--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:25:50 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2532/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -404.69          -408.39
2       -404.73          -407.70
--------------------------------------
TOTAL     -404.71          -408.10
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.897493    0.086567    0.379119    1.483864    0.875017   1501.00   1501.00    1.001
r(A<->C){all}   0.155185    0.018628    0.000107    0.441153    0.118870    105.13    195.16    1.000
r(A<->G){all}   0.154076    0.017788    0.000028    0.422187    0.119865    306.01    319.93    1.008
r(A<->T){all}   0.178374    0.021757    0.000127    0.468992    0.141893    207.03    245.14    1.005
r(C<->G){all}   0.160619    0.017722    0.000022    0.424132    0.129587    149.01    204.64    1.000
r(C<->T){all}   0.178724    0.022177    0.000149    0.485512    0.140349    247.84    270.82    1.011
r(G<->T){all}   0.173021    0.021971    0.000110    0.473227    0.133214    180.29    196.82    1.002
pi(A){all}      0.194281    0.000532    0.145992    0.234832    0.193589   1242.35   1371.67    1.000
pi(C){all}      0.271482    0.000639    0.218495    0.319639    0.270461   1315.84   1329.91    1.000
pi(G){all}      0.309079    0.000731    0.254783    0.357894    0.308441   1259.51   1287.48    1.000
pi(T){all}      0.225159    0.000581    0.180114    0.273871    0.223979   1062.96   1196.19    1.000
alpha{1,2}      0.418977    0.238859    0.000103    1.390746    0.252686   1102.44   1256.52    1.000
alpha{3}        0.441686    0.219337    0.000123    1.365005    0.280295   1313.54   1407.27    1.000
pinvar{all}     0.994494    0.000043    0.982160    0.999992    0.996684   1174.35   1256.24    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-373.789878
Model 2: PositiveSelection	-373.789769
Model 0: one-ratio	-373.789958
Model 7: beta	-373.789967
Model 8: beta&w>1	-373.789761


Model 0 vs 1	1.6000000005078618E-4

Model 2 vs 1	2.180000000180371E-4

Model 8 vs 7	4.1199999998298154E-4
>C1
VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
>C2
VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
>C3
VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
>C4
VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
>C5
VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
>C6
VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=98 

C1              VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
C2              VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
C3              VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
C4              VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
C5              VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
C6              VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
                **************************************************

C1              FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
C2              FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
C3              FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
C4              FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
C5              FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
C6              FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
                ************************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   98 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   98 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2940]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [2940]--->[2940]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.453 Mb, Max= 30.622 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
C2              VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
C3              VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
C4              VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
C5              VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
C6              VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
                **************************************************

C1              FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
C2              FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
C3              FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
C4              FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
C5              FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
C6              FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
                ************************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC
C2              GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC
C3              GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC
C4              GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC
C5              GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC
C6              GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC
                **************************************************

C1              GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT
C2              GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT
C3              GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT
C4              GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT
C5              GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT
C6              GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT
                **************************************************

C1              GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA
C2              GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA
C3              GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA
C4              GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA
C5              GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA
C6              GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA
                **************************************************

C1              TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC
C2              TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC
C3              TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC
C4              TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC
C5              TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC
C6              TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC
                **************************************************

C1              TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG
C2              TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG
C3              TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG
C4              TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG
C5              TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG
C6              TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG
                **************************************************

C1              TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG
C2              TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG
C3              TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG
C4              TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG
C5              TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG
C6              TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG
                ********************************************



>C1
GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC
GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT
GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA
TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC
TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG
TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG
>C2
GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC
GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT
GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA
TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC
TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG
TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG
>C3
GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC
GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT
GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA
TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC
TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG
TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG
>C4
GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC
GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT
GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA
TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC
TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG
TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG
>C5
GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC
GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT
GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA
TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC
TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG
TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG
>C6
GTGAGTCTTTTGGATGTTCATATCCCACAACTGGTCGCCTCGGAGTCGGC
GTTCGCTGCCAAGGCTGCGTTGATGCGCAGCCAGATTAATCAGGCTGAGT
GTGAGGCGATCTCGGCTCAGGCGTTTCACCAGGGGGAGAGCTCCGCAGCA
TTTCAGTCCGCGCATGCTCAGTTTGTCACCGCGGCAGAGAAAATCAACGC
TCTGCTCGATATTGCGCAGCAGCATTTGGGTGAGGCAGCAGAGACGTATG
TGGCCACCGATGCTACGGCTGCGTCGACTTACACCACCGGGCTG
>C1
VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
>C2
VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
>C3
VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
>C4
VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
>C5
VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL
>C6
VSLLDVHIPQLVASESAFAAKAALMRSQINQAECEAISAQAFHQGESSAA
FQSAHAQFVTAAEKINALLDIAQQHLGEAAETYVATDATAASTYTTGL


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 294 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579857869
      Setting output file names to "/data/9res/ML2532/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1719118634
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5610351917
      Seed = 1651087126
      Swapseed = 1579857869
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -657.986094 -- -24.965149
         Chain 2 -- -657.986094 -- -24.965149
         Chain 3 -- -657.986094 -- -24.965149
         Chain 4 -- -657.986094 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -657.986094 -- -24.965149
         Chain 2 -- -657.986094 -- -24.965149
         Chain 3 -- -657.986094 -- -24.965149
         Chain 4 -- -657.986094 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-657.986] (-657.986) (-657.986) (-657.986) * [-657.986] (-657.986) (-657.986) (-657.986) 
        500 -- (-415.968) (-420.152) (-418.112) [-412.081] * (-423.003) (-418.764) (-416.169) [-413.220] -- 0:00:00
       1000 -- (-414.477) (-416.477) (-418.319) [-409.100] * [-415.598] (-416.567) (-409.121) (-413.065) -- 0:00:00
       1500 -- [-409.074] (-415.709) (-415.746) (-418.322) * (-415.720) (-411.826) [-415.595] (-412.272) -- 0:00:00
       2000 -- (-417.912) (-417.805) [-418.826] (-410.282) * (-414.524) (-416.674) (-420.311) [-418.090] -- 0:00:00
       2500 -- (-410.392) [-413.306] (-417.653) (-411.890) * (-416.865) (-413.359) (-417.936) [-413.177] -- 0:00:00
       3000 -- (-414.839) [-411.350] (-415.005) (-413.064) * (-408.840) [-410.515] (-410.771) (-416.072) -- 0:00:00
       3500 -- (-419.586) (-418.146) [-411.316] (-410.990) * (-417.642) [-423.240] (-410.097) (-422.407) -- 0:00:00
       4000 -- (-419.987) [-413.138] (-416.380) (-422.466) * (-412.005) (-409.384) (-418.841) [-410.634] -- 0:00:00
       4500 -- (-421.280) (-417.044) [-412.258] (-418.021) * [-415.851] (-416.001) (-416.848) (-411.669) -- 0:00:00
       5000 -- (-413.321) (-413.516) [-416.468] (-411.144) * [-418.087] (-414.750) (-419.981) (-414.105) -- 0:00:00

      Average standard deviation of split frequencies: 0.114280

       5500 -- [-410.500] (-412.017) (-417.894) (-418.365) * (-417.363) (-415.595) [-413.648] (-408.512) -- 0:00:00
       6000 -- [-404.942] (-414.899) (-420.245) (-434.836) * (-413.801) [-411.614] (-420.516) (-418.828) -- 0:00:00
       6500 -- (-405.869) (-416.049) (-424.965) [-413.874] * (-410.924) [-410.368] (-412.715) (-417.200) -- 0:02:32
       7000 -- (-404.372) [-415.305] (-422.630) (-416.759) * (-420.436) [-418.057] (-415.243) (-414.851) -- 0:02:21
       7500 -- [-405.392] (-417.928) (-423.215) (-420.210) * (-418.353) (-414.843) [-414.320] (-414.072) -- 0:02:12
       8000 -- (-403.450) (-418.974) [-411.362] (-416.379) * (-411.433) (-419.022) [-414.480] (-418.030) -- 0:02:04
       8500 -- (-405.556) [-405.169] (-413.618) (-411.636) * (-417.510) [-412.750] (-415.675) (-417.315) -- 0:01:56
       9000 -- (-405.233) (-405.217) (-421.675) [-413.960] * [-408.842] (-410.257) (-412.999) (-414.691) -- 0:01:50
       9500 -- (-404.334) (-404.479) [-415.816] (-416.646) * (-418.405) (-414.958) (-415.657) [-410.426] -- 0:01:44
      10000 -- (-407.629) [-405.254] (-415.599) (-413.553) * (-415.956) (-415.738) [-417.044] (-413.592) -- 0:01:39

      Average standard deviation of split frequencies: 0.068300

      10500 -- [-405.567] (-405.603) (-416.920) (-411.605) * (-415.339) (-419.710) (-413.886) [-410.271] -- 0:01:34
      11000 -- (-405.268) [-407.191] (-411.209) (-417.986) * (-420.501) (-413.645) [-411.113] (-415.995) -- 0:01:29
      11500 -- (-405.152) [-405.065] (-414.138) (-413.358) * (-424.197) (-423.602) (-415.919) [-419.140] -- 0:01:25
      12000 -- (-408.481) (-406.598) (-411.902) [-408.227] * (-420.386) (-418.200) (-419.598) [-417.718] -- 0:01:22
      12500 -- [-408.370] (-405.335) (-411.776) (-419.148) * (-414.463) [-411.312] (-407.316) (-423.618) -- 0:01:19
      13000 -- (-404.956) (-404.204) (-414.570) [-410.236] * (-415.622) (-411.894) [-407.262] (-405.889) -- 0:01:15
      13500 -- (-404.454) [-405.708] (-412.389) (-424.597) * (-419.237) (-422.550) (-404.740) [-406.557] -- 0:01:13
      14000 -- (-404.526) [-413.628] (-422.584) (-413.119) * (-414.484) (-403.571) (-406.095) [-403.722] -- 0:01:10
      14500 -- (-404.742) (-412.335) (-413.923) [-412.149] * (-414.515) (-403.701) (-404.303) [-404.612] -- 0:01:07
      15000 -- (-407.396) (-406.800) [-411.770] (-408.854) * (-411.609) [-403.757] (-404.463) (-407.727) -- 0:01:05

      Average standard deviation of split frequencies: 0.058926

      15500 -- (-404.328) [-406.500] (-416.432) (-412.542) * (-419.278) [-406.472] (-405.817) (-404.883) -- 0:01:03
      16000 -- (-407.689) (-406.194) (-417.097) [-409.911] * (-425.576) (-406.031) (-407.039) [-404.013] -- 0:01:01
      16500 -- (-405.580) [-406.168] (-411.918) (-419.479) * (-412.731) (-405.385) [-406.295] (-404.172) -- 0:00:59
      17000 -- [-404.451] (-404.397) (-418.368) (-418.888) * (-405.754) [-403.884] (-408.901) (-408.814) -- 0:00:57
      17500 -- (-407.974) (-405.310) (-413.532) [-414.816] * [-406.704] (-405.555) (-407.368) (-404.930) -- 0:00:56
      18000 -- (-404.370) (-405.133) (-415.294) [-415.415] * (-408.255) (-405.895) [-404.942] (-405.301) -- 0:00:54
      18500 -- (-405.088) (-404.417) (-412.260) [-406.503] * (-405.472) (-406.036) [-407.650] (-405.026) -- 0:00:53
      19000 -- [-405.017] (-405.856) (-418.814) (-417.390) * [-404.252] (-405.787) (-404.528) (-405.614) -- 0:00:51
      19500 -- (-407.894) [-405.780] (-415.083) (-412.880) * (-404.309) (-407.432) (-412.293) [-405.195] -- 0:00:50
      20000 -- (-407.276) [-406.374] (-416.725) (-416.925) * [-404.090] (-404.153) (-407.658) (-406.827) -- 0:01:38

      Average standard deviation of split frequencies: 0.051322

      20500 -- (-405.440) [-406.356] (-413.435) (-417.770) * (-404.427) [-405.248] (-404.686) (-408.173) -- 0:01:35
      21000 -- (-405.762) [-407.964] (-412.292) (-413.218) * (-405.400) [-405.976] (-403.875) (-407.428) -- 0:01:33
      21500 -- (-407.430) [-407.351] (-404.218) (-421.841) * (-406.204) (-403.950) [-407.334] (-407.368) -- 0:01:31
      22000 -- (-406.854) (-408.882) (-404.304) [-408.396] * [-404.100] (-404.654) (-404.523) (-405.437) -- 0:01:28
      22500 -- (-405.268) (-407.066) [-405.614] (-416.601) * (-403.515) (-406.880) (-405.884) [-407.224] -- 0:01:26
      23000 -- (-404.467) [-405.677] (-404.231) (-417.502) * (-404.829) (-409.611) (-405.169) [-406.553] -- 0:01:24
      23500 -- (-403.234) [-406.072] (-406.358) (-422.232) * [-404.945] (-406.807) (-403.600) (-408.563) -- 0:01:23
      24000 -- (-404.309) (-406.824) [-403.194] (-422.780) * (-406.971) [-405.182] (-403.817) (-405.056) -- 0:01:21
      24500 -- (-404.629) (-405.808) (-403.545) [-404.313] * (-403.927) (-407.626) [-404.871] (-405.501) -- 0:01:19
      25000 -- (-405.222) [-408.303] (-403.649) (-405.750) * (-406.658) (-410.242) [-404.535] (-404.027) -- 0:01:18

      Average standard deviation of split frequencies: 0.038627

      25500 -- (-409.783) (-408.577) (-403.111) [-405.408] * (-406.672) [-406.879] (-404.061) (-405.047) -- 0:01:16
      26000 -- [-406.765] (-409.087) (-404.498) (-405.075) * (-408.117) (-404.945) (-408.293) [-404.415] -- 0:01:14
      26500 -- [-406.450] (-406.137) (-407.916) (-408.023) * (-407.486) [-405.113] (-403.862) (-404.034) -- 0:01:13
      27000 -- (-406.611) (-406.299) [-405.523] (-408.279) * (-406.944) (-404.901) (-407.243) [-406.486] -- 0:01:12
      27500 -- (-404.588) (-404.143) [-407.244] (-405.915) * (-403.451) (-406.575) [-407.467] (-404.900) -- 0:01:10
      28000 -- [-406.146] (-404.921) (-403.670) (-406.370) * [-403.157] (-408.364) (-404.622) (-406.306) -- 0:01:09
      28500 -- (-406.799) (-403.716) (-405.303) [-404.270] * [-403.226] (-406.311) (-404.708) (-408.898) -- 0:01:08
      29000 -- (-406.556) [-404.252] (-403.854) (-410.681) * [-405.005] (-403.786) (-403.691) (-405.229) -- 0:01:06
      29500 -- (-408.357) [-405.381] (-406.356) (-406.643) * (-405.145) (-404.961) [-404.855] (-404.620) -- 0:01:05
      30000 -- (-405.320) [-404.565] (-404.482) (-403.446) * (-404.774) (-407.506) [-403.746] (-406.297) -- 0:01:04

      Average standard deviation of split frequencies: 0.037332

      30500 -- (-407.601) (-405.844) [-405.461] (-410.372) * (-404.812) (-409.134) [-408.904] (-406.515) -- 0:01:03
      31000 -- (-407.011) (-405.384) (-404.508) [-406.012] * (-404.858) (-408.526) (-406.362) [-403.591] -- 0:01:02
      31500 -- (-406.237) (-406.715) (-407.556) [-408.251] * [-403.831] (-407.129) (-409.896) (-403.801) -- 0:01:01
      32000 -- (-403.998) (-406.524) [-407.887] (-406.256) * (-404.894) (-405.386) (-408.991) [-406.254] -- 0:01:00
      32500 -- (-406.462) (-410.885) [-405.120] (-405.832) * (-405.171) (-405.700) (-406.862) [-407.387] -- 0:00:59
      33000 -- (-406.536) (-410.137) (-405.112) [-403.520] * (-405.250) (-403.341) (-405.826) [-405.950] -- 0:00:58
      33500 -- (-404.289) [-407.272] (-405.844) (-404.393) * (-404.405) [-405.232] (-404.779) (-406.059) -- 0:00:57
      34000 -- [-404.245] (-406.580) (-404.041) (-405.145) * (-404.439) (-408.145) (-408.028) [-405.399] -- 0:01:25
      34500 -- (-406.312) (-407.465) [-407.166] (-407.928) * [-404.173] (-406.285) (-411.274) (-404.320) -- 0:01:23
      35000 -- (-405.407) [-404.278] (-405.148) (-406.299) * (-403.951) (-405.909) (-405.997) [-404.871] -- 0:01:22

      Average standard deviation of split frequencies: 0.038660

      35500 -- (-405.169) (-403.887) [-406.126] (-404.425) * [-403.466] (-407.465) (-403.673) (-408.218) -- 0:01:21
      36000 -- (-406.530) (-408.172) [-405.682] (-404.430) * (-408.208) [-404.612] (-409.594) (-404.734) -- 0:01:20
      36500 -- [-404.547] (-411.801) (-405.582) (-404.283) * (-410.074) (-404.733) [-403.039] (-407.025) -- 0:01:19
      37000 -- (-405.575) (-404.364) (-405.382) [-404.494] * [-407.231] (-405.962) (-405.742) (-405.123) -- 0:01:18
      37500 -- (-404.353) [-405.136] (-404.991) (-404.170) * (-404.923) (-404.818) [-405.721] (-405.808) -- 0:01:17
      38000 -- (-404.215) (-405.291) (-405.095) [-404.462] * (-403.984) (-405.266) (-405.189) [-405.688] -- 0:01:15
      38500 -- (-405.853) [-405.128] (-409.068) (-407.294) * (-406.523) (-404.490) (-406.069) [-403.941] -- 0:01:14
      39000 -- (-404.202) [-405.355] (-409.216) (-407.531) * (-405.006) [-408.009] (-405.666) (-405.047) -- 0:01:13
      39500 -- (-405.584) (-405.375) (-404.681) [-406.910] * [-403.529] (-406.717) (-408.608) (-404.222) -- 0:01:12
      40000 -- (-404.151) (-404.596) [-405.707] (-405.598) * (-404.379) [-407.496] (-408.236) (-404.929) -- 0:01:12

