_1_1365_A3216_RS02500: 0.000004, NZ_LYPH01000044_1_WP_010908946_1_1698_A8144_RS08095: 0.000004, NZ_CP029543_1_WP_010908946_1_2735_DIJ64_RS13930: 0.000004, NZ_AP014567_1_WP_010908946_1_2801_JK2ML_RS14260: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 29.92380
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 1.00000 1.00000 128.11732
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 208.6 85.4 128.1169 0.0000 0.0000 0.0 0.0
7..2 0.000 208.6 85.4 128.1169 0.0000 0.0000 0.0 0.0
7..3 0.000 208.6 85.4 128.1169 0.0000 0.0000 0.0 0.0
7..4 0.000 208.6 85.4 128.1169 0.0000 0.0000 0.0 0.0
7..5 0.000 208.6 85.4 128.1169 0.0000 0.0000 0.0 0.0
7..6 0.000 208.6 85.4 128.1169 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908946_1_2704_MLBR_RS12860)
Pr(w>1) post mean +- SE for w
1 V 1.000** 128.117
2 S 1.000** 128.117
3 L 1.000** 128.117
4 L 1.000** 128.117
5 D 1.000** 128.117
6 V 1.000** 128.117
7 H 1.000** 128.117
8 I 1.000** 128.117
9 P 1.000** 128.117
10 Q 1.000** 128.117
11 L 1.000** 128.117
12 V 1.000** 128.117
13 A 1.000** 128.117
14 S 1.000** 128.117
15 E 1.000** 128.117
16 S 1.000** 128.117
17 A 1.000** 128.117
18 F 1.000** 128.117
19 A 1.000** 128.117
20 A 1.000** 128.117
21 K 1.000** 128.117
22 A 1.000** 128.117
23 A 1.000** 128.117
24 L 1.000** 128.117
25 M 1.000** 128.117
26 R 1.000** 128.117
27 S 1.000** 128.117
28 Q 1.000** 128.117
29 I 1.000** 128.117
30 N 1.000** 128.117
31 Q 1.000** 128.117
32 A 1.000** 128.117
33 E 1.000** 128.117
34 C 1.000** 128.117
35 E 1.000** 128.117
36 A 1.000** 128.117
37 I 1.000** 128.117
38 S 1.000** 128.117
39 A 1.000** 128.117
40 Q 1.000** 128.117
41 A 1.000** 128.117
42 F 1.000** 128.117
43 H 1.000** 128.117
44 Q 1.000** 128.117
45 G 1.000** 128.117
46 E 1.000** 128.117
47 S 1.000** 128.117
48 S 1.000** 128.117
49 A 1.000** 128.117
50 A 1.000** 128.117
51 F 1.000** 128.117
52 Q 1.000** 128.117
53 S 1.000** 128.117
54 A 1.000** 128.117
55 H 1.000** 128.117
56 A 1.000** 128.117
57 Q 1.000** 128.117
58 F 1.000** 128.117
59 V 1.000** 128.117
60 T 1.000** 128.117
61 A 1.000** 128.117
62 A 1.000** 128.117
63 E 1.000** 128.117
64 K 1.000** 128.117
65 I 1.000** 128.117
66 N 1.000** 128.117
67 A 1.000** 128.117
68 L 1.000** 128.117
69 L 1.000** 128.117
70 D 1.000** 128.117
71 I 1.000** 128.117
72 A 1.000** 128.117
73 Q 1.000** 128.117
74 Q 1.000** 128.117
75 H 1.000** 128.117
76 L 1.000** 128.117
77 G 1.000** 128.117
78 E 1.000** 128.117
79 A 1.000** 128.117
80 A 1.000** 128.117
81 E 1.000** 128.117
82 T 1.000** 128.117
83 Y 1.000** 128.117
84 V 1.000** 128.117
85 A 1.000** 128.117
86 T 1.000** 128.117
87 D 1.000** 128.117
88 A 1.000** 128.117
89 T 1.000** 128.117
90 A 1.000** 128.117
91 A 1.000** 128.117
92 S 1.000** 128.117
93 T 1.000** 128.117
94 Y 1.000** 128.117
95 T 1.000** 128.117
96 T 1.000** 128.117
97 G 1.000** 128.117
98 L 1.000** 128.117
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908946_1_2704_MLBR_RS12860)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:07
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -373.789967 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 29.734001 36.302577 98.999973
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908946_1_2704_MLBR_RS12860: 0.000004, NC_002677_1_NP_302627_1_1499_ML2532: 0.000004, NZ_LVXE01000003_1_WP_010908946_1_1365_A3216_RS02500: 0.000004, NZ_LYPH01000044_1_WP_010908946_1_1698_A8144_RS08095: 0.000004, NZ_CP029543_1_WP_010908946_1_2735_DIJ64_RS13930: 0.000004, NZ_AP014567_1_WP_010908946_1_2801_JK2ML_RS14260: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 29.73400
Parameters in M7 (beta):
p = 36.30258 q = 98.99997
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.20786 0.22898 0.24201 0.25266 0.26239 0.27197 0.28201 0.29337 0.30782 0.33266
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 208.6 85.4 0.2682 0.0000 0.0000 0.0 0.0
7..2 0.000 208.6 85.4 0.2682 0.0000 0.0000 0.0 0.0