      Average standard deviation of split frequencies: 0.041216

      40500 -- [-407.462] (-409.041) (-405.499) (-404.744) * (-405.753) (-407.134) [-404.283] (-408.517) -- 0:01:11
      41000 -- (-403.647) (-405.224) [-405.805] (-405.003) * (-406.191) (-406.679) [-403.702] (-409.345) -- 0:01:10
      41500 -- [-403.781] (-405.313) (-405.646) (-405.930) * (-406.834) (-406.765) (-407.035) [-405.781] -- 0:01:09
      42000 -- (-407.694) (-406.102) [-405.716] (-406.672) * [-403.976] (-404.031) (-403.760) (-404.602) -- 0:01:08
      42500 -- (-405.001) [-405.861] (-406.624) (-405.452) * (-404.851) (-404.145) (-407.718) [-404.049] -- 0:01:07
      43000 -- (-404.267) (-403.517) (-407.465) [-404.112] * (-406.906) (-408.120) [-406.038] (-404.501) -- 0:01:06
      43500 -- (-404.118) (-405.656) [-410.791] (-406.716) * [-404.252] (-407.725) (-411.565) (-407.552) -- 0:01:05
      44000 -- (-404.916) [-404.790] (-404.327) (-408.178) * [-404.445] (-403.735) (-407.460) (-404.570) -- 0:01:05
      44500 -- (-405.568) (-405.748) [-405.199] (-405.296) * [-405.571] (-406.845) (-404.269) (-405.109) -- 0:01:04
      45000 -- (-403.801) (-403.276) [-404.121] (-406.093) * [-408.054] (-404.954) (-405.295) (-404.701) -- 0:01:03

      Average standard deviation of split frequencies: 0.034843

      45500 -- (-403.976) (-403.626) [-403.420] (-404.781) * [-406.009] (-404.790) (-404.821) (-403.810) -- 0:01:02
      46000 -- (-403.951) [-405.328] (-404.451) (-404.107) * (-405.403) (-404.197) [-404.981] (-405.580) -- 0:01:02
      46500 -- (-405.601) (-405.844) (-403.670) [-404.986] * (-404.274) (-408.770) [-405.003] (-405.219) -- 0:01:01
      47000 -- (-403.928) [-403.813] (-404.893) (-407.192) * [-409.132] (-406.613) (-405.812) (-406.052) -- 0:01:00
      47500 -- (-404.959) (-404.446) (-405.869) [-407.604] * (-405.960) [-406.039] (-405.622) (-404.166) -- 0:01:00
      48000 -- (-408.398) [-404.941] (-406.176) (-408.078) * (-405.010) [-403.276] (-405.063) (-404.891) -- 0:00:59
      48500 -- (-406.114) (-404.162) (-407.827) [-404.889] * [-404.720] (-403.824) (-404.401) (-407.757) -- 0:00:58
      49000 -- [-406.604] (-406.149) (-405.220) (-406.771) * (-405.383) [-405.739] (-403.797) (-407.461) -- 0:00:58
      49500 -- (-404.718) (-410.341) [-403.984] (-404.545) * (-404.995) [-405.161] (-406.592) (-404.630) -- 0:00:57
      50000 -- (-403.878) (-405.164) [-406.411] (-404.931) * [-404.964] (-406.911) (-407.494) (-408.385) -- 0:01:16

      Average standard deviation of split frequencies: 0.035149

      50500 -- (-403.385) (-404.630) (-406.783) [-404.509] * (-408.648) [-403.607] (-409.682) (-404.613) -- 0:01:15
      51000 -- (-406.420) (-406.312) (-405.469) [-405.335] * (-406.349) [-404.277] (-409.156) (-407.005) -- 0:01:14
      51500 -- (-408.387) (-408.368) [-403.807] (-408.715) * (-406.707) (-407.279) [-405.426] (-404.619) -- 0:01:13
      52000 -- (-405.960) (-403.899) [-403.866] (-405.245) * (-406.028) [-404.086] (-406.024) (-404.444) -- 0:01:12
      52500 -- (-403.426) (-406.559) [-407.383] (-406.909) * (-404.328) [-406.835] (-408.541) (-404.864) -- 0:01:12
      53000 -- (-404.839) [-407.085] (-404.357) (-407.370) * (-405.337) [-407.143] (-409.069) (-403.812) -- 0:01:11
      53500 -- (-406.908) (-406.102) (-405.162) [-404.247] * (-405.244) (-406.405) [-409.263] (-403.756) -- 0:01:10
      54000 -- (-405.019) [-404.181] (-409.421) (-405.330) * (-403.645) [-405.433] (-409.437) (-406.775) -- 0:01:10
      54500 -- (-406.426) [-404.448] (-406.761) (-405.608) * [-403.513] (-411.243) (-409.379) (-406.888) -- 0:01:09
      55000 -- (-408.566) (-406.691) [-406.894] (-405.978) * [-406.660] (-407.200) (-404.883) (-407.327) -- 0:01:08

      Average standard deviation of split frequencies: 0.035887

      55500 -- (-405.504) (-404.022) [-405.198] (-408.327) * (-404.212) [-405.817] (-406.076) (-406.322) -- 0:01:08
      56000 -- (-405.204) (-404.843) [-405.727] (-404.464) * (-405.277) (-404.442) (-404.732) [-404.711] -- 0:01:07
      56500 -- (-405.137) (-403.712) (-406.232) [-405.371] * (-407.305) (-406.642) (-406.177) [-405.224] -- 0:01:06
      57000 -- (-403.549) (-407.950) [-407.021] (-408.296) * (-405.156) [-407.798] (-404.844) (-406.402) -- 0:01:06
      57500 -- (-404.642) (-404.450) [-406.694] (-404.844) * (-403.748) [-403.477] (-405.922) (-404.982) -- 0:01:05
      58000 -- (-405.307) (-405.174) [-406.430] (-406.100) * (-409.038) (-404.385) (-407.188) [-407.974] -- 0:01:04
      58500 -- [-405.482] (-407.932) (-405.455) (-405.115) * [-404.786] (-405.493) (-407.865) (-405.561) -- 0:01:04
      59000 -- (-403.953) (-405.414) [-404.741] (-404.618) * (-405.326) (-406.215) (-408.157) [-405.090] -- 0:01:03
      59500 -- [-404.672] (-411.339) (-404.568) (-416.585) * (-403.689) [-406.317] (-411.719) (-404.113) -- 0:01:03
      60000 -- [-404.010] (-406.917) (-407.546) (-412.623) * (-404.040) (-406.754) [-407.482] (-404.071) -- 0:01:02

      Average standard deviation of split frequencies: 0.027810

      60500 -- [-406.427] (-404.890) (-404.122) (-406.235) * [-407.306] (-403.903) (-404.200) (-404.139) -- 0:01:02
      61000 -- [-406.625] (-405.630) (-403.810) (-407.880) * [-404.463] (-406.684) (-405.775) (-405.776) -- 0:01:01
      61500 -- (-405.131) (-404.501) (-407.377) [-404.490] * (-413.262) [-405.857] (-406.315) (-409.745) -- 0:01:01
      62000 -- (-408.923) [-406.809] (-407.127) (-404.079) * (-403.904) [-404.963] (-404.780) (-405.044) -- 0:01:00
      62500 -- (-405.466) [-403.833] (-404.372) (-406.860) * (-405.276) [-404.666] (-410.355) (-406.575) -- 0:01:00
      63000 -- (-407.717) (-404.145) [-404.513] (-404.175) * (-405.138) (-407.405) (-406.856) [-404.749] -- 0:00:59
      63500 -- (-403.847) [-405.660] (-409.429) (-409.074) * (-405.314) (-405.504) (-408.939) [-404.475] -- 0:00:58
      64000 -- (-404.208) [-407.857] (-408.312) (-404.216) * [-405.854] (-404.842) (-414.587) (-405.506) -- 0:00:58
      64500 -- (-404.765) (-406.656) [-404.361] (-406.558) * [-403.709] (-405.370) (-410.293) (-406.203) -- 0:00:58
      65000 -- [-405.704] (-405.176) (-406.164) (-405.079) * (-405.260) [-404.706] (-406.346) (-406.331) -- 0:00:57

      Average standard deviation of split frequencies: 0.025849

      65500 -- [-405.208] (-412.145) (-405.403) (-406.260) * (-404.048) (-406.831) [-403.767] (-409.902) -- 0:00:57
      66000 -- [-404.124] (-405.993) (-406.904) (-409.793) * (-406.100) (-405.251) (-405.803) [-405.917] -- 0:00:56
      66500 -- (-404.520) [-406.076] (-409.966) (-412.289) * [-405.193] (-404.808) (-403.815) (-404.058) -- 0:01:10
      67000 -- (-408.852) (-407.062) [-407.613] (-406.127) * (-404.945) [-406.795] (-406.152) (-405.096) -- 0:01:09
      67500 -- [-403.835] (-406.558) (-404.848) (-405.385) * (-404.379) (-410.335) [-404.665] (-405.260) -- 0:01:09
      68000 -- (-404.928) (-405.932) (-403.709) [-405.360] * [-405.854] (-406.636) (-414.915) (-406.151) -- 0:01:08
      68500 -- (-405.108) (-405.514) [-403.682] (-404.903) * (-405.322) (-405.516) (-404.430) [-405.709] -- 0:01:07
      69000 -- (-404.647) [-404.475] (-405.819) (-403.924) * (-405.441) (-405.487) (-407.210) [-407.283] -- 0:01:07
      69500 -- (-405.559) [-407.068] (-406.294) (-404.234) * (-404.671) [-405.020] (-407.223) (-406.501) -- 0:01:06
      70000 -- (-403.446) (-406.147) [-406.246] (-405.572) * (-405.909) [-405.270] (-407.317) (-404.676) -- 0:01:06

      Average standard deviation of split frequencies: 0.023348

      70500 -- [-404.951] (-404.120) (-405.330) (-404.021) * [-404.996] (-410.278) (-408.475) (-405.049) -- 0:01:05
      71000 -- (-405.538) (-404.728) [-407.548] (-404.700) * [-405.542] (-412.628) (-408.556) (-409.073) -- 0:01:05
      71500 -- (-404.126) (-403.639) [-407.497] (-405.350) * [-404.648] (-407.120) (-404.336) (-408.077) -- 0:01:04
      72000 -- (-403.610) (-404.893) (-404.742) [-407.318] * [-407.331] (-404.891) (-405.388) (-407.735) -- 0:01:04
      72500 -- (-407.757) (-408.004) [-404.816] (-406.131) * (-404.913) (-403.656) (-404.808) [-406.520] -- 0:01:03
      73000 -- (-405.619) (-408.680) (-404.136) [-403.947] * (-406.454) (-404.065) (-405.736) [-405.910] -- 0:01:03
      73500 -- (-404.606) (-404.276) (-407.438) [-404.993] * (-406.827) [-404.353] (-403.590) (-405.798) -- 0:01:03
      74000 -- (-404.642) (-405.659) (-403.996) [-406.289] * (-406.133) (-406.126) (-403.416) [-405.119] -- 0:01:02
      74500 -- [-404.689] (-406.124) (-404.090) (-404.322) * (-406.997) (-407.180) [-403.500] (-405.121) -- 0:01:02
      75000 -- (-405.338) [-407.378] (-404.880) (-406.466) * (-405.509) (-406.933) [-403.782] (-404.820) -- 0:01:01

      Average standard deviation of split frequencies: 0.022448

      75500 -- (-406.594) (-404.165) [-404.600] (-405.478) * (-407.290) (-407.419) (-404.398) [-405.160] -- 0:01:01
      76000 -- (-404.584) (-405.299) (-405.010) [-404.329] * (-408.374) [-403.640] (-403.715) (-404.945) -- 0:01:00
      76500 -- (-404.487) [-405.799] (-407.991) (-405.345) * (-406.154) [-404.466] (-405.209) (-406.199) -- 0:01:00
      77000 -- (-403.236) [-405.120] (-405.841) (-406.956) * [-404.348] (-406.459) (-404.856) (-405.030) -- 0:00:59
      77500 -- (-405.015) (-405.042) [-406.429] (-405.223) * (-404.038) (-403.525) (-408.929) [-404.434] -- 0:00:59
      78000 -- (-403.681) (-409.527) [-406.312] (-406.457) * (-405.015) (-404.912) (-410.755) [-405.144] -- 0:00:59
      78500 -- (-405.338) (-412.538) [-408.760] (-405.891) * [-406.237] (-406.557) (-410.082) (-404.821) -- 0:00:58
      79000 -- [-404.877] (-406.637) (-404.287) (-405.625) * (-409.965) (-407.847) (-404.410) [-406.796] -- 0:00:58
      79500 -- [-407.103] (-409.894) (-403.364) (-404.931) * (-406.526) [-405.821] (-409.205) (-404.819) -- 0:00:57
      80000 -- (-406.753) (-406.184) (-405.348) [-403.717] * (-405.806) [-404.187] (-404.137) (-407.251) -- 0:00:57

      Average standard deviation of split frequencies: 0.024298

      80500 -- (-405.356) [-405.869] (-405.178) (-403.926) * (-408.258) (-403.255) [-403.582] (-403.987) -- 0:00:57
      81000 -- [-404.463] (-409.821) (-406.130) (-406.204) * (-405.798) (-403.898) (-403.643) [-407.138] -- 0:00:56
      81500 -- (-405.613) (-407.378) (-403.643) [-406.463] * (-405.134) (-407.387) (-407.778) [-406.081] -- 0:00:56
      82000 -- (-407.175) (-405.037) (-405.022) [-406.376] * (-404.595) [-406.221] (-408.380) (-403.696) -- 0:00:55
      82500 -- (-407.201) [-407.841] (-411.396) (-406.291) * [-404.185] (-403.821) (-407.439) (-407.107) -- 0:00:55
      83000 -- (-407.773) (-404.633) (-404.174) [-405.896] * (-404.094) (-406.009) [-409.679] (-406.797) -- 0:00:55
      83500 -- (-406.644) (-404.098) [-403.792] (-405.081) * (-409.440) [-406.946] (-404.331) (-404.774) -- 0:01:05
      84000 -- (-404.938) [-405.668] (-404.050) (-404.699) * (-411.521) (-406.043) (-405.205) [-403.749] -- 0:01:05
      84500 -- (-405.180) [-404.826] (-405.199) (-409.752) * (-405.183) (-408.435) (-406.738) [-404.025] -- 0:01:05
      85000 -- (-413.130) (-404.251) [-409.381] (-404.539) * (-403.287) (-407.508) (-405.946) [-403.985] -- 0:01:04

      Average standard deviation of split frequencies: 0.027407

      85500 -- (-410.907) [-403.855] (-408.088) (-404.455) * [-403.997] (-407.630) (-404.274) (-404.618) -- 0:01:04
      86000 -- (-406.264) (-405.642) (-404.961) [-405.280] * (-409.873) [-406.280] (-408.365) (-413.268) -- 0:01:03
      86500 -- (-407.720) (-406.560) (-407.287) [-404.083] * (-410.181) (-404.275) [-403.507] (-409.341) -- 0:01:03
      87000 -- (-405.364) (-405.020) [-407.766] (-409.766) * (-407.610) (-403.223) [-405.366] (-404.120) -- 0:01:02
      87500 -- (-405.758) [-405.211] (-407.143) (-403.491) * (-410.776) (-407.929) [-405.137] (-403.883) -- 0:01:02
      88000 -- (-407.852) (-405.388) [-406.638] (-404.654) * (-406.347) (-406.128) [-404.331] (-407.707) -- 0:01:02
      88500 -- [-404.274] (-407.798) (-404.562) (-404.662) * (-407.339) (-407.115) [-405.604] (-406.964) -- 0:01:01
      89000 -- (-408.125) (-405.092) (-404.194) [-406.385] * (-404.503) [-405.579] (-405.390) (-405.917) -- 0:01:01
      89500 -- (-407.954) (-407.339) [-404.686] (-404.523) * (-406.654) (-404.848) [-406.280] (-406.831) -- 0:01:01
      90000 -- [-405.332] (-405.929) (-408.174) (-404.546) * (-409.014) [-403.885] (-409.009) (-406.773) -- 0:01:00

      Average standard deviation of split frequencies: 0.026517

      90500 -- (-404.835) [-404.602] (-405.796) (-404.575) * (-406.944) (-403.474) [-403.982] (-405.436) -- 0:01:00
      91000 -- (-403.863) (-406.010) (-406.314) [-404.170] * (-408.139) [-405.156] (-404.582) (-404.431) -- 0:00:59
      91500 -- (-405.967) (-408.204) [-404.774] (-404.008) * (-406.151) (-406.184) [-406.505] (-406.436) -- 0:00:59
      92000 -- [-406.519] (-405.056) (-405.784) (-405.608) * (-405.445) (-406.926) [-409.342] (-406.672) -- 0:00:59
      92500 -- (-413.427) (-404.315) (-406.684) [-405.464] * (-405.180) (-405.357) [-404.898] (-405.190) -- 0:00:58
      93000 -- (-409.934) (-407.858) [-404.652] (-404.325) * (-406.757) (-403.476) (-403.409) [-404.978] -- 0:00:58
      93500 -- [-406.555] (-405.828) (-407.635) (-407.135) * (-405.721) (-404.622) [-403.714] (-404.499) -- 0:00:58
      94000 -- (-409.597) [-407.685] (-405.319) (-404.883) * [-403.519] (-405.074) (-403.918) (-404.197) -- 0:00:57
      94500 -- (-406.051) [-406.076] (-404.388) (-409.208) * (-405.650) [-406.509] (-405.987) (-404.743) -- 0:00:57
      95000 -- (-405.825) [-404.670] (-404.158) (-404.234) * (-405.246) [-406.367] (-405.048) (-404.154) -- 0:00:57

      Average standard deviation of split frequencies: 0.025043

      95500 -- (-408.156) (-407.895) (-406.720) [-406.252] * (-405.391) [-404.720] (-406.625) (-405.172) -- 0:00:56
      96000 -- [-404.991] (-406.949) (-406.917) (-410.767) * (-407.854) (-407.552) (-407.729) [-405.397] -- 0:00:56
      96500 -- (-407.356) (-404.103) (-409.191) [-404.978] * [-406.173] (-406.791) (-408.744) (-406.701) -- 0:00:56
      97000 -- [-407.056] (-404.078) (-407.930) (-405.255) * (-404.257) (-405.254) (-403.695) [-403.552] -- 0:00:55
      97500 -- (-403.888) (-403.857) (-406.425) [-404.023] * (-406.066) (-409.035) [-403.657] (-406.138) -- 0:00:55
      98000 -- (-406.773) (-404.815) (-406.356) [-403.597] * (-406.087) [-404.601] (-406.819) (-406.408) -- 0:00:55
      98500 -- [-403.693] (-405.158) (-405.563) (-408.463) * (-406.971) (-406.677) [-411.679] (-408.224) -- 0:00:54
      99000 -- (-405.876) (-404.178) (-405.251) [-406.041] * (-406.885) [-406.029] (-408.984) (-410.404) -- 0:00:54
      99500 -- [-405.579] (-404.283) (-405.690) (-410.345) * (-405.040) (-403.404) [-408.132] (-407.168) -- 0:00:54
      100000 -- (-404.922) (-405.780) [-404.697] (-406.462) * (-404.491) [-405.272] (-406.512) (-406.794) -- 0:01:02

      Average standard deviation of split frequencies: 0.022921

      100500 -- (-408.132) [-404.032] (-405.450) (-405.233) * (-404.988) (-403.881) (-410.398) [-405.628] -- 0:01:02
      101000 -- (-406.759) (-404.632) (-403.660) [-405.295] * [-407.495] (-403.976) (-406.411) (-410.437) -- 0:01:02
      101500 -- (-405.757) [-405.895] (-408.490) (-404.859) * (-407.408) (-406.546) (-404.202) [-407.391] -- 0:01:01
      102000 -- [-405.192] (-406.749) (-405.656) (-406.811) * (-406.678) (-405.716) [-404.200] (-410.295) -- 0:01:01
      102500 -- (-406.041) (-403.634) (-405.495) [-408.460] * (-405.401) (-404.872) [-403.272] (-408.639) -- 0:01:01
      103000 -- [-403.692] (-406.192) (-404.215) (-406.774) * (-405.072) (-404.566) [-403.389] (-405.939) -- 0:01:00
      103500 -- (-403.822) (-404.680) [-405.252] (-407.090) * (-411.863) (-407.252) (-403.802) [-407.734] -- 0:01:00
      104000 -- (-405.156) [-405.057] (-408.872) (-405.950) * (-405.293) (-403.892) [-405.385] (-407.495) -- 0:01:00
      104500 -- (-405.008) (-408.193) [-404.713] (-405.004) * (-408.420) [-407.601] (-408.554) (-404.613) -- 0:00:59
      105000 -- (-407.558) (-410.935) (-403.983) [-406.311] * [-404.566] (-404.683) (-409.189) (-403.754) -- 0:00:59

      Average standard deviation of split frequencies: 0.024904

      105500 -- [-405.914] (-408.442) (-405.455) (-406.588) * (-406.775) (-404.699) (-409.104) [-404.547] -- 0:00:59
      106000 -- (-404.891) [-405.886] (-405.398) (-406.494) * (-405.967) (-404.991) (-406.224) [-405.357] -- 0:00:59
      106500 -- [-404.229] (-406.037) (-404.798) (-405.171) * (-405.326) [-406.494] (-404.746) (-408.148) -- 0:00:58
      107000 -- (-403.782) (-406.306) (-404.375) [-405.433] * (-404.760) (-409.839) (-404.209) [-403.577] -- 0:00:58
      107500 -- (-404.459) (-407.921) [-404.587] (-407.657) * (-404.898) (-404.909) (-407.401) [-403.707] -- 0:00:58
      108000 -- (-406.976) [-404.162] (-403.719) (-404.646) * (-409.285) [-406.617] (-406.650) (-404.202) -- 0:00:57
      108500 -- (-403.960) (-403.756) (-403.370) [-404.005] * (-406.662) (-408.005) (-404.265) [-403.818] -- 0:00:57
      109000 -- (-406.933) [-408.691] (-405.004) (-405.395) * (-407.565) (-407.571) [-405.077] (-405.001) -- 0:00:57
      109500 -- [-404.242] (-405.904) (-404.949) (-408.501) * (-403.809) (-407.430) (-404.854) [-405.718] -- 0:00:56
      110000 -- (-405.402) (-404.864) [-404.303] (-408.439) * (-405.678) [-404.322] (-408.091) (-404.573) -- 0:00:56

      Average standard deviation of split frequencies: 0.023215

      110500 -- (-403.952) [-405.633] (-406.606) (-403.444) * [-405.317] (-403.750) (-404.734) (-410.530) -- 0:00:56
      111000 -- (-409.840) (-409.456) (-403.670) [-403.981] * (-403.606) [-404.967] (-405.894) (-409.806) -- 0:00:56
      111500 -- (-407.355) (-405.688) [-405.453] (-404.388) * (-406.081) (-404.089) [-408.298] (-404.191) -- 0:00:55
      112000 -- (-406.360) (-404.225) [-405.202] (-404.313) * [-406.008] (-405.304) (-410.515) (-407.272) -- 0:00:55
      112500 -- [-406.089] (-407.862) (-405.087) (-406.068) * (-403.512) (-408.183) [-404.876] (-405.259) -- 0:00:55
      113000 -- (-406.412) (-404.227) [-406.268] (-403.626) * [-408.260] (-407.211) (-407.168) (-407.659) -- 0:00:54
      113500 -- (-405.755) [-404.394] (-403.717) (-404.484) * (-407.765) (-405.520) [-404.095] (-407.585) -- 0:00:54
      114000 -- (-405.599) (-406.225) (-407.215) [-405.800] * (-407.553) (-403.955) [-405.469] (-406.518) -- 0:00:54
      114500 -- [-403.955] (-406.480) (-406.672) (-404.067) * (-407.679) (-408.428) [-405.601] (-407.368) -- 0:00:54
      115000 -- (-407.640) (-406.021) (-403.407) [-407.968] * (-405.510) [-403.149] (-406.504) (-405.934) -- 0:00:53

      Average standard deviation of split frequencies: 0.021816

      115500 -- (-404.893) (-405.644) [-408.454] (-407.732) * [-405.468] (-404.596) (-405.384) (-403.677) -- 0:01:01
      116000 -- (-404.733) (-409.916) (-407.966) [-405.689] * (-405.041) [-407.846] (-406.993) (-406.227) -- 0:01:00
      116500 -- (-404.604) (-404.628) [-406.431] (-405.396) * (-405.931) [-405.730] (-410.297) (-404.502) -- 0:01:00
      117000 -- (-405.269) (-405.999) [-406.066] (-404.640) * (-407.337) (-404.122) (-406.225) [-405.539] -- 0:01:00
      117500 -- (-404.470) [-405.526] (-406.129) (-405.110) * (-405.199) [-404.781] (-410.236) (-406.824) -- 0:01:00
      118000 -- (-405.403) (-404.056) [-404.945] (-405.412) * (-406.227) (-404.798) [-404.317] (-406.916) -- 0:00:59
      118500 -- (-405.919) [-404.443] (-406.688) (-405.057) * (-406.096) [-406.459] (-405.298) (-407.520) -- 0:00:59
      119000 -- (-405.135) (-404.747) (-404.275) [-404.240] * (-403.909) (-406.327) [-406.323] (-405.046) -- 0:00:59
      119500 -- [-405.687] (-406.030) (-404.146) (-405.297) * (-406.351) (-407.440) [-405.102] (-407.262) -- 0:00:58
      120000 -- (-406.550) [-403.503] (-403.871) (-404.453) * (-405.188) [-407.117] (-405.436) (-404.446) -- 0:00:58

      Average standard deviation of split frequencies: 0.023029

      120500 -- [-407.666] (-403.923) (-404.231) (-405.471) * [-404.678] (-404.532) (-409.794) (-405.758) -- 0:00:58
      121000 -- (-406.206) (-404.012) [-406.262] (-407.665) * [-405.196] (-403.810) (-406.350) (-407.388) -- 0:00:58
      121500 -- (-413.605) [-405.148] (-405.051) (-405.146) * [-404.530] (-407.161) (-413.070) (-406.240) -- 0:00:57
      122000 -- (-406.562) [-405.396] (-403.575) (-403.841) * (-405.999) (-407.427) (-405.732) [-404.240] -- 0:00:57
      122500 -- (-407.266) (-408.523) (-406.828) [-404.589] * [-404.654] (-408.095) (-405.028) (-405.252) -- 0:00:57
      123000 -- (-405.407) (-409.249) (-404.258) [-403.693] * (-403.712) (-405.259) (-404.907) [-404.575] -- 0:00:57
      123500 -- (-404.945) [-405.235] (-404.911) (-403.940) * [-404.205] (-406.791) (-404.282) (-404.229) -- 0:00:56
      124000 -- (-406.480) (-408.789) [-405.169] (-405.298) * (-408.260) (-405.877) (-403.909) [-405.499] -- 0:00:56
      124500 -- (-405.472) (-405.694) [-405.098] (-405.007) * [-409.170] (-408.075) (-403.845) (-406.829) -- 0:00:56
      125000 -- [-408.622] (-404.366) (-404.291) (-409.474) * (-410.790) (-410.019) (-407.876) [-405.254] -- 0:00:56

      Average standard deviation of split frequencies: 0.023039

      125500 -- (-404.953) (-405.452) (-404.279) [-409.710] * (-404.681) (-404.877) (-407.785) [-403.671] -- 0:00:55
      126000 -- (-403.734) (-406.988) [-406.639] (-406.687) * (-404.731) (-407.522) [-406.136] (-404.257) -- 0:00:55
      126500 -- (-407.367) [-405.154] (-408.503) (-404.971) * (-405.916) (-405.264) [-403.267] (-405.994) -- 0:00:55
      127000 -- [-406.113] (-404.616) (-404.641) (-406.704) * (-408.334) [-408.176] (-406.603) (-406.205) -- 0:00:54
      127500 -- (-403.412) (-405.761) [-405.385] (-405.256) * (-405.090) (-408.276) (-406.755) [-404.954] -- 0:00:54
      128000 -- (-405.433) (-404.324) [-405.315] (-407.831) * (-403.989) (-406.237) [-406.055] (-404.246) -- 0:00:54
      128500 -- (-404.915) [-405.040] (-405.851) (-405.778) * (-405.788) (-405.206) (-406.763) [-406.199] -- 0:01:01
      129000 -- (-405.560) (-404.481) (-403.763) [-404.633] * (-405.055) (-404.968) [-409.355] (-403.648) -- 0:01:00
      129500 -- (-404.323) (-404.282) [-407.019] (-406.542) * [-405.839] (-403.938) (-409.787) (-403.810) -- 0:01:00
      130000 -- (-403.784) [-406.743] (-404.108) (-405.803) * (-406.116) (-404.737) [-409.194] (-403.563) -- 0:01:00

      Average standard deviation of split frequencies: 0.023250

      130500 -- (-408.166) (-406.011) [-403.877] (-406.888) * (-413.824) (-404.330) [-405.200] (-403.882) -- 0:00:59
      131000 -- (-407.236) [-410.990] (-407.942) (-409.243) * (-404.839) (-403.060) [-406.585] (-404.129) -- 0:00:59
      131500 -- (-404.463) (-404.674) (-404.579) [-405.711] * (-404.877) (-404.163) (-405.028) [-405.310] -- 0:00:59
      132000 -- (-404.602) (-405.163) (-404.932) [-405.625] * [-403.574] (-406.110) (-407.490) (-406.806) -- 0:00:59
      132500 -- [-409.081] (-405.279) (-405.097) (-403.393) * (-407.777) [-404.994] (-405.580) (-404.547) -- 0:00:58
      133000 -- (-404.640) (-406.505) [-404.724] (-404.451) * (-406.497) (-405.247) [-414.017] (-404.592) -- 0:00:58
      133500 -- (-404.555) [-404.348] (-406.846) (-405.213) * (-407.673) [-404.251] (-405.325) (-404.977) -- 0:00:58
      134000 -- [-405.941] (-407.820) (-405.202) (-406.901) * (-403.823) (-404.339) (-408.713) [-404.055] -- 0:00:58
      134500 -- (-405.952) [-404.776] (-404.308) (-405.833) * [-405.290] (-403.877) (-407.386) (-408.898) -- 0:00:57
      135000 -- (-404.813) (-404.158) (-406.406) [-408.498] * [-403.209] (-403.755) (-408.925) (-404.118) -- 0:00:57

      Average standard deviation of split frequencies: 0.024263

      135500 -- (-404.329) [-408.107] (-405.999) (-405.810) * [-403.702] (-404.565) (-407.904) (-406.793) -- 0:00:57
      136000 -- (-409.720) (-414.118) (-403.775) [-404.347] * [-404.052] (-406.094) (-404.469) (-405.234) -- 0:00:57
      136500 -- [-405.977] (-404.987) (-403.745) (-403.990) * (-408.468) (-406.917) (-403.583) [-404.829] -- 0:00:56
      137000 -- (-405.309) (-403.595) (-404.808) [-406.015] * [-407.228] (-403.674) (-404.277) (-405.233) -- 0:00:56
      137500 -- (-406.604) (-403.731) [-403.829] (-409.046) * [-404.865] (-403.579) (-411.776) (-404.130) -- 0:00:56
      138000 -- (-406.577) (-410.763) (-403.668) [-405.832] * (-403.563) (-406.996) (-404.881) [-403.201] -- 0:00:56
      138500 -- (-410.082) (-405.635) (-405.187) [-404.790] * [-405.391] (-403.851) (-405.150) (-403.816) -- 0:00:55
      139000 -- [-406.746] (-404.970) (-404.068) (-410.099) * (-405.779) [-404.370] (-406.466) (-406.500) -- 0:00:55
      139500 -- (-404.679) [-405.231] (-403.909) (-404.462) * [-406.483] (-405.074) (-404.574) (-410.541) -- 0:00:55
      140000 -- (-404.395) [-404.516] (-405.793) (-407.092) * (-404.852) [-403.972] (-408.144) (-403.804) -- 0:00:55

      Average standard deviation of split frequencies: 0.023272

      140500 -- (-407.303) [-406.416] (-404.799) (-407.759) * (-404.220) [-405.072] (-406.213) (-403.788) -- 0:00:55
      141000 -- [-407.388] (-404.567) (-405.768) (-405.646) * (-404.296) (-404.204) [-405.324] (-406.204) -- 0:00:54
      141500 -- (-408.963) (-404.712) [-407.521] (-406.206) * [-405.147] (-407.641) (-408.404) (-406.983) -- 0:00:54
      142000 -- (-406.055) (-406.252) (-405.307) [-404.760] * (-405.695) (-405.918) [-404.469] (-407.739) -- 0:00:54
      142500 -- (-406.036) (-404.899) (-407.369) [-404.713] * (-406.542) [-405.638] (-404.184) (-411.674) -- 0:00:54
      143000 -- (-404.021) (-410.826) (-410.482) [-408.711] * (-405.134) (-403.392) (-406.682) [-407.876] -- 0:00:59
      143500 -- (-403.348) (-415.027) [-407.757] (-404.608) * (-404.013) [-407.050] (-407.121) (-404.718) -- 0:00:59
      144000 -- [-403.354] (-404.927) (-406.033) (-404.358) * (-403.549) [-405.614] (-406.355) (-409.482) -- 0:00:59
      144500 -- (-403.189) (-406.746) [-404.960] (-405.810) * (-403.318) (-409.310) (-404.870) [-406.747] -- 0:00:59
      145000 -- (-405.165) [-406.568] (-414.101) (-409.952) * (-406.392) (-404.295) [-408.391] (-407.194) -- 0:00:58

      Average standard deviation of split frequencies: 0.022781

      145500 -- [-405.227] (-405.723) (-416.642) (-403.120) * (-405.553) [-405.436] (-407.700) (-404.865) -- 0:00:58
      146000 -- (-406.427) (-404.369) [-409.366] (-412.379) * [-404.998] (-407.028) (-407.659) (-404.986) -- 0:00:58
      146500 -- (-406.444) (-410.610) (-409.096) [-406.109] * (-403.826) (-407.073) [-404.793] (-405.623) -- 0:00:58
      147000 -- (-405.617) (-406.303) (-405.189) [-405.694] * (-403.510) (-405.503) (-405.948) [-406.083] -- 0:00:58
      147500 -- (-405.600) (-403.626) [-403.225] (-403.343) * [-407.687] (-405.280) (-405.116) (-405.450) -- 0:00:57
      148000 -- (-405.727) (-404.700) (-403.302) [-405.694] * (-406.534) [-404.111] (-404.302) (-404.106) -- 0:00:57
      148500 -- (-407.094) (-403.900) (-404.840) [-404.390] * [-408.484] (-405.934) (-404.082) (-404.542) -- 0:00:57
      149000 -- (-403.941) (-404.157) (-408.470) [-404.998] * (-405.254) (-406.898) [-404.368] (-406.080) -- 0:00:57
      149500 -- (-404.522) [-404.902] (-403.610) (-405.975) * (-403.964) (-405.539) (-406.086) [-407.287] -- 0:00:56
      150000 -- [-403.986] (-405.369) (-403.802) (-405.475) * (-406.867) (-405.117) (-414.279) [-404.506] -- 0:00:56

      Average standard deviation of split frequencies: 0.023118

      150500 -- (-407.484) (-404.089) (-405.210) [-404.191] * (-405.825) [-406.940] (-406.887) (-405.551) -- 0:00:56
      151000 -- (-407.226) (-406.403) [-403.421] (-404.642) * (-407.655) (-404.752) (-405.264) [-406.033] -- 0:00:56
      151500 -- (-407.518) (-404.788) (-405.831) [-403.322] * (-406.684) (-405.171) [-405.055] (-412.880) -- 0:00:56
      152000 -- (-405.972) (-405.366) [-408.794] (-405.827) * (-410.152) (-404.724) [-403.560] (-408.442) -- 0:00:55
      152500 -- (-407.373) [-404.272] (-404.226) (-409.810) * (-404.059) (-405.911) (-405.065) [-406.869] -- 0:00:55
      153000 -- [-404.411] (-405.390) (-407.382) (-411.153) * (-404.359) [-404.786] (-403.699) (-404.448) -- 0:00:55
      153500 -- (-406.011) (-409.969) [-409.316] (-410.438) * (-405.536) [-403.758] (-403.277) (-404.324) -- 0:00:55
      154000 -- (-404.121) [-405.134] (-408.205) (-406.881) * (-405.068) (-404.421) [-403.521] (-404.938) -- 0:00:54
      154500 -- (-405.599) [-407.240] (-406.434) (-405.806) * (-405.164) [-404.588] (-404.465) (-404.406) -- 0:00:54
      155000 -- [-404.324] (-404.838) (-403.398) (-406.254) * (-413.824) [-403.208] (-406.842) (-408.149) -- 0:00:54