7..3 0.000 208.6 85.4 0.2682 0.0000 0.0000 0.0 0.0
7..4 0.000 208.6 85.4 0.2682 0.0000 0.0000 0.0 0.0
7..5 0.000 208.6 85.4 0.2682 0.0000 0.0000 0.0 0.0
7..6 0.000 208.6 85.4 0.2682 0.0000 0.0000 0.0 0.0
Time used: 0:12
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -373.789761 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 58.831559 0.000010 0.005000 1.677394 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908946_1_2704_MLBR_RS12860: 0.000004, NC_002677_1_NP_302627_1_1499_ML2532: 0.000004, NZ_LVXE01000003_1_WP_010908946_1_1365_A3216_RS02500: 0.000004, NZ_LYPH01000044_1_WP_010908946_1_1698_A8144_RS08095: 0.000004, NZ_CP029543_1_WP_010908946_1_2735_DIJ64_RS13930: 0.000004, NZ_AP014567_1_WP_010908946_1_2801_JK2ML_RS14260: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 58.83156
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 1.67739
(p1 = 0.99999) w = 999.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 208.0 86.0 998.9900 0.0000 0.0000 0.0 0.0
7..2 0.000 208.0 86.0 998.9900 0.0000 0.0000 0.0 0.0
7..3 0.000 208.0 86.0 998.9900 0.0000 0.0000 0.0 0.0
7..4 0.000 208.0 86.0 998.9900 0.0000 0.0000 0.0 0.0
7..5 0.000 208.0 86.0 998.9900 0.0000 0.0000 0.0 0.0
7..6 0.000 208.0 86.0 998.9900 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908946_1_2704_MLBR_RS12860)
Pr(w>1) post mean +- SE for w
1 V 1.000** 998.990
2 S 1.000** 998.990
3 L 1.000** 998.990
4 L 1.000** 998.990
5 D 1.000** 998.990
6 V 1.000** 998.990
7 H 1.000** 998.990
8 I 1.000** 998.990
9 P 1.000** 998.990
10 Q 1.000** 998.990
11 L 1.000** 998.990
12 V 1.000** 998.990
13 A 1.000** 998.990
14 S 1.000** 998.990
15 E 1.000** 998.990
16 S 1.000** 998.990
17 A 1.000** 998.990
18 F 1.000** 998.990
19 A 1.000** 998.990
20 A 1.000** 998.990
21 K 1.000** 998.990
22 A 1.000** 998.990
23 A 1.000** 998.990
24 L 1.000** 998.990
25 M 1.000** 998.990
26 R 1.000** 998.990
27 S 1.000** 998.990
28 Q 1.000** 998.990
29 I 1.000** 998.990
30 N 1.000** 998.990
31 Q 1.000** 998.990
32 A 1.000** 998.990
33 E 1.000** 998.990
34 C 1.000** 998.990
35 E 1.000** 998.990
36 A 1.000** 998.990
37 I 1.000** 998.990
38 S 1.000** 998.990
39 A 1.000** 998.990
40 Q 1.000** 998.990
41 A 1.000** 998.990
42 F 1.000** 998.990
43 H 1.000** 998.990
44 Q 1.000** 998.990
45 G 1.000** 998.990
46 E 1.000** 998.990
47 S 1.000** 998.990
48 S 1.000** 998.990
49 A 1.000** 998.990
50 A 1.000** 998.990
51 F 1.000** 998.990
52 Q 1.000** 998.990
53 S 1.000** 998.990
54 A 1.000** 998.990
55 H 1.000** 998.990
56 A 1.000** 998.990
57 Q 1.000** 998.990
58 F 1.000** 998.990
59 V 1.000** 998.990
60 T 1.000** 998.990
61 A 1.000** 998.990
62 A 1.000** 998.990
63 E 1.000** 998.990
64 K 1.000** 998.990
65 I 1.000** 998.990
66 N 1.000** 998.990
67 A 1.000** 998.990
68 L 1.000** 998.990
69 L 1.000** 998.990
70 D 1.000** 998.990
71 I 1.000** 998.990
72 A 1.000** 998.990
73 Q 1.000** 998.990
74 Q 1.000** 998.990
75 H 1.000** 998.990
76 L 1.000** 998.990
77 G 1.000** 998.990
78 E 1.000** 998.990
79 A 1.000** 998.990
80 A 1.000** 998.990
81 E 1.000** 998.990
82 T 1.000** 998.990
83 Y 1.000** 998.990
84 V 1.000** 998.990
85 A 1.000** 998.990
86 T 1.000** 998.990
87 D 1.000** 998.990
88 A 1.000** 998.990
89 T 1.000** 998.990
90 A 1.000** 998.990
91 A 1.000** 998.990
92 S 1.000** 998.990
93 T 1.000** 998.990
94 Y 1.000** 998.990
95 T 1.000** 998.990
96 T 1.000** 998.990
97 G 1.000** 998.990
98 L 1.000** 998.990
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908946_1_2704_MLBR_RS12860)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:18
Model 1: NearlyNeutral -373.789878 Model 2: PositiveSelection -373.789769 Model 0: one-ratio -373.789958 Model 7: beta -373.789967 Model 8: beta&w>1 -373.789761 Model 0 vs 1 1.6000000005078618E-4 Model 2 vs 1 2.180000000180371E-4 Model 8 vs 7 4.1199999998298154E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