      Average standard deviation of split frequencies: 0.021992

      155500 -- [-403.716] (-405.619) (-403.913) (-405.568) * (-410.108) (-408.542) [-406.019] (-405.918) -- 0:00:54
      156000 -- (-405.215) (-405.604) (-404.913) [-404.161] * (-406.997) [-405.449] (-404.487) (-409.156) -- 0:00:54
      156500 -- (-405.773) [-406.067] (-404.568) (-406.094) * (-405.415) [-407.557] (-404.093) (-405.568) -- 0:00:53
      157000 -- (-404.553) (-405.591) [-404.285] (-404.058) * (-405.719) (-411.855) [-404.704] (-404.886) -- 0:00:53
      157500 -- [-407.089] (-403.534) (-405.349) (-405.374) * (-404.788) (-404.013) (-404.018) [-403.501] -- 0:00:53
      158000 -- [-409.616] (-405.658) (-405.386) (-404.058) * (-406.019) (-406.771) [-403.893] (-403.591) -- 0:00:53
      158500 -- (-406.596) [-404.674] (-410.166) (-404.749) * (-406.516) (-406.001) (-405.074) [-405.926] -- 0:00:53
      159000 -- (-403.701) [-406.144] (-403.592) (-408.863) * (-407.046) (-405.325) (-405.199) [-405.783] -- 0:00:52
      159500 -- [-403.035] (-403.854) (-403.788) (-405.801) * (-405.542) (-407.613) (-404.049) [-404.775] -- 0:00:57
      160000 -- (-403.301) (-405.910) [-404.732] (-404.708) * (-404.721) (-408.495) (-405.456) [-406.106] -- 0:00:57

      Average standard deviation of split frequencies: 0.021353

      160500 -- [-405.750] (-408.563) (-404.946) (-405.529) * (-407.809) [-404.139] (-405.556) (-408.586) -- 0:00:57
      161000 -- (-403.552) (-404.463) (-404.424) [-404.547] * (-408.925) [-404.176] (-404.481) (-405.424) -- 0:00:57
      161500 -- (-406.117) (-408.007) (-405.311) [-405.629] * (-404.339) [-410.660] (-406.472) (-405.240) -- 0:00:57
      162000 -- (-405.117) (-405.946) [-405.822] (-404.427) * [-408.027] (-404.904) (-406.263) (-408.128) -- 0:00:56
      162500 -- (-407.236) (-405.294) [-403.783] (-404.177) * (-403.554) [-404.248] (-405.683) (-409.224) -- 0:00:56
      163000 -- (-404.222) (-405.427) (-404.304) [-406.281] * (-404.843) [-405.072] (-404.609) (-405.487) -- 0:00:56
      163500 -- (-405.104) [-407.947] (-406.797) (-406.366) * (-403.471) (-403.690) [-403.234] (-406.587) -- 0:00:56
      164000 -- (-406.094) (-407.679) (-407.340) [-406.568] * (-405.247) [-405.625] (-403.660) (-405.864) -- 0:00:56
      164500 -- (-406.059) [-404.693] (-407.068) (-405.942) * (-409.490) (-407.104) [-405.314] (-405.426) -- 0:00:55
      165000 -- (-406.994) (-407.420) (-405.504) [-404.177] * (-405.461) [-404.429] (-404.553) (-405.058) -- 0:00:55

      Average standard deviation of split frequencies: 0.020825

      165500 -- (-406.242) (-409.345) [-405.228] (-403.240) * (-408.596) (-406.152) [-404.888] (-406.952) -- 0:00:55
      166000 -- (-405.953) (-404.857) [-404.471] (-404.915) * (-408.908) [-405.620] (-404.241) (-407.201) -- 0:00:55
      166500 -- [-408.946] (-407.273) (-407.283) (-406.942) * (-405.506) (-406.533) [-404.412] (-405.639) -- 0:00:55
      167000 -- (-405.490) (-404.830) (-405.479) [-404.814] * (-408.392) (-403.999) [-405.344] (-404.899) -- 0:00:54
      167500 -- (-406.529) [-404.182] (-405.096) (-406.890) * [-406.382] (-407.213) (-406.494) (-405.723) -- 0:00:54
      168000 -- [-405.085] (-403.597) (-404.408) (-409.108) * (-404.302) (-403.967) (-405.632) [-405.175] -- 0:00:54
      168500 -- (-405.694) (-405.605) (-407.467) [-408.598] * (-405.947) (-404.254) [-405.449] (-406.033) -- 0:00:54
      169000 -- (-404.935) (-404.524) [-404.027] (-407.552) * [-406.123] (-404.644) (-405.094) (-408.182) -- 0:00:54
      169500 -- (-405.813) [-404.458] (-405.059) (-405.211) * [-407.162] (-406.589) (-405.685) (-404.720) -- 0:00:53
      170000 -- (-406.594) (-405.296) (-407.281) [-405.153] * [-408.624] (-404.181) (-405.309) (-403.975) -- 0:00:53

      Average standard deviation of split frequencies: 0.020409

      170500 -- (-409.717) [-404.281] (-407.580) (-403.884) * (-405.242) (-405.686) (-407.996) [-404.949] -- 0:00:53
      171000 -- (-407.251) (-405.535) [-410.131] (-404.511) * (-405.013) (-406.337) (-408.756) [-405.650] -- 0:00:53
      171500 -- [-405.235] (-404.893) (-408.212) (-409.892) * (-405.104) (-407.380) (-404.585) [-404.098] -- 0:00:53
      172000 -- (-404.798) (-404.775) [-404.960] (-404.389) * (-404.301) [-405.369] (-404.993) (-408.437) -- 0:00:52
      172500 -- (-407.213) (-405.260) (-406.145) [-404.825] * (-405.827) (-404.161) (-405.497) [-403.691] -- 0:00:52
      173000 -- (-406.465) [-407.696] (-404.868) (-406.960) * (-405.721) (-404.433) (-407.126) [-406.148] -- 0:00:52
      173500 -- (-405.110) (-405.506) [-405.538] (-406.163) * (-407.958) [-405.123] (-406.783) (-406.845) -- 0:00:52
      174000 -- (-403.863) (-406.019) [-403.828] (-405.267) * [-405.333] (-404.350) (-405.627) (-403.740) -- 0:00:52
      174500 -- (-403.629) (-405.154) [-403.507] (-408.544) * [-405.850] (-405.184) (-408.467) (-405.313) -- 0:00:52
      175000 -- [-405.407] (-406.202) (-406.062) (-406.379) * (-410.343) (-407.134) (-407.114) [-404.445] -- 0:00:51

      Average standard deviation of split frequencies: 0.020088

      175500 -- (-408.710) (-405.225) [-403.844] (-406.703) * (-407.929) (-405.763) (-413.047) [-414.774] -- 0:00:51
      176000 -- [-405.509] (-405.797) (-406.493) (-407.395) * [-406.031] (-403.241) (-406.429) (-406.414) -- 0:00:51
      176500 -- (-405.380) [-407.506] (-405.809) (-404.530) * [-407.905] (-409.507) (-406.249) (-405.702) -- 0:00:55
      177000 -- (-405.014) (-404.380) (-410.884) [-404.427] * (-406.683) [-409.598] (-404.246) (-408.025) -- 0:00:55
      177500 -- [-405.834] (-403.692) (-405.687) (-405.207) * (-403.853) (-404.462) (-404.922) [-404.912] -- 0:00:55
      178000 -- (-405.460) (-405.634) (-407.316) [-403.150] * [-405.972] (-404.601) (-409.350) (-403.730) -- 0:00:55
      178500 -- [-409.894] (-411.860) (-405.951) (-407.409) * (-405.264) (-404.564) [-405.353] (-409.401) -- 0:00:55
      179000 -- [-405.588] (-407.710) (-407.439) (-408.739) * [-406.415] (-407.094) (-405.595) (-406.199) -- 0:00:55
      179500 -- (-403.396) (-403.820) (-408.912) [-405.803] * (-406.243) (-408.274) [-404.687] (-403.314) -- 0:00:54
      180000 -- (-406.613) (-405.454) [-405.866] (-403.804) * [-403.405] (-406.778) (-403.751) (-406.796) -- 0:00:54

      Average standard deviation of split frequencies: 0.018700

      180500 -- (-408.443) (-408.038) (-411.821) [-404.380] * (-405.398) [-406.957] (-405.938) (-406.459) -- 0:00:54
      181000 -- (-405.807) [-406.309] (-405.144) (-406.154) * [-409.216] (-404.834) (-412.636) (-405.054) -- 0:00:54
      181500 -- [-404.043] (-406.266) (-406.004) (-403.868) * (-408.414) (-404.830) (-411.127) [-404.493] -- 0:00:54
      182000 -- (-408.414) [-404.563] (-403.602) (-405.456) * [-404.242] (-403.535) (-409.185) (-403.976) -- 0:00:53
      182500 -- [-406.355] (-408.976) (-406.186) (-405.708) * [-404.372] (-405.391) (-406.247) (-405.802) -- 0:00:53
      183000 -- [-404.298] (-406.880) (-406.433) (-405.721) * (-406.803) (-411.289) [-406.871] (-407.485) -- 0:00:53
      183500 -- [-406.384] (-405.622) (-403.930) (-405.621) * [-406.909] (-411.463) (-408.860) (-409.425) -- 0:00:53
      184000 -- [-405.443] (-410.226) (-406.052) (-404.446) * (-406.588) (-406.257) (-405.900) [-407.018] -- 0:00:53
      184500 -- [-403.857] (-405.905) (-405.933) (-407.029) * [-403.863] (-410.859) (-404.740) (-408.740) -- 0:00:53
      185000 -- (-404.315) (-403.845) [-408.533] (-407.844) * (-405.278) (-406.346) (-404.989) [-404.532] -- 0:00:52

      Average standard deviation of split frequencies: 0.019149

      185500 -- [-408.929] (-403.480) (-405.836) (-404.251) * (-412.382) [-408.908] (-406.175) (-405.086) -- 0:00:52
      186000 -- (-409.718) (-405.670) [-403.672] (-409.246) * (-405.132) (-403.594) [-403.623] (-405.859) -- 0:00:52
      186500 -- [-404.902] (-406.295) (-404.828) (-407.878) * (-407.456) (-406.502) (-405.529) [-406.581] -- 0:00:52
      187000 -- [-408.165] (-404.002) (-404.407) (-404.448) * (-403.328) (-404.846) [-404.045] (-406.830) -- 0:00:52
      187500 -- [-405.213] (-403.936) (-405.937) (-407.114) * [-405.451] (-404.778) (-406.730) (-406.770) -- 0:00:52
      188000 -- [-408.256] (-404.031) (-406.323) (-406.537) * (-405.270) [-404.003] (-407.885) (-403.410) -- 0:00:51
      188500 -- (-404.330) [-406.335] (-405.420) (-407.603) * (-409.228) (-407.261) (-408.588) [-404.387] -- 0:00:51
      189000 -- (-404.049) [-405.557] (-404.512) (-405.669) * (-407.326) [-403.588] (-408.844) (-404.367) -- 0:00:51
      189500 -- [-407.998] (-405.300) (-405.403) (-419.331) * (-404.547) [-403.954] (-408.455) (-406.966) -- 0:00:51
      190000 -- (-406.274) (-405.701) [-405.091] (-404.683) * (-409.355) [-404.338] (-405.578) (-406.329) -- 0:00:51

      Average standard deviation of split frequencies: 0.018608

      190500 -- (-405.321) (-408.895) [-407.732] (-404.867) * [-404.298] (-410.131) (-406.759) (-407.653) -- 0:00:50
      191000 -- [-409.042] (-403.435) (-405.059) (-404.869) * (-404.756) (-414.431) [-407.374] (-403.303) -- 0:00:50
      191500 -- [-410.192] (-403.601) (-407.133) (-405.440) * (-403.602) [-409.696] (-406.766) (-404.201) -- 0:00:50
      192000 -- (-406.984) (-405.918) (-406.628) [-406.522] * (-403.640) (-405.809) [-403.666] (-404.077) -- 0:00:50
      192500 -- (-404.990) [-405.016] (-404.909) (-403.520) * (-403.520) (-403.244) (-405.740) [-409.931] -- 0:00:50
      193000 -- [-404.444] (-408.066) (-407.420) (-409.098) * (-403.888) [-404.119] (-404.932) (-405.151) -- 0:00:50
      193500 -- (-404.131) (-405.237) [-405.930] (-409.085) * (-408.287) (-405.863) [-408.739] (-404.175) -- 0:00:50
      194000 -- (-403.494) (-404.725) [-404.490] (-409.898) * (-406.184) (-406.695) (-404.585) [-405.693] -- 0:00:54
      194500 -- (-406.916) (-406.023) [-404.833] (-406.138) * (-404.455) (-403.406) (-405.644) [-405.649] -- 0:00:53
      195000 -- (-409.750) (-408.961) (-404.057) [-405.536] * (-403.615) (-404.560) (-411.445) [-404.153] -- 0:00:53

      Average standard deviation of split frequencies: 0.018439

      195500 -- (-404.982) (-406.296) [-403.632] (-406.368) * (-407.891) (-405.659) (-408.059) [-404.086] -- 0:00:53
      196000 -- (-404.472) (-405.153) [-403.307] (-405.480) * (-406.205) (-407.946) (-405.976) [-403.968] -- 0:00:53
      196500 -- (-403.694) (-408.036) (-404.238) [-403.771] * (-408.022) (-407.068) [-404.137] (-406.276) -- 0:00:53
      197000 -- (-405.893) (-407.754) [-404.894] (-404.536) * (-408.232) [-403.668] (-406.623) (-404.510) -- 0:00:52
      197500 -- (-406.506) (-406.147) (-406.819) [-405.669] * (-405.747) [-404.633] (-404.324) (-405.406) -- 0:00:52
      198000 -- (-408.929) [-406.170] (-406.653) (-404.325) * (-404.609) [-404.572] (-414.017) (-404.610) -- 0:00:52
      198500 -- (-406.631) (-408.246) [-406.692] (-404.973) * (-409.657) (-409.355) [-405.886] (-407.001) -- 0:00:52
      199000 -- (-405.904) [-407.274] (-404.579) (-407.870) * (-404.809) [-406.602] (-406.980) (-408.120) -- 0:00:52
      199500 -- (-404.889) (-409.932) [-407.904] (-405.796) * (-409.806) [-406.491] (-405.163) (-406.413) -- 0:00:52
      200000 -- [-405.046] (-404.496) (-404.901) (-404.987) * (-407.179) (-407.755) [-405.285] (-407.645) -- 0:00:51

      Average standard deviation of split frequencies: 0.017488

      200500 -- (-405.822) (-404.988) (-405.840) [-408.103] * (-403.918) [-404.534] (-405.311) (-406.262) -- 0:00:51
      201000 -- (-404.355) [-406.441] (-406.666) (-407.590) * [-404.428] (-404.096) (-405.790) (-404.710) -- 0:00:51
      201500 -- [-405.063] (-404.509) (-405.715) (-409.656) * (-404.122) (-404.025) (-405.356) [-404.997] -- 0:00:51
      202000 -- (-404.979) (-404.498) [-403.696] (-409.555) * (-405.856) (-406.193) (-405.951) [-403.190] -- 0:00:51
      202500 -- (-404.896) [-408.091] (-403.711) (-410.989) * (-405.667) [-404.989] (-405.516) (-404.779) -- 0:00:51
      203000 -- [-404.162] (-405.256) (-403.525) (-411.645) * [-405.977] (-407.337) (-405.559) (-404.402) -- 0:00:51
      203500 -- (-406.972) (-405.107) [-403.727] (-405.288) * (-406.392) (-407.388) (-408.250) [-406.705] -- 0:00:50
      204000 -- [-405.353] (-405.496) (-406.493) (-408.376) * (-404.839) (-406.961) (-404.925) [-403.597] -- 0:00:50
      204500 -- [-405.009] (-404.444) (-405.856) (-404.710) * [-407.299] (-405.173) (-403.853) (-405.535) -- 0:00:50
      205000 -- (-407.043) (-405.160) (-407.000) [-404.097] * [-405.000] (-413.561) (-408.097) (-404.414) -- 0:00:50

      Average standard deviation of split frequencies: 0.016934

      205500 -- (-405.234) [-406.296] (-407.416) (-405.206) * (-407.678) (-404.775) (-405.730) [-409.798] -- 0:00:50
      206000 -- [-403.752] (-403.904) (-405.706) (-406.469) * (-407.098) [-404.273] (-406.606) (-411.545) -- 0:00:50
      206500 -- (-407.489) (-404.400) (-406.593) [-404.309] * (-406.644) (-411.599) (-408.182) [-405.819] -- 0:00:49
      207000 -- [-405.530] (-407.303) (-404.356) (-403.811) * (-406.171) [-406.141] (-408.630) (-407.402) -- 0:00:49
      207500 -- (-405.144) (-404.247) [-405.515] (-407.581) * (-408.942) (-407.164) (-409.000) [-404.539] -- 0:00:49
      208000 -- [-405.679] (-407.563) (-408.406) (-409.500) * (-407.425) (-404.221) (-407.261) [-404.636] -- 0:00:49
      208500 -- [-404.934] (-404.463) (-404.010) (-407.986) * (-404.780) [-407.137] (-404.425) (-405.336) -- 0:00:49
      209000 -- [-407.102] (-403.437) (-405.666) (-408.065) * (-404.515) (-405.706) (-405.578) [-405.447] -- 0:00:49
      209500 -- (-408.265) (-406.099) [-403.764] (-406.933) * (-407.509) [-403.615] (-403.726) (-405.177) -- 0:00:49
      210000 -- (-404.767) (-407.822) (-404.798) [-407.092] * (-405.121) [-410.443] (-404.194) (-405.921) -- 0:00:48

      Average standard deviation of split frequencies: 0.018399

      210500 -- (-403.853) (-409.504) (-408.627) [-408.720] * (-403.973) [-407.939] (-406.800) (-405.060) -- 0:00:52
      211000 -- (-405.835) [-409.675] (-404.190) (-404.687) * (-403.373) [-404.272] (-405.421) (-405.027) -- 0:00:52
      211500 -- (-404.020) (-406.046) (-404.296) [-403.913] * (-403.367) (-407.749) [-404.089] (-408.045) -- 0:00:52
      212000 -- (-404.947) [-407.218] (-404.250) (-411.054) * [-403.858] (-406.757) (-404.732) (-404.514) -- 0:00:52
      212500 -- [-406.001] (-403.899) (-403.309) (-405.209) * (-403.162) (-406.743) [-407.022] (-406.244) -- 0:00:51
      213000 -- [-404.306] (-407.828) (-404.492) (-405.127) * (-407.717) [-405.898] (-405.271) (-404.729) -- 0:00:51
      213500 -- (-409.830) (-406.761) [-404.355] (-406.010) * (-404.373) [-405.099] (-405.515) (-406.075) -- 0:00:51
      214000 -- (-408.280) (-405.345) [-403.211] (-405.222) * [-404.982] (-404.685) (-406.938) (-403.455) -- 0:00:51
      214500 -- [-409.609] (-405.746) (-406.867) (-404.730) * [-404.867] (-407.770) (-406.391) (-405.365) -- 0:00:51
      215000 -- (-409.716) (-405.199) (-404.736) [-404.420] * (-404.641) (-404.517) (-407.914) [-406.762] -- 0:00:51

      Average standard deviation of split frequencies: 0.018672

      215500 -- (-407.793) (-405.104) [-405.733] (-404.747) * (-407.069) [-404.064] (-403.825) (-404.203) -- 0:00:50
      216000 -- [-406.508] (-405.347) (-405.147) (-408.789) * (-410.589) (-404.780) (-405.544) [-404.273] -- 0:00:50
      216500 -- [-405.268] (-405.690) (-405.952) (-406.783) * (-409.457) (-405.036) (-405.310) [-406.678] -- 0:00:50
      217000 -- (-405.850) (-405.120) [-406.672] (-405.217) * [-405.672] (-404.783) (-406.418) (-404.687) -- 0:00:50
      217500 -- (-404.989) [-404.991] (-404.656) (-406.632) * [-405.972] (-407.237) (-408.821) (-404.850) -- 0:00:50
      218000 -- (-404.051) (-404.438) (-407.891) [-404.496] * (-403.316) (-404.205) [-404.943] (-404.602) -- 0:00:50
      218500 -- (-404.019) [-405.875] (-412.130) (-404.595) * (-405.068) (-404.681) (-405.397) [-406.899] -- 0:00:50
      219000 -- (-408.106) (-406.970) (-413.652) [-404.166] * (-406.097) (-405.830) (-404.653) [-404.101] -- 0:00:49
      219500 -- (-408.152) (-406.310) (-413.301) [-405.816] * (-405.632) (-408.892) (-405.097) [-408.799] -- 0:00:49
      220000 -- (-407.001) (-405.099) (-414.001) [-404.944] * [-404.512] (-404.967) (-404.676) (-407.114) -- 0:00:49

      Average standard deviation of split frequencies: 0.017203

      220500 -- (-403.523) (-406.710) (-417.744) [-405.503] * (-405.474) [-405.407] (-409.691) (-407.632) -- 0:00:49
      221000 -- (-404.009) [-404.309] (-407.114) (-408.286) * (-405.510) (-405.476) [-404.233] (-406.844) -- 0:00:49
      221500 -- (-406.556) [-403.732] (-407.547) (-408.953) * (-407.677) (-404.780) [-405.679] (-404.347) -- 0:00:49
      222000 -- (-407.496) [-404.898] (-404.477) (-406.138) * (-406.712) (-405.200) (-407.062) [-403.245] -- 0:00:49
      222500 -- (-404.832) (-410.790) [-405.223] (-407.252) * [-403.525] (-404.212) (-410.677) (-405.141) -- 0:00:48
      223000 -- [-404.451] (-406.382) (-403.442) (-407.676) * (-404.593) [-408.195] (-407.795) (-405.509) -- 0:00:48
      223500 -- (-408.494) (-404.965) [-405.188] (-406.807) * (-406.562) [-405.494] (-403.920) (-406.356) -- 0:00:48
      224000 -- [-406.415] (-404.733) (-405.903) (-404.031) * (-406.217) [-406.180] (-406.485) (-405.498) -- 0:00:48
      224500 -- (-405.146) [-404.360] (-407.227) (-404.506) * (-407.695) (-407.371) [-404.338] (-404.442) -- 0:00:48
      225000 -- (-404.791) (-405.527) (-405.350) [-403.820] * [-405.349] (-406.680) (-406.231) (-404.853) -- 0:00:48

      Average standard deviation of split frequencies: 0.016467

      225500 -- (-404.534) [-407.124] (-404.711) (-409.032) * (-405.516) [-403.933] (-403.901) (-404.106) -- 0:00:48
      226000 -- (-408.592) [-405.558] (-404.616) (-406.990) * [-403.767] (-403.549) (-404.965) (-405.972) -- 0:00:47
      226500 -- (-407.935) (-406.179) [-410.323] (-407.713) * (-404.788) (-405.843) (-405.279) [-403.282] -- 0:00:47
      227000 -- (-406.771) (-405.772) [-409.948] (-407.112) * [-404.374] (-404.729) (-408.275) (-403.504) -- 0:00:47
      227500 -- (-407.522) (-404.744) (-406.920) [-403.653] * [-405.530] (-404.827) (-407.429) (-409.357) -- 0:00:50
      228000 -- (-404.509) (-403.434) [-405.145] (-407.196) * [-406.443] (-405.498) (-405.272) (-409.325) -- 0:00:50
      228500 -- (-403.926) [-405.555] (-405.444) (-405.954) * (-405.074) (-406.801) (-405.129) [-404.751] -- 0:00:50
      229000 -- [-404.238] (-403.241) (-406.902) (-404.025) * (-403.526) (-404.725) (-407.187) [-406.824] -- 0:00:50
      229500 -- (-405.040) (-404.781) [-405.327] (-405.428) * [-405.551] (-407.058) (-408.919) (-406.206) -- 0:00:50
      230000 -- (-406.509) (-405.742) [-404.090] (-403.230) * (-403.596) (-405.573) (-405.936) [-406.252] -- 0:00:50

      Average standard deviation of split frequencies: 0.016247

      230500 -- [-405.713] (-408.408) (-404.473) (-403.695) * [-407.206] (-404.199) (-406.414) (-403.196) -- 0:00:50
      231000 -- [-404.169] (-406.746) (-404.516) (-405.992) * (-407.780) (-404.137) [-404.534] (-405.753) -- 0:00:49
      231500 -- (-403.971) (-407.081) (-407.860) [-406.990] * (-406.547) [-403.467] (-404.800) (-403.799) -- 0:00:49
      232000 -- (-404.064) (-405.657) [-405.985] (-407.322) * (-403.209) (-406.639) [-403.508] (-406.222) -- 0:00:49
      232500 -- (-404.960) (-406.705) [-406.373] (-404.295) * [-405.516] (-403.669) (-404.804) (-404.510) -- 0:00:49
      233000 -- [-406.261] (-404.897) (-405.400) (-407.192) * [-403.955] (-404.123) (-403.262) (-410.612) -- 0:00:49
      233500 -- (-406.324) (-405.726) (-404.077) [-405.357] * (-405.124) (-405.392) [-404.489] (-408.239) -- 0:00:49
      234000 -- (-407.412) [-403.993] (-406.637) (-406.165) * [-407.055] (-405.420) (-403.790) (-405.616) -- 0:00:49
      234500 -- [-404.941] (-403.962) (-407.016) (-407.125) * (-405.111) (-405.255) (-403.865) [-404.808] -- 0:00:48
      235000 -- (-405.398) (-404.571) (-406.037) [-404.723] * (-404.467) [-404.265] (-407.199) (-405.202) -- 0:00:48

      Average standard deviation of split frequencies: 0.015029

      235500 -- (-410.403) (-405.430) (-406.191) [-404.912] * (-405.189) [-405.450] (-403.409) (-407.707) -- 0:00:48
      236000 -- [-405.940] (-405.015) (-406.240) (-404.002) * [-405.184] (-412.350) (-410.299) (-409.955) -- 0:00:48
      236500 -- (-405.819) [-406.862] (-404.014) (-404.328) * [-403.350] (-409.638) (-408.324) (-405.431) -- 0:00:48
      237000 -- (-408.152) [-403.730] (-405.210) (-405.618) * [-403.863] (-407.919) (-404.595) (-406.454) -- 0:00:48
      237500 -- (-410.235) [-404.296] (-411.362) (-404.336) * [-404.188] (-404.991) (-404.324) (-406.410) -- 0:00:48
      238000 -- (-409.244) (-404.362) (-408.031) [-405.227] * [-404.544] (-405.240) (-407.336) (-405.575) -- 0:00:48
      238500 -- (-406.372) (-407.220) (-403.672) [-405.748] * (-410.302) (-403.847) [-409.080] (-408.583) -- 0:00:47
      239000 -- (-405.772) [-405.566] (-403.658) (-405.101) * (-405.516) (-404.051) [-405.803] (-404.231) -- 0:00:47
      239500 -- (-407.270) (-403.963) [-405.699] (-404.563) * [-406.418] (-404.368) (-404.545) (-404.816) -- 0:00:47
      240000 -- (-406.504) [-404.511] (-405.697) (-408.583) * (-407.131) (-405.651) (-407.239) [-407.285] -- 0:00:47

      Average standard deviation of split frequencies: 0.015763

      240500 -- (-404.215) [-404.511] (-405.165) (-406.188) * (-406.647) [-404.808] (-403.225) (-403.846) -- 0:00:47
      241000 -- (-404.335) (-405.676) [-404.693] (-408.129) * (-406.153) (-404.330) [-406.426] (-407.145) -- 0:00:47
      241500 -- (-406.041) [-405.112] (-408.658) (-404.611) * [-404.788] (-407.517) (-407.168) (-405.071) -- 0:00:47
      242000 -- (-403.890) (-405.835) [-405.677] (-405.474) * (-407.020) (-407.566) [-404.154] (-405.982) -- 0:00:46
      242500 -- (-406.115) [-404.602] (-405.382) (-406.979) * (-404.665) [-408.178] (-405.617) (-405.989) -- 0:00:46
      243000 -- (-405.385) (-404.944) (-405.013) [-404.286] * [-405.495] (-405.484) (-405.050) (-407.441) -- 0:00:46
      243500 -- [-404.845] (-406.261) (-404.112) (-406.457) * (-407.477) (-403.616) (-406.487) [-407.802] -- 0:00:46
      244000 -- (-405.686) (-409.146) [-404.096] (-407.480) * (-406.162) (-407.548) (-404.393) [-407.315] -- 0:00:46
      244500 -- (-403.749) (-406.218) (-404.687) [-403.966] * (-404.370) [-404.827] (-403.356) (-407.003) -- 0:00:49
      245000 -- [-409.340] (-407.138) (-406.196) (-407.731) * (-405.850) [-404.316] (-406.058) (-405.274) -- 0:00:49

      Average standard deviation of split frequencies: 0.015604

      245500 -- (-408.520) [-406.315] (-406.359) (-405.813) * (-407.799) [-408.857] (-403.570) (-404.872) -- 0:00:49
      246000 -- (-403.756) [-405.309] (-403.669) (-407.802) * (-406.381) [-406.960] (-406.059) (-406.518) -- 0:00:49
      246500 -- (-403.842) [-405.434] (-406.987) (-406.259) * [-405.951] (-410.823) (-404.700) (-405.603) -- 0:00:48
      247000 -- (-406.054) [-406.212] (-405.961) (-408.296) * (-406.114) [-404.998] (-403.914) (-404.271) -- 0:00:48
      247500 -- [-404.779] (-404.778) (-406.764) (-405.179) * (-403.848) (-404.059) (-404.181) [-404.046] -- 0:00:48
      248000 -- (-404.750) (-405.810) (-405.167) [-404.984] * (-408.053) (-404.230) (-405.092) [-407.187] -- 0:00:48
      248500 -- (-406.899) [-406.581] (-403.760) (-407.959) * [-406.960] (-405.022) (-403.133) (-406.678) -- 0:00:48
      249000 -- (-403.966) (-405.513) (-403.789) [-408.068] * [-405.368] (-405.480) (-404.370) (-404.809) -- 0:00:48
      249500 -- (-407.315) [-406.760] (-407.378) (-406.386) * (-405.555) [-406.426] (-405.455) (-404.387) -- 0:00:48
      250000 -- (-403.738) (-407.182) (-404.782) [-406.397] * (-404.434) (-405.731) [-404.151] (-404.389) -- 0:00:48

      Average standard deviation of split frequencies: 0.015985

      250500 -- [-404.086] (-404.728) (-407.061) (-405.633) * (-405.938) (-405.792) [-403.603] (-405.410) -- 0:00:47
      251000 -- (-405.228) (-407.442) (-405.570) [-404.416] * (-404.629) (-406.148) (-407.451) [-407.269] -- 0:00:47
      251500 -- [-406.406] (-404.345) (-406.014) (-403.893) * (-403.859) [-404.108] (-406.387) (-406.788) -- 0:00:47
      252000 -- (-409.509) [-404.575] (-405.897) (-405.461) * (-404.912) [-404.329] (-407.943) (-405.814) -- 0:00:47
      252500 -- (-404.005) (-406.647) (-404.269) [-406.588] * (-404.158) [-404.083] (-405.460) (-406.193) -- 0:00:47
      253000 -- (-405.593) [-403.577] (-408.154) (-407.156) * [-404.049] (-406.610) (-406.087) (-404.064) -- 0:00:47
      253500 -- (-404.230) (-407.550) [-404.675] (-408.524) * (-403.396) [-404.163] (-406.133) (-406.661) -- 0:00:47
      254000 -- [-405.688] (-404.562) (-406.805) (-406.860) * (-409.337) (-408.054) (-404.593) [-406.540] -- 0:00:46
      254500 -- (-404.526) (-404.639) [-407.016] (-408.657) * (-405.994) (-409.370) (-408.425) [-405.308] -- 0:00:46
      255000 -- (-406.708) (-403.877) (-404.054) [-407.581] * [-406.796] (-405.876) (-408.604) (-405.514) -- 0:00:46

      Average standard deviation of split frequencies: 0.016864

      255500 -- [-405.182] (-406.456) (-406.438) (-405.284) * (-406.054) (-404.365) (-405.581) [-404.639] -- 0:00:46
      256000 -- [-403.955] (-406.295) (-406.501) (-406.519) * [-406.097] (-405.264) (-406.761) (-404.695) -- 0:00:46
      256500 -- [-405.791] (-406.380) (-405.888) (-406.996) * (-403.211) (-407.123) [-404.631] (-404.523) -- 0:00:46
      257000 -- (-407.360) (-406.391) [-406.617] (-405.143) * (-403.954) (-405.505) (-406.415) [-404.227] -- 0:00:46
      257500 -- [-404.913] (-407.659) (-406.390) (-408.859) * (-403.984) (-406.215) (-404.052) [-407.251] -- 0:00:46
      258000 -- (-404.689) [-404.820] (-403.877) (-403.549) * [-409.706] (-408.418) (-405.064) (-406.926) -- 0:00:46
      258500 -- (-403.815) (-403.673) (-406.602) [-404.102] * [-408.688] (-407.134) (-405.067) (-404.573) -- 0:00:45
      259000 -- (-403.705) (-403.797) (-407.823) [-407.082] * (-404.020) [-409.547] (-404.454) (-403.581) -- 0:00:45
      259500 -- (-403.994) (-405.175) [-406.072] (-412.342) * [-405.123] (-419.600) (-404.311) (-404.649) -- 0:00:45
      260000 -- [-403.581] (-406.892) (-408.906) (-405.764) * (-405.151) (-406.544) (-407.362) [-404.361] -- 0:00:45

      Average standard deviation of split frequencies: 0.016979

      260500 -- [-405.403] (-408.837) (-407.882) (-405.574) * (-405.907) [-405.994] (-404.868) (-406.723) -- 0:00:45
      261000 -- (-404.749) (-407.989) [-407.785] (-405.036) * (-405.142) (-404.785) [-405.719] (-404.341) -- 0:00:48
      261500 -- (-403.461) (-405.023) [-405.834] (-404.853) * (-406.305) [-404.626] (-407.921) (-404.768) -- 0:00:48
      262000 -- [-403.853] (-404.753) (-408.903) (-407.451) * (-405.404) [-406.882] (-406.379) (-405.776) -- 0:00:47
      262500 -- (-406.347) [-403.987] (-409.362) (-403.319) * [-405.385] (-405.522) (-404.412) (-406.167) -- 0:00:47
      263000 -- [-405.741] (-406.157) (-408.184) (-406.853) * (-405.071) (-404.812) (-406.380) [-405.232] -- 0:00:47
      263500 -- [-405.083] (-407.697) (-407.017) (-407.740) * (-403.754) (-409.642) (-404.497) [-404.222] -- 0:00:47
      264000 -- [-406.909] (-408.371) (-407.142) (-404.685) * [-408.283] (-407.341) (-404.959) (-404.757) -- 0:00:47
      264500 -- (-406.038) [-404.718] (-407.042) (-406.696) * [-407.189] (-408.505) (-405.067) (-405.246) -- 0:00:47
      265000 -- [-407.211] (-406.597) (-407.832) (-404.010) * (-405.745) (-407.664) (-404.932) [-406.300] -- 0:00:47

      Average standard deviation of split frequencies: 0.015857

      265500 -- [-404.706] (-406.472) (-404.671) (-404.010) * [-405.126] (-404.348) (-405.621) (-408.045) -- 0:00:47
      266000 -- (-408.922) (-403.698) (-406.307) [-404.054] * [-404.421] (-405.523) (-407.438) (-409.061) -- 0:00:46
      266500 -- (-410.656) (-406.960) (-404.571) [-404.924] * (-405.303) (-404.448) (-408.183) [-407.508] -- 0:00:46
      267000 -- (-406.124) [-405.825] (-404.398) (-405.825) * (-404.900) (-404.102) (-405.229) [-405.928] -- 0:00:46
      267500 -- (-405.232) (-407.071) (-405.468) [-404.453] * (-404.931) (-404.645) [-404.257] (-403.901) -- 0:00:46
      268000 -- (-404.819) (-404.093) (-418.549) [-403.920] * (-407.255) (-406.006) [-406.882] (-405.410) -- 0:00:46
      268500 -- [-405.507] (-403.967) (-409.199) (-404.799) * (-406.961) (-407.311) [-405.182] (-403.971) -- 0:00:46
      269000 -- (-403.536) (-404.756) (-406.810) [-405.104] * [-404.973] (-407.465) (-406.317) (-406.302) -- 0:00:46
      269500 -- (-404.835) (-405.141) [-405.340] (-404.402) * (-406.073) (-410.623) [-403.514] (-406.952) -- 0:00:46
      270000 -- (-407.975) (-404.685) (-409.936) [-404.717] * (-405.557) (-406.331) (-403.849) [-404.541] -- 0:00:45

      Average standard deviation of split frequencies: 0.016159

      270500 -- (-406.394) (-404.433) [-404.173] (-405.059) * (-406.022) (-404.457) (-404.995) [-403.618] -- 0:00:45
      271000 -- [-405.521] (-407.092) (-405.979) (-409.693) * [-404.835] (-405.253) (-405.215) (-406.525) -- 0:00:45
      271500 -- (-403.194) [-403.899] (-405.482) (-405.335) * [-406.343] (-408.071) (-403.529) (-404.351) -- 0:00:45
      272000 -- (-403.939) [-405.040] (-406.166) (-411.766) * (-406.582) (-408.371) [-406.256] (-404.272) -- 0:00:45
      272500 -- (-407.830) (-404.787) (-403.923) [-409.669] * (-404.871) (-405.548) (-403.981) [-404.644] -- 0:00:45
      273000 -- [-408.103] (-407.861) (-404.658) (-408.929) * (-411.507) (-404.190) [-404.805] (-406.142) -- 0:00:45
      273500 -- (-406.562) [-403.906] (-403.880) (-403.162) * (-404.903) [-405.207] (-404.454) (-406.796) -- 0:00:45
      274000 -- [-405.754] (-406.180) (-404.215) (-405.116) * (-406.568) [-404.371] (-407.009) (-405.198) -- 0:00:45
      274500 -- (-405.267) (-408.402) (-405.895) [-405.028] * (-407.890) [-404.934] (-407.531) (-406.682) -- 0:00:44
      275000 -- (-405.721) [-404.911] (-408.608) (-407.487) * (-412.518) (-408.511) (-406.215) [-406.367] -- 0:00:44

      Average standard deviation of split frequencies: 0.015462

      275500 -- (-405.670) (-408.674) [-404.191] (-406.506) * (-406.304) (-405.606) (-404.370) [-404.770] -- 0:00:44
      276000 -- (-407.138) (-403.668) (-403.855) [-409.177] * (-403.748) (-404.387) (-406.319) [-405.462] -- 0:00:44
      276500 -- [-403.353] (-408.647) (-407.230) (-406.786) * (-404.722) (-405.877) [-406.497] (-406.900) -- 0:00:44
      277000 -- (-411.128) (-404.664) (-403.880) [-410.159] * (-405.313) (-405.328) (-408.790) [-404.819] -- 0:00:44
      277500 -- (-403.966) (-404.318) [-406.506] (-408.576) * (-404.394) [-405.447] (-405.825) (-405.424) -- 0:00:46
      278000 -- (-403.857) (-408.048) (-404.263) [-408.055] * (-404.738) (-406.594) (-408.015) [-403.760] -- 0:00:46
      278500 -- [-404.678] (-404.620) (-403.187) (-404.864) * (-403.569) (-407.850) (-407.781) [-403.399] -- 0:00:46
      279000 -- (-403.839) [-405.801] (-406.907) (-405.036) * (-404.409) [-404.232] (-404.126) (-407.185) -- 0:00:46
      279500 -- (-404.796) [-406.977] (-403.897) (-403.512) * (-404.728) (-408.862) [-407.402] (-404.377) -- 0:00:46
      280000 -- (-404.367) (-406.968) [-405.452] (-405.079) * (-404.852) [-406.316] (-411.784) (-404.229) -- 0:00:46

      Average standard deviation of split frequencies: 0.013702

      280500 -- (-405.157) (-405.553) (-404.103) [-406.336] * [-404.391] (-404.306) (-407.701) (-406.718) -- 0:00:46
      281000 -- (-404.234) (-407.554) [-403.740] (-405.538) * (-405.896) [-403.450] (-403.992) (-404.370) -- 0:00:46
      281500 -- [-406.252] (-406.376) (-403.667) (-413.093) * (-404.282) [-407.415] (-408.459) (-404.203) -- 0:00:45
      282000 -- (-403.735) [-405.107] (-407.713) (-405.241) * [-406.267] (-407.836) (-405.199) (-404.441) -- 0:00:45
      282500 -- [-404.121] (-406.437) (-404.104) (-408.614) * (-405.238) [-405.778] (-404.863) (-406.222) -- 0:00:45
      283000 -- (-406.622) (-404.288) [-404.043] (-405.644) * (-406.556) (-405.398) [-406.991] (-405.987) -- 0:00:45
      283500 -- (-406.459) [-405.969] (-405.465) (-408.750) * (-407.427) (-405.551) (-403.523) [-403.596] -- 0:00:45
      284000 -- (-407.845) (-404.421) (-404.855) [-406.696] * (-404.523) (-406.157) [-404.972] (-403.776) -- 0:00:45
      284500 -- (-404.186) (-404.641) (-405.353) [-404.699] * (-403.403) (-407.255) (-410.858) [-404.926] -- 0:00:45
      285000 -- (-406.195) [-404.966] (-410.116) (-407.417) * [-404.892] (-404.071) (-404.461) (-404.859) -- 0:00:45

      Average standard deviation of split frequencies: 0.012839

      285500 -- (-408.214) (-405.097) (-407.939) [-404.988] * (-406.460) [-404.887] (-405.187) (-404.918) -- 0:00:45
      286000 -- [-405.464] (-408.421) (-413.866) (-408.165) * (-403.817) (-405.239) [-405.706] (-404.051) -- 0:00:44
      286500 -- [-405.221] (-405.044) (-406.951) (-406.935) * (-406.311) (-405.091) [-407.900] (-407.095) -- 0:00:44
      287000 -- [-404.881] (-405.544) (-405.732) (-404.038) * (-403.787) [-406.031] (-407.304) (-404.748) -- 0:00:44
      287500 -- (-404.264) (-404.915) (-405.147) [-408.834] * (-406.796) (-406.714) [-404.185] (-405.764) -- 0:00:44
      288000 -- [-406.530] (-407.246) (-405.379) (-404.639) * [-403.762] (-405.005) (-403.865) (-408.133) -- 0:00:44
      288500 -- (-405.613) (-406.779) [-404.867] (-404.699) * (-405.346) (-403.873) [-403.822] (-406.081) -- 0:00:44
      289000 -- [-405.892] (-404.902) (-404.228) (-408.068) * [-405.607] (-404.284) (-407.004) (-408.096) -- 0:00:44
      289500 -- (-404.025) (-405.481) [-405.276] (-406.983) * (-407.608) [-403.964] (-405.994) (-406.968) -- 0:00:44
      290000 -- (-405.600) (-404.653) (-408.313) [-403.759] * [-406.453] (-406.473) (-404.800) (-404.887) -- 0:00:44

      Average standard deviation of split frequencies: 0.012524

      290500 -- (-408.780) (-404.136) [-405.992] (-406.380) * (-405.138) [-407.626] (-404.803) (-408.808) -- 0:00:43
      291000 -- (-406.019) [-406.669] (-405.083) (-404.040) * (-406.961) (-405.405) (-404.306) [-406.120] -- 0:00:43
      291500 -- [-405.212] (-404.795) (-406.140) (-406.367) * [-405.748] (-405.876) (-406.914) (-405.446) -- 0:00:43
      292000 -- (-409.537) (-404.992) [-404.299] (-405.921) * (-408.953) (-405.830) [-407.420] (-407.811) -- 0:00:43
      292500 -- (-406.481) (-405.384) [-404.205] (-404.940) * (-404.194) (-405.107) (-404.428) [-405.219] -- 0:00:43
      293000 -- (-407.271) (-406.032) [-404.618] (-404.968) * [-410.155] (-411.514) (-405.417) (-410.616) -- 0:00:43
      293500 -- (-405.437) (-404.818) [-406.657] (-404.501) * (-414.754) [-405.391] (-406.949) (-409.361) -- 0:00:43
      294000 -- (-405.869) (-408.669) (-406.986) [-404.463] * [-404.796] (-404.298) (-407.628) (-403.751) -- 0:00:45
      294500 -- (-405.673) (-405.363) (-408.677) [-405.620] * (-404.109) [-407.893] (-408.867) (-403.612) -- 0:00:45
      295000 -- (-405.238) [-405.939] (-406.126) (-404.145) * [-404.080] (-407.383) (-414.566) (-404.746) -- 0:00:45

      Average standard deviation of split frequencies: 0.012475

      295500 -- [-404.380] (-405.257) (-405.199) (-405.755) * (-405.643) [-403.943] (-409.007) (-404.463) -- 0:00:45
      296000 -- (-404.494) [-409.411] (-406.278) (-405.397) * (-404.915) (-404.119) [-406.840] (-403.673) -- 0:00:45
      296500 -- (-404.417) [-406.864] (-404.751) (-404.802) * [-405.260] (-405.398) (-409.108) (-404.023) -- 0:00:45
      297000 -- (-405.022) (-406.117) [-404.237] (-404.120) * [-404.530] (-403.812) (-404.359) (-403.907) -- 0:00:44
      297500 -- (-403.845) [-403.138] (-405.783) (-404.123) * (-406.160) (-406.902) [-406.509] (-405.343) -- 0:00:44
      298000 -- [-404.214] (-407.999) (-417.851) (-404.175) * (-406.003) [-404.055] (-408.929) (-407.041) -- 0:00:44
      298500 -- (-403.236) (-408.583) [-406.505] (-407.120) * (-409.561) (-403.945) [-406.627] (-413.840) -- 0:00:44
      299000 -- (-407.786) (-403.847) (-406.106) [-404.452] * (-412.782) (-404.356) [-408.726] (-404.133) -- 0:00:44
      299500 -- (-406.136) (-404.791) (-404.507) [-404.263] * (-407.895) (-407.708) [-404.982] (-408.096) -- 0:00:44
      300000 -- (-406.275) (-404.438) (-404.761) [-404.730] * (-407.557) (-405.263) [-403.838] (-408.826) -- 0:00:44

      Average standard deviation of split frequencies: 0.011933

      300500 -- (-405.680) (-406.104) [-405.542] (-404.453) * (-408.500) (-408.586) (-404.861) [-406.053] -- 0:00:44
      301000 -- (-406.404) (-405.024) (-403.675) [-404.285] * (-406.243) (-403.935) (-403.727) [-405.336] -- 0:00:44
      301500 -- (-411.441) (-407.148) (-403.542) [-405.119] * (-404.140) (-403.308) (-406.751) [-406.798] -- 0:00:44
      302000 -- (-406.472) [-404.190] (-404.054) (-405.926) * (-404.213) (-404.060) [-406.210] (-404.886) -- 0:00:43
      302500 -- (-405.935) [-404.738] (-409.240) (-406.483) * (-404.910) (-405.902) [-405.758] (-403.796) -- 0:00:43
      303000 -- [-404.092] (-405.150) (-404.587) (-405.223) * (-405.886) [-404.440] (-404.862) (-403.198) -- 0:00:43
      303500 -- [-404.323] (-403.323) (-404.628) (-404.428) * (-406.195) [-404.056] (-405.893) (-404.683) -- 0:00:43
      304000 -- [-403.520] (-408.762) (-404.498) (-407.913) * [-411.073] (-407.460) (-406.801) (-405.214) -- 0:00:43
      304500 -- [-403.671] (-404.933) (-403.526) (-405.817) * (-407.428) (-410.379) (-405.518) [-405.452] -- 0:00:43
      305000 -- [-403.626] (-405.254) (-404.111) (-403.600) * (-408.443) (-408.646) (-405.799) [-405.247] -- 0:00:43

      Average standard deviation of split frequencies: 0.011896

      305500 -- (-408.081) (-408.978) [-403.539] (-404.295) * [-406.224] (-406.019) (-404.793) (-406.399) -- 0:00:43
      306000 -- (-406.397) (-404.819) (-404.528) [-406.039] * (-404.485) [-405.365] (-403.547) (-409.800) -- 0:00:43
      306500 -- (-404.897) [-405.056] (-407.217) (-407.054) * (-404.122) (-404.840) [-405.880] (-407.091) -- 0:00:42
      307000 -- [-405.303] (-404.384) (-405.770) (-405.905) * (-408.473) (-406.631) (-406.098) [-405.363] -- 0:00:42
      307500 -- (-406.850) (-405.494) [-404.108] (-404.755) * (-404.253) [-408.286] (-408.075) (-407.247) -- 0:00:42
      308000 -- [-408.043] (-404.562) (-405.754) (-404.908) * [-405.511] (-407.017) (-407.012) (-407.685) -- 0:00:42
      308500 -- (-407.685) (-408.889) (-403.420) [-404.556] * (-406.893) [-407.295] (-403.972) (-405.126) -- 0:00:42
      309000 -- (-408.142) (-405.396) [-403.687] (-407.805) * (-406.687) (-411.337) [-403.924] (-404.228) -- 0:00:42
      309500 -- (-410.616) (-404.421) (-403.918) [-403.696] * [-406.521] (-403.415) (-404.730) (-407.113) -- 0:00:42
      310000 -- (-406.462) (-404.674) (-405.899) [-404.193] * (-407.233) [-405.965] (-404.156) (-409.088) -- 0:00:42

      Average standard deviation of split frequencies: 0.012055

      310500 -- [-403.588] (-406.592) (-406.716) (-403.750) * [-407.152] (-410.833) (-406.787) (-406.177) -- 0:00:44
      311000 -- (-409.362) (-405.893) (-407.893) [-404.158] * (-405.727) (-406.514) [-404.777] (-406.730) -- 0:00:44
      311500 -- (-406.825) [-406.201] (-405.112) (-405.788) * (-404.195) (-405.712) [-405.690] (-407.084) -- 0:00:44
      312000 -- (-404.553) [-406.176] (-413.957) (-405.063) * (-403.385) (-405.142) [-407.226] (-409.272) -- 0:00:44
      312500 -- (-405.623) [-404.688] (-408.050) (-404.847) * (-404.657) (-403.763) (-408.498) [-404.248] -- 0:00:44
      313000 -- [-405.315] (-405.258) (-404.727) (-404.559) * (-405.362) (-405.547) (-405.810) [-403.250] -- 0:00:43
      313500 -- (-405.178) [-405.839] (-406.277) (-406.236) * [-408.099] (-403.740) (-404.180) (-406.172) -- 0:00:43
      314000 -- [-405.081] (-403.818) (-411.118) (-407.146) * [-404.479] (-404.597) (-407.549) (-405.086) -- 0:00:43
      314500 -- (-403.431) [-404.218] (-404.872) (-408.116) * (-404.153) [-403.597] (-409.273) (-406.442) -- 0:00:43
      315000 -- (-403.775) [-404.538] (-407.277) (-407.008) * [-404.305] (-404.901) (-404.049) (-406.451) -- 0:00:43

      Average standard deviation of split frequencies: 0.011106

      315500 -- (-405.820) (-404.721) [-405.209] (-404.199) * (-407.100) [-404.595] (-406.357) (-404.337) -- 0:00:43
      316000 -- [-403.244] (-404.545) (-405.035) (-403.317) * (-404.193) [-404.124] (-406.788) (-409.586) -- 0:00:43
      316500 -- [-405.257] (-405.553) (-403.607) (-404.780) * [-404.459] (-404.324) (-403.766) (-406.272) -- 0:00:43
      317000 -- (-405.661) [-404.010] (-406.730) (-405.393) * [-405.072] (-407.801) (-405.379) (-404.319) -- 0:00:43
      317500 -- (-404.631) (-404.067) (-406.864) [-403.994] * (-403.904) [-406.833] (-407.361) (-405.204) -- 0:00:42
      318000 -- (-403.527) (-404.555) (-407.968) [-405.414] * [-403.552] (-409.278) (-405.982) (-405.279) -- 0:00:42
      318500 -- (-404.680) (-404.177) [-406.368] (-404.653) * (-403.553) (-408.840) [-405.145] (-408.146) -- 0:00:42
      319000 -- [-406.091] (-405.935) (-403.934) (-403.913) * [-405.850] (-405.929) (-405.865) (-404.446) -- 0:00:42
      319500 -- (-408.846) (-404.358) [-405.118] (-404.159) * (-407.362) [-407.033] (-404.665) (-403.266) -- 0:00:42
      320000 -- [-405.695] (-403.831) (-403.891) (-405.091) * (-406.704) [-406.845] (-404.349) (-403.802) -- 0:00:42

      Average standard deviation of split frequencies: 0.010699

      320500 -- [-403.747] (-409.292) (-404.506) (-403.365) * [-403.455] (-407.845) (-404.218) (-404.383) -- 0:00:42
      321000 -- (-406.514) (-405.732) [-409.325] (-403.832) * (-403.389) (-405.442) [-403.886] (-405.228) -- 0:00:42
      321500 -- [-403.269] (-406.475) (-405.348) (-404.980) * [-406.988] (-405.340) (-403.289) (-405.075) -- 0:00:42
      322000 -- (-405.250) (-407.265) [-404.315] (-405.077) * (-406.912) (-406.057) (-410.134) [-407.166] -- 0:00:42
      322500 -- (-403.950) [-404.530] (-404.654) (-411.057) * (-403.246) [-403.791] (-405.998) (-405.260) -- 0:00:42
      323000 -- (-407.468) (-405.786) [-405.353] (-412.639) * (-406.811) (-405.326) (-405.681) [-405.184] -- 0:00:41
      323500 -- (-406.914) (-403.956) [-406.330] (-403.432) * (-405.292) (-404.556) [-408.375] (-408.550) -- 0:00:41
      324000 -- [-404.711] (-407.491) (-405.705) (-409.357) * [-407.055] (-405.597) (-406.879) (-403.573) -- 0:00:41
      324500 -- (-404.137) (-406.103) [-404.126] (-406.254) * (-408.843) [-403.310] (-408.920) (-405.343) -- 0:00:41
      325000 -- [-403.871] (-406.425) (-404.272) (-404.210) * (-407.388) (-404.960) [-407.064] (-410.969) -- 0:00:41

      Average standard deviation of split frequencies: 0.011167

      325500 -- (-404.602) (-409.397) [-408.225] (-404.514) * [-408.421] (-406.721) (-409.076) (-407.492) -- 0:00:41
      326000 -- (-407.867) [-406.604] (-405.490) (-403.972) * [-404.455] (-404.763) (-408.100) (-404.911) -- 0:00:41
      326500 -- (-405.023) (-405.206) [-404.407] (-404.287) * (-406.584) (-407.397) (-406.533) [-404.798] -- 0:00:41
      327000 -- [-403.394] (-406.239) (-405.520) (-404.721) * [-404.656] (-404.324) (-406.871) (-405.281) -- 0:00:41
      327500 -- (-407.021) [-406.660] (-404.527) (-411.029) * (-405.658) (-406.247) [-406.570] (-405.544) -- 0:00:43
      328000 -- [-404.383] (-406.262) (-403.998) (-407.894) * [-406.985] (-412.742) (-406.961) (-405.958) -- 0:00:43
      328500 -- (-412.274) [-403.638] (-404.802) (-404.711) * (-405.143) (-404.559) (-404.390) [-403.474] -- 0:00:42
      329000 -- (-409.175) (-404.125) (-405.343) [-403.679] * [-404.530] (-406.486) (-404.235) (-403.262) -- 0:00:42
      329500 -- (-403.878) (-404.185) [-405.565] (-405.165) * (-407.017) [-406.110] (-404.541) (-403.186) -- 0:00:42
      330000 -- (-404.581) (-406.163) [-408.384] (-413.266) * [-404.086] (-413.178) (-403.736) (-408.461) -- 0:00:42

      Average standard deviation of split frequencies: 0.010217

      330500 -- (-404.308) (-405.197) (-405.591) [-403.872] * (-409.808) (-409.111) (-405.659) [-404.700] -- 0:00:42
      331000 -- (-407.259) [-405.037] (-406.715) (-405.689) * (-408.495) (-406.993) (-403.684) [-406.399] -- 0:00:42
      331500 -- [-408.009] (-404.464) (-405.887) (-406.346) * [-405.552] (-410.537) (-408.375) (-404.520) -- 0:00:42
      332000 -- (-403.625) [-406.516] (-404.935) (-405.397) * (-403.642) (-405.204) (-403.363) [-406.000] -- 0:00:42
      332500 -- (-405.767) [-404.933] (-406.263) (-408.157) * (-404.462) (-406.391) [-406.503] (-405.334) -- 0:00:42
      333000 -- [-404.119] (-407.507) (-404.678) (-404.107) * (-405.624) (-407.634) (-410.271) [-407.740] -- 0:00:42
      333500 -- (-405.121) [-406.767] (-404.657) (-407.057) * (-407.010) (-404.315) [-406.273] (-406.840) -- 0:00:41
      334000 -- [-404.733] (-408.824) (-408.229) (-407.234) * (-404.103) [-404.008] (-408.454) (-404.070) -- 0:00:41
      334500 -- (-406.686) (-409.846) [-404.735] (-405.638) * (-403.999) (-404.472) (-404.585) [-405.064] -- 0:00:41
      335000 -- [-405.652] (-404.016) (-405.812) (-403.755) * [-404.972] (-406.285) (-406.543) (-409.880) -- 0:00:41

      Average standard deviation of split frequencies: 0.009665

      335500 -- (-406.456) [-405.114] (-404.667) (-405.089) * (-403.625) (-407.474) [-407.069] (-410.117) -- 0:00:41
      336000 -- (-405.666) (-403.509) (-404.490) [-404.511] * (-404.698) [-407.703] (-407.983) (-404.887) -- 0:00:41
      336500 -- (-405.565) (-404.657) (-406.477) [-406.127] * (-406.190) (-405.377) [-404.416] (-408.974) -- 0:00:41
      337000 -- (-404.538) [-410.267] (-406.320) (-407.075) * (-406.051) (-407.136) [-404.666] (-404.452) -- 0:00:41
      337500 -- (-405.052) (-409.839) [-404.678] (-409.694) * [-404.687] (-406.892) (-406.719) (-403.754) -- 0:00:41
      338000 -- [-405.587] (-407.942) (-404.324) (-409.150) * (-406.500) [-404.529] (-404.768) (-404.585) -- 0:00:41
      338500 -- (-406.896) (-407.238) [-403.614] (-406.705) * (-403.926) (-405.120) (-406.086) [-406.139] -- 0:00:41
      339000 -- (-405.545) (-406.484) (-406.197) [-404.037] * (-404.856) (-405.341) [-407.033] (-404.324) -- 0:00:40
      339500 -- (-404.744) (-404.968) (-404.772) [-407.103] * [-406.954] (-404.097) (-403.998) (-404.768) -- 0:00:40
      340000 -- (-406.424) [-404.664] (-406.260) (-405.466) * (-409.034) [-406.132] (-408.061) (-407.617) -- 0:00:40

      Average standard deviation of split frequencies: 0.009605

      340500 -- [-404.778] (-406.438) (-405.952) (-406.548) * (-405.144) [-405.182] (-404.899) (-405.895) -- 0:00:40
      341000 -- (-405.806) (-406.995) [-406.801] (-406.351) * (-406.328) (-405.178) (-405.119) [-404.451] -- 0:00:40
      341500 -- (-406.404) [-403.659] (-404.398) (-404.532) * (-405.118) (-404.365) (-403.807) [-404.049] -- 0:00:40
      342000 -- (-409.750) [-406.567] (-408.824) (-409.439) * (-405.971) (-404.425) (-406.107) [-404.281] -- 0:00:40
      342500 -- (-403.931) [-405.682] (-406.205) (-404.417) * (-405.093) [-403.301] (-408.161) (-406.309) -- 0:00:40
      343000 -- (-404.706) (-408.191) [-404.342] (-408.195) * (-408.088) (-404.536) (-407.259) [-405.150] -- 0:00:40
      343500 -- (-405.501) [-405.430] (-409.132) (-408.241) * [-407.510] (-405.725) (-404.757) (-406.738) -- 0:00:40
      344000 -- (-404.918) (-406.722) [-409.059] (-405.496) * [-404.610] (-406.412) (-403.116) (-406.060) -- 0:00:40
      344500 -- [-406.048] (-405.790) (-407.838) (-409.485) * (-403.858) (-403.519) [-405.507] (-403.176) -- 0:00:41
      345000 -- (-406.492) (-406.666) [-404.950] (-406.239) * [-405.120] (-405.071) (-405.175) (-409.842) -- 0:00:41

      Average standard deviation of split frequencies: 0.009605

      345500 -- (-406.494) [-405.443] (-403.820) (-404.847) * [-408.707] (-404.608) (-404.006) (-407.485) -- 0:00:41
      346000 -- [-404.357] (-406.226) (-406.228) (-408.960) * [-405.063] (-408.466) (-404.323) (-405.436) -- 0:00:41
      346500 -- [-404.329] (-404.520) (-405.672) (-408.571) * [-404.932] (-403.951) (-411.097) (-406.695) -- 0:00:41
      347000 -- [-406.653] (-404.364) (-404.224) (-408.113) * [-409.016] (-404.146) (-408.809) (-404.379) -- 0:00:41
      347500 -- (-404.548) [-404.654] (-403.902) (-406.412) * [-404.361] (-406.115) (-406.291) (-408.588) -- 0:00:41
      348000 -- (-404.909) [-404.082] (-404.598) (-404.954) * [-407.725] (-405.260) (-407.768) (-407.179) -- 0:00:41
      348500 -- (-407.723) (-404.689) (-408.927) [-404.564] * (-406.295) (-407.144) (-412.788) [-403.925] -- 0:00:41
      349000 -- (-405.318) (-406.012) (-407.672) [-406.543] * (-405.108) (-405.505) [-403.723] (-404.430) -- 0:00:41
      349500 -- (-406.074) (-403.731) (-404.558) [-405.517] * [-404.933] (-405.756) (-404.222) (-408.242) -- 0:00:40
      350000 -- (-406.443) [-404.043] (-404.667) (-404.620) * (-405.993) (-405.290) (-406.766) [-405.629] -- 0:00:40

      Average standard deviation of split frequencies: 0.008805

      350500 -- (-405.157) [-405.067] (-405.825) (-406.746) * (-407.612) [-403.874] (-404.133) (-404.650) -- 0:00:40
      351000 -- [-405.296] (-404.780) (-408.543) (-405.441) * (-406.873) [-403.812] (-404.019) (-404.158) -- 0:00:40
      351500 -- (-406.417) (-407.148) [-407.022] (-406.946) * (-406.670) [-405.117] (-403.642) (-404.545) -- 0:00:40
      352000 -- [-405.721] (-403.954) (-403.468) (-403.442) * (-404.975) (-408.327) [-403.935] (-403.745) -- 0:00:40
      352500 -- [-410.582] (-405.312) (-404.839) (-403.994) * (-409.621) [-406.437] (-407.382) (-403.233) -- 0:00:40
      353000 -- (-405.399) (-407.054) [-403.803] (-414.104) * (-404.920) [-404.538] (-408.251) (-406.932) -- 0:00:40
      353500 -- (-406.917) [-404.944] (-404.975) (-410.302) * (-407.950) (-404.218) (-405.315) [-404.831] -- 0:00:40
      354000 -- (-405.704) (-404.494) (-403.793) [-404.482] * (-405.912) (-404.843) [-405.985] (-405.462) -- 0:00:40
      354500 -- (-408.428) (-407.306) [-403.945] (-409.330) * (-406.107) (-404.189) (-403.407) [-404.319] -- 0:00:40
      355000 -- [-404.047] (-406.351) (-404.185) (-406.177) * (-405.686) (-404.302) [-404.465] (-406.204) -- 0:00:39

      Average standard deviation of split frequencies: 0.009468

      355500 -- (-408.013) (-407.198) (-404.907) [-405.163] * (-405.903) (-405.428) [-404.741] (-412.989) -- 0:00:39
      356000 -- (-404.113) (-405.501) (-406.071) [-404.229] * (-407.176) [-404.830] (-408.012) (-404.010) -- 0:00:39
      356500 -- (-404.129) [-404.652] (-406.685) (-404.337) * (-404.429) (-404.211) [-411.405] (-404.186) -- 0:00:39
      357000 -- (-403.903) (-406.297) [-405.073] (-405.783) * (-406.196) (-405.612) [-406.953] (-405.435) -- 0:00:39
      357500 -- [-405.919] (-406.288) (-404.878) (-403.908) * (-407.095) [-405.472] (-406.033) (-405.224) -- 0:00:39
      358000 -- (-407.060) [-403.626] (-404.608) (-404.756) * (-408.968) (-406.596) [-404.492] (-404.800) -- 0:00:39
      358500 -- (-405.998) (-404.006) (-406.077) [-407.387] * (-406.281) (-406.580) (-404.764) [-406.517] -- 0:00:39
      359000 -- [-405.912] (-406.338) (-407.338) (-413.530) * (-407.388) [-403.395] (-405.769) (-403.656) -- 0:00:39
      359500 -- [-408.515] (-405.418) (-405.899) (-407.045) * [-403.713] (-405.375) (-404.491) (-406.961) -- 0:00:39
      360000 -- [-406.920] (-403.544) (-405.058) (-404.326) * (-405.447) (-405.660) (-405.191) [-403.534] -- 0:00:39

      Average standard deviation of split frequencies: 0.010250

      360500 -- (-404.353) (-407.688) (-404.761) [-410.412] * (-410.032) (-404.133) (-407.105) [-404.405] -- 0:00:39
      361000 -- (-405.244) (-409.795) (-405.842) [-406.738] * (-406.929) (-408.992) (-403.668) [-403.667] -- 0:00:40
      361500 -- (-406.134) (-405.815) (-407.704) [-403.902] * (-410.265) (-407.034) [-406.177] (-405.883) -- 0:00:40
      362000 -- [-405.718] (-404.539) (-405.280) (-407.658) * (-403.602) (-404.044) (-404.805) [-403.920] -- 0:00:40
      362500 -- (-413.243) (-405.141) [-405.903] (-405.182) * [-404.284] (-404.506) (-404.722) (-408.293) -- 0:00:40
      363000 -- (-405.754) [-405.148] (-411.222) (-406.076) * (-405.004) [-404.751] (-406.218) (-409.285) -- 0:00:40
      363500 -- (-408.936) [-404.845] (-404.882) (-403.797) * (-406.020) [-406.848] (-405.517) (-408.856) -- 0:00:40
      364000 -- (-408.330) [-403.723] (-409.597) (-406.043) * (-405.629) (-404.068) [-406.670] (-406.283) -- 0:00:40
      364500 -- (-407.940) (-406.765) [-407.641] (-403.613) * (-404.605) [-405.622] (-407.869) (-405.866) -- 0:00:40
      365000 -- (-404.150) [-405.944] (-408.407) (-404.281) * [-404.976] (-404.280) (-404.880) (-404.291) -- 0:00:40

      Average standard deviation of split frequencies: 0.010755

      365500 -- (-405.819) [-407.522] (-407.893) (-404.682) * (-405.174) (-405.848) (-404.787) [-409.601] -- 0:00:39
      366000 -- (-406.892) [-404.705] (-406.591) (-406.067) * (-406.850) (-409.008) [-404.951] (-406.003) -- 0:00:39
      366500 -- (-404.948) [-403.748] (-407.109) (-405.872) * (-404.809) (-409.672) [-404.730] (-405.533) -- 0:00:39
      367000 -- (-406.367) (-408.523) [-405.063] (-411.055) * (-405.186) (-407.367) (-408.709) [-406.854] -- 0:00:39
      367500 -- [-408.650] (-405.267) (-406.513) (-405.508) * (-403.988) [-404.404] (-405.805) (-404.519) -- 0:00:39
      368000 -- (-405.672) [-404.491] (-410.346) (-409.794) * (-403.694) (-406.766) [-409.404] (-407.651) -- 0:00:39
      368500 -- (-404.792) (-409.071) [-404.770] (-407.896) * [-403.372] (-407.506) (-406.800) (-406.915) -- 0:00:39
      369000 -- (-405.196) [-405.670] (-406.715) (-406.213) * (-405.005) [-403.839] (-407.338) (-407.281) -- 0:00:39
      369500 -- (-404.507) (-409.800) [-407.572] (-406.357) * [-403.167] (-406.201) (-406.692) (-405.833) -- 0:00:39
      370000 -- (-407.001) (-405.971) [-405.500] (-410.285) * [-404.711] (-404.852) (-405.260) (-404.355) -- 0:00:39

      Average standard deviation of split frequencies: 0.010238

      370500 -- (-410.125) (-403.632) (-404.893) [-405.756] * (-404.217) (-404.908) [-407.700] (-404.713) -- 0:00:39
      371000 -- (-406.130) (-406.509) [-403.601] (-407.035) * (-405.623) [-406.724] (-409.317) (-405.302) -- 0:00:38
      371500 -- (-406.724) [-404.029] (-404.922) (-407.640) * (-405.492) (-407.812) (-406.932) [-405.337] -- 0:00:38
      372000 -- (-408.755) [-404.888] (-406.277) (-404.243) * (-404.152) (-406.517) (-404.981) [-408.281] -- 0:00:38
      372500 -- [-403.356] (-403.239) (-404.506) (-406.040) * (-407.757) (-405.903) [-404.963] (-403.494) -- 0:00:38
      373000 -- (-403.615) (-404.518) [-405.291] (-405.932) * (-408.261) [-405.370] (-405.071) (-407.141) -- 0:00:38
      373500 -- (-406.057) (-409.725) [-406.809] (-405.655) * (-403.627) (-406.672) (-406.634) [-404.244] -- 0:00:38
      374000 -- [-404.290] (-405.263) (-404.943) (-410.203) * (-406.571) (-408.186) [-403.667] (-406.621) -- 0:00:38
      374500 -- (-403.533) [-404.469] (-404.827) (-406.280) * [-404.241] (-407.219) (-408.912) (-405.346) -- 0:00:38
      375000 -- [-404.955] (-404.799) (-404.192) (-406.969) * [-408.455] (-407.948) (-406.972) (-405.616) -- 0:00:38

      Average standard deviation of split frequencies: 0.009040

      375500 -- (-404.768) (-409.042) (-406.633) [-408.005] * (-404.796) (-406.011) (-404.410) [-405.332] -- 0:00:38
      376000 -- (-404.802) (-404.526) (-404.683) [-407.466] * (-406.436) [-404.005] (-404.523) (-409.287) -- 0:00:38
      376500 -- (-405.946) [-405.575] (-403.908) (-406.750) * [-403.902] (-409.023) (-404.815) (-406.922) -- 0:00:38
      377000 -- (-406.312) (-405.882) [-406.380] (-407.600) * (-404.861) [-405.423] (-407.057) (-406.571) -- 0:00:38
      377500 -- [-406.521] (-404.057) (-404.750) (-406.220) * [-403.681] (-405.102) (-405.001) (-404.274) -- 0:00:37
      378000 -- (-404.694) (-404.964) [-405.005] (-405.343) * (-404.032) (-405.821) (-404.492) [-407.028] -- 0:00:39
      378500 -- (-407.117) (-405.327) [-406.378] (-406.225) * (-403.204) (-407.107) [-407.044] (-405.284) -- 0:00:39
      379000 -- [-406.705] (-403.376) (-407.176) (-406.755) * (-405.323) [-405.220] (-405.237) (-403.958) -- 0:00:39
      379500 -- (-405.540) (-406.389) [-406.338] (-407.526) * (-404.261) (-407.173) (-404.862) [-404.167] -- 0:00:39
      380000 -- (-406.527) (-405.616) (-407.866) [-406.070] * (-406.606) (-406.192) [-403.696] (-406.491) -- 0:00:39

      Average standard deviation of split frequencies: 0.008960

      380500 -- (-404.537) [-403.514] (-408.978) (-407.899) * [-404.753] (-405.985) (-407.532) (-403.597) -- 0:00:39
      381000 -- (-403.903) [-405.438] (-411.036) (-408.198) * (-410.054) (-406.746) (-407.483) [-404.267] -- 0:00:38
      381500 -- [-405.201] (-403.454) (-406.621) (-407.895) * (-404.513) [-406.616] (-405.590) (-403.695) -- 0:00:38
      382000 -- (-408.433) (-410.749) [-406.377] (-404.287) * (-405.222) [-405.195] (-405.370) (-406.739) -- 0:00:38
      382500 -- (-405.007) (-403.620) (-404.095) [-404.930] * (-409.181) (-404.152) (-405.036) [-404.056] -- 0:00:38
      383000 -- (-406.932) (-405.139) (-405.867) [-403.789] * (-405.926) [-408.457] (-406.563) (-404.644) -- 0:00:38
      383500 -- (-406.871) (-404.555) [-407.021] (-406.295) * [-406.086] (-403.117) (-403.766) (-404.221) -- 0:00:38
      384000 -- (-404.212) (-405.561) [-403.729] (-405.371) * (-405.163) [-403.081] (-403.583) (-410.168) -- 0:00:38
      384500 -- [-409.616] (-406.670) (-403.968) (-404.146) * (-409.525) (-404.480) (-404.391) [-409.638] -- 0:00:38
      385000 -- (-406.639) [-405.530] (-404.779) (-407.782) * (-405.705) [-404.065] (-404.017) (-412.239) -- 0:00:38

      Average standard deviation of split frequencies: 0.009431

      385500 -- (-403.939) (-403.726) [-404.748] (-404.947) * (-405.598) (-409.736) [-404.468] (-406.403) -- 0:00:38
      386000 -- (-405.214) (-403.331) [-404.276] (-404.053) * (-404.091) (-405.422) (-404.701) [-409.549] -- 0:00:38
      386500 -- [-403.752] (-405.735) (-406.448) (-404.047) * [-404.547] (-404.058) (-403.796) (-405.395) -- 0:00:38
      387000 -- [-403.601] (-410.127) (-405.766) (-404.980) * (-403.901) (-404.248) [-404.623] (-407.275) -- 0:00:38
      387500 -- (-407.852) (-403.774) (-404.330) [-404.568] * (-403.812) [-407.870] (-408.191) (-406.559) -- 0:00:37
      388000 -- [-407.305] (-405.114) (-403.324) (-405.511) * (-404.015) (-405.603) [-405.022] (-408.296) -- 0:00:37
      388500 -- (-405.323) [-406.271] (-403.225) (-407.683) * (-405.503) (-404.349) [-404.350] (-405.384) -- 0:00:37
      389000 -- (-404.472) (-405.251) [-404.091] (-403.532) * [-407.281] (-405.812) (-404.805) (-405.003) -- 0:00:37
      389500 -- (-406.087) [-405.690] (-406.230) (-403.986) * (-404.599) [-404.764] (-407.387) (-409.890) -- 0:00:37
      390000 -- (-403.662) [-405.955] (-406.717) (-410.347) * (-407.174) (-405.811) [-404.221] (-406.478) -- 0:00:37

      Average standard deviation of split frequencies: 0.009653

      390500 -- [-404.224] (-406.214) (-404.596) (-413.984) * (-404.845) (-407.033) [-405.204] (-406.295) -- 0:00:37
      391000 -- (-405.555) [-405.412] (-404.138) (-408.860) * (-405.213) (-405.124) [-404.950] (-405.055) -- 0:00:37
      391500 -- (-405.032) (-405.234) [-404.529] (-408.343) * (-404.889) (-404.129) (-405.030) [-405.199] -- 0:00:37
      392000 -- (-406.557) (-404.914) (-404.469) [-405.017] * (-406.253) (-404.854) [-407.545] (-406.995) -- 0:00:37
      392500 -- [-405.173] (-405.127) (-407.748) (-404.818) * (-408.462) (-403.797) (-404.386) [-405.918] -- 0:00:37
      393000 -- (-404.329) (-403.794) (-404.560) [-404.461] * (-408.530) [-404.315] (-408.560) (-407.404) -- 0:00:37
      393500 -- (-404.598) (-403.791) [-403.998] (-404.739) * (-408.033) (-405.815) (-404.414) [-404.889] -- 0:00:36
      394000 -- (-406.199) (-403.869) (-406.450) [-405.017] * (-408.257) (-405.134) [-405.058] (-403.827) -- 0:00:36
      394500 -- (-404.010) [-404.483] (-405.050) (-407.094) * (-404.653) (-408.162) [-404.388] (-406.800) -- 0:00:36
      395000 -- (-404.632) (-404.402) (-405.322) [-404.586] * (-406.291) [-404.885] (-405.085) (-405.600) -- 0:00:38

      Average standard deviation of split frequencies: 0.009656

      395500 -- [-406.131] (-404.309) (-404.551) (-403.865) * (-405.979) [-405.486] (-403.465) (-409.261) -- 0:00:38
      396000 -- [-408.466] (-406.373) (-405.658) (-404.029) * (-406.114) (-406.194) (-405.772) [-406.916] -- 0:00:38
      396500 -- (-409.857) (-404.068) [-406.313] (-403.914) * (-410.183) (-410.078) [-403.627] (-404.981) -- 0:00:38
      397000 -- (-409.115) (-405.533) (-405.756) [-406.456] * [-406.032] (-405.624) (-405.683) (-408.577) -- 0:00:37
      397500 -- (-404.273) (-403.626) (-406.247) [-407.036] * [-405.333] (-404.060) (-405.202) (-406.248) -- 0:00:37
      398000 -- (-405.166) [-406.185] (-408.856) (-405.362) * [-406.863] (-405.387) (-406.391) (-404.026) -- 0:00:37
      398500 -- (-404.840) (-406.055) [-407.205] (-407.982) * [-404.088] (-404.530) (-410.368) (-405.011) -- 0:00:37
      399000 -- [-404.290] (-406.089) (-409.309) (-407.892) * [-405.384] (-403.431) (-404.062) (-404.243) -- 0:00:37
      399500 -- (-407.186) (-408.051) (-403.321) [-406.305] * [-405.351] (-403.948) (-407.842) (-405.590) -- 0:00:37
      400000 -- (-408.026) (-410.538) [-405.292] (-409.178) * (-404.438) [-404.143] (-406.163) (-405.335) -- 0:00:37

      Average standard deviation of split frequencies: 0.009216

      400500 -- (-404.874) (-412.258) [-405.696] (-404.000) * [-403.874] (-404.952) (-407.728) (-405.091) -- 0:00:37
      401000 -- (-407.867) [-403.601] (-406.069) (-404.919) * (-405.806) [-404.161] (-404.458) (-407.395) -- 0:00:37
      401500 -- (-406.964) (-404.102) [-405.923] (-408.457) * (-405.690) (-403.184) [-406.037] (-404.969) -- 0:00:37
      402000 -- (-408.026) (-406.254) (-407.138) [-405.114] * (-406.213) (-404.485) [-405.394] (-403.561) -- 0:00:37
      402500 -- [-404.382] (-405.579) (-407.413) (-409.042) * (-405.128) (-405.949) (-405.550) [-406.762] -- 0:00:37
      403000 -- (-405.035) (-404.657) [-403.459] (-410.227) * [-405.028] (-405.197) (-406.226) (-405.029) -- 0:00:37
      403500 -- (-403.523) [-404.794] (-403.304) (-406.160) * [-405.952] (-404.601) (-405.077) (-405.243) -- 0:00:36
      404000 -- (-405.036) [-403.945] (-404.695) (-404.300) * (-406.431) (-405.423) (-404.290) [-406.809] -- 0:00:36
      404500 -- [-403.699] (-404.997) (-406.580) (-405.762) * [-405.718] (-404.308) (-405.165) (-405.011) -- 0:00:36
      405000 -- (-406.026) [-406.587] (-415.082) (-404.271) * (-403.200) (-407.712) (-404.309) [-404.882] -- 0:00:36

      Average standard deviation of split frequencies: 0.010108

      405500 -- [-406.679] (-407.192) (-405.755) (-406.699) * [-403.643] (-407.095) (-408.824) (-404.255) -- 0:00:36
      406000 -- (-408.024) (-406.933) (-404.223) [-404.379] * (-407.158) (-406.391) (-405.231) [-404.060] -- 0:00:36
      406500 -- (-405.247) (-404.662) (-413.596) [-403.581] * [-403.996] (-406.928) (-406.286) (-404.235) -- 0:00:36
      407000 -- (-405.032) (-407.091) [-405.567] (-404.037) * [-405.712] (-409.151) (-406.720) (-404.683) -- 0:00:36
      407500 -- (-404.683) (-403.856) [-406.555] (-404.768) * (-404.661) [-404.603] (-404.944) (-405.786) -- 0:00:36
      408000 -- [-405.950] (-403.544) (-409.276) (-404.806) * (-405.538) (-403.715) (-409.668) [-408.538] -- 0:00:36
      408500 -- (-406.410) (-404.265) (-407.052) [-407.909] * (-406.500) (-403.884) [-406.871] (-405.415) -- 0:00:36
      409000 -- [-406.279] (-403.469) (-404.721) (-408.161) * (-404.392) (-405.756) [-404.197] (-403.203) -- 0:00:36
      409500 -- (-405.661) [-405.576] (-405.820) (-411.491) * (-404.706) (-404.098) [-404.231] (-404.463) -- 0:00:36
      410000 -- (-406.771) [-403.762] (-406.878) (-406.174) * (-407.758) (-404.531) (-406.426) [-405.163] -- 0:00:35

      Average standard deviation of split frequencies: 0.010196

      410500 -- [-404.817] (-404.532) (-404.698) (-407.298) * [-404.976] (-403.925) (-410.161) (-405.133) -- 0:00:35
      411000 -- (-405.430) (-404.926) (-409.335) [-406.194] * [-404.306] (-404.791) (-404.719) (-404.197) -- 0:00:35
      411500 -- [-403.349] (-408.378) (-410.201) (-405.620) * (-407.772) (-407.268) (-403.368) [-404.174] -- 0:00:37
      412000 -- (-405.121) (-411.103) [-407.503] (-404.060) * (-403.824) (-405.110) [-407.330] (-405.979) -- 0:00:37
      412500 -- (-407.595) (-403.988) (-406.001) [-404.972] * (-408.653) (-406.446) (-408.237) [-404.306] -- 0:00:37
      413000 -- [-404.419] (-408.333) (-407.887) (-405.111) * [-405.301] (-409.840) (-405.765) (-405.327) -- 0:00:36
      413500 -- (-403.514) (-405.816) (-410.006) [-406.429] * (-404.060) (-410.757) (-403.518) [-404.540] -- 0:00:36
      414000 -- (-405.249) [-405.413] (-407.397) (-405.186) * [-404.704] (-406.922) (-405.063) (-405.900) -- 0:00:36
      414500 -- (-404.902) [-404.508] (-403.724) (-404.083) * (-408.503) [-407.606] (-405.717) (-404.305) -- 0:00:36
      415000 -- (-407.002) [-404.754] (-406.131) (-403.996) * [-403.929] (-404.228) (-408.859) (-404.218) -- 0:00:36

      Average standard deviation of split frequencies: 0.010865

      415500 -- (-410.405) (-407.430) [-404.215] (-405.057) * [-403.786] (-408.825) (-404.906) (-404.408) -- 0:00:36
      416000 -- (-406.428) (-407.715) [-404.012] (-406.722) * (-405.594) (-407.772) [-408.116] (-406.108) -- 0:00:36
      416500 -- [-404.402] (-406.642) (-405.014) (-404.468) * (-405.654) (-410.462) (-406.451) [-405.203] -- 0:00:36
      417000 -- (-404.442) (-404.621) (-404.974) [-405.997] * (-405.381) (-407.253) [-405.962] (-405.074) -- 0:00:36
      417500 -- (-404.442) (-404.321) [-403.829] (-405.407) * (-406.191) (-407.653) (-405.203) [-404.416] -- 0:00:36
      418000 -- (-403.326) [-406.038] (-405.002) (-406.477) * (-407.195) (-404.230) (-407.337) [-403.527] -- 0:00:36
      418500 -- [-404.063] (-404.568) (-403.806) (-406.035) * (-403.781) [-406.122] (-406.307) (-408.048) -- 0:00:36
      419000 -- (-407.316) [-407.766] (-404.586) (-405.837) * (-404.620) (-406.554) (-405.522) [-405.396] -- 0:00:36
      419500 -- [-405.256] (-405.632) (-405.199) (-404.881) * (-404.017) (-404.133) [-405.762] (-404.206) -- 0:00:35
      420000 -- (-409.992) [-404.748] (-406.746) (-407.963) * [-404.515] (-406.449) (-405.356) (-406.697) -- 0:00:35

      Average standard deviation of split frequencies: 0.009035

      420500 -- [-405.141] (-404.302) (-404.772) (-404.597) * [-404.825] (-404.885) (-407.765) (-405.077) -- 0:00:35
      421000 -- [-405.202] (-405.018) (-405.581) (-404.697) * (-404.403) [-404.102] (-408.397) (-404.473) -- 0:00:35
      421500 -- [-404.847] (-404.478) (-403.926) (-405.500) * (-404.075) (-404.085) (-405.696) [-404.120] -- 0:00:35
      422000 -- [-404.100] (-405.288) (-406.286) (-403.682) * (-405.458) [-404.166] (-403.633) (-404.328) -- 0:00:35
      422500 -- [-407.087] (-404.253) (-404.190) (-408.962) * (-403.551) [-403.411] (-405.350) (-405.212) -- 0:00:35
      423000 -- (-411.276) (-405.529) (-403.936) [-406.298] * (-406.065) (-404.082) (-407.864) [-403.495] -- 0:00:35
      423500 -- (-408.201) (-404.136) [-404.693] (-404.979) * (-403.838) (-405.755) (-405.568) [-405.263] -- 0:00:35
      424000 -- (-403.541) (-405.451) [-405.899] (-406.660) * (-405.149) (-404.288) [-406.810] (-403.554) -- 0:00:35
      424500 -- (-406.913) [-405.304] (-403.242) (-410.941) * [-406.480] (-404.364) (-408.232) (-403.682) -- 0:00:35
      425000 -- (-405.059) (-403.987) [-403.527] (-404.019) * (-404.939) [-408.327] (-404.536) (-403.854) -- 0:00:35

      Average standard deviation of split frequencies: 0.008503

      425500 -- (-403.485) [-405.607] (-406.400) (-404.292) * [-404.492] (-409.270) (-405.565) (-408.791) -- 0:00:35
      426000 -- (-405.747) (-404.116) [-409.720] (-405.311) * (-404.220) (-408.716) [-407.606] (-408.209) -- 0:00:35
      426500 -- (-405.815) (-403.760) [-403.499] (-406.710) * (-405.402) (-408.857) (-404.769) [-406.461] -- 0:00:34
      427000 -- [-407.039] (-406.945) (-405.980) (-406.826) * (-404.130) (-403.704) [-403.763] (-406.455) -- 0:00:34
      427500 -- [-404.757] (-404.414) (-404.299) (-405.320) * [-405.218] (-403.649) (-403.170) (-404.302) -- 0:00:34
      428000 -- [-405.541] (-405.528) (-406.031) (-408.014) * (-405.532) (-409.483) [-405.015] (-405.698) -- 0:00:34
      428500 -- (-406.435) (-407.288) (-404.011) [-403.821] * (-405.649) (-408.261) (-404.722) [-405.589] -- 0:00:36
      429000 -- (-406.814) (-407.430) (-404.815) [-404.573] * (-403.637) (-405.926) (-404.554) [-406.344] -- 0:00:35
      429500 -- (-405.885) (-412.336) (-405.111) [-403.612] * (-405.570) (-406.090) (-403.986) [-405.845] -- 0:00:35
      430000 -- [-406.092] (-410.559) (-406.026) (-403.659) * (-405.565) [-404.720] (-407.340) (-405.951) -- 0:00:35

      Average standard deviation of split frequencies: 0.008526

      430500 -- [-405.848] (-408.838) (-403.745) (-406.096) * [-405.610] (-407.224) (-405.130) (-408.079) -- 0:00:35
      431000 -- (-406.748) [-411.489] (-404.942) (-408.573) * (-406.170) [-404.118] (-404.120) (-404.924) -- 0:00:35
      431500 -- (-404.028) [-410.861] (-405.734) (-403.962) * [-407.071] (-404.407) (-410.421) (-410.738) -- 0:00:35
      432000 -- [-404.195] (-406.730) (-404.833) (-405.572) * (-405.429) (-404.146) [-409.305] (-405.650) -- 0:00:35
      432500 -- [-405.778] (-405.584) (-405.126) (-405.477) * (-404.540) [-405.014] (-407.128) (-406.745) -- 0:00:35
      433000 -- (-403.301) (-406.774) (-405.914) [-409.632] * (-403.731) [-404.427] (-405.156) (-404.951) -- 0:00:35
      433500 -- [-404.537] (-404.838) (-404.953) (-405.532) * (-407.029) (-406.352) [-403.717] (-406.472) -- 0:00:35
      434000 -- [-406.217] (-409.218) (-408.205) (-407.827) * (-406.617) [-405.551] (-403.946) (-404.074) -- 0:00:35
      434500 -- (-405.390) (-408.626) [-404.171] (-406.604) * (-403.765) (-406.699) [-406.237] (-405.205) -- 0:00:35
      435000 -- (-414.404) (-403.859) [-404.807] (-413.577) * (-404.876) (-403.488) [-404.630] (-404.327) -- 0:00:35

      Average standard deviation of split frequencies: 0.009276

      435500 -- (-405.724) (-406.425) (-406.740) [-406.235] * (-405.439) (-403.796) (-406.698) [-403.505] -- 0:00:34
      436000 -- (-407.765) (-406.083) (-409.370) [-406.255] * (-404.727) [-403.810] (-405.542) (-406.023) -- 0:00:34
      436500 -- (-406.762) [-404.003] (-405.841) (-406.453) * (-404.062) (-407.380) (-407.527) [-406.070] -- 0:00:34
      437000 -- (-405.526) (-403.801) [-404.452] (-407.887) * [-405.771] (-411.591) (-404.103) (-405.997) -- 0:00:34
      437500 -- (-409.234) [-405.377] (-407.068) (-408.997) * (-406.598) (-405.345) (-407.023) [-405.136] -- 0:00:34
      438000 -- (-405.943) (-403.508) (-406.830) [-404.546] * (-404.652) (-403.390) [-404.632] (-405.550) -- 0:00:34
      438500 -- (-405.208) (-409.265) (-407.823) [-406.543] * (-407.045) (-405.433) [-405.189] (-406.002) -- 0:00:34
      439000 -- [-406.523] (-405.930) (-404.682) (-408.195) * (-406.818) (-405.261) (-406.668) [-405.801] -- 0:00:34
      439500 -- (-407.493) [-403.603] (-406.415) (-410.430) * (-408.225) (-404.770) (-405.006) [-406.045] -- 0:00:34
      440000 -- [-407.695] (-404.585) (-405.296) (-407.021) * [-406.531] (-404.151) (-405.961) (-407.374) -- 0:00:34

      Average standard deviation of split frequencies: 0.009008

      440500 -- (-410.511) (-405.212) (-405.103) [-404.929] * (-405.365) [-405.392] (-408.933) (-404.054) -- 0:00:34
      441000 -- (-405.455) [-404.102] (-408.156) (-404.268) * (-406.257) [-403.891] (-407.596) (-406.992) -- 0:00:34
      441500 -- (-405.118) (-404.580) [-405.082] (-405.194) * (-404.614) (-405.715) (-405.825) [-403.270] -- 0:00:34
      442000 -- (-404.945) (-407.295) (-407.083) [-407.894] * [-408.309] (-404.159) (-406.281) (-405.681) -- 0:00:34
      442500 -- (-406.899) (-408.565) (-406.420) [-405.108] * (-406.878) [-403.136] (-404.140) (-403.899) -- 0:00:34
      443000 -- [-404.570] (-404.308) (-404.398) (-408.099) * (-403.795) (-404.483) [-406.149] (-404.722) -- 0:00:33
      443500 -- (-404.532) (-407.996) [-403.676] (-406.381) * (-407.867) [-404.735] (-403.711) (-404.409) -- 0:00:33
      444000 -- (-404.405) [-405.705] (-403.567) (-408.313) * (-406.474) (-403.123) (-405.287) [-407.351] -- 0:00:33
      444500 -- (-404.528) (-407.699) [-404.923] (-409.808) * (-405.853) (-405.464) (-407.042) [-404.320] -- 0:00:33
      445000 -- (-404.478) (-405.871) [-406.477] (-403.081) * (-405.645) (-408.655) (-405.044) [-404.507] -- 0:00:33

      Average standard deviation of split frequencies: 0.008845

      445500 -- (-404.841) (-408.162) [-404.267] (-403.438) * [-406.463] (-410.519) (-407.269) (-405.330) -- 0:00:34
      446000 -- [-407.480] (-408.372) (-403.048) (-404.090) * (-408.293) [-405.813] (-404.332) (-409.464) -- 0:00:34
      446500 -- [-404.455] (-406.355) (-405.408) (-408.094) * (-404.669) (-404.586) (-405.667) [-410.373] -- 0:00:34
      447000 -- (-404.318) [-405.838] (-408.789) (-410.568) * [-403.568] (-407.434) (-406.509) (-404.306) -- 0:00:34
      447500 -- [-406.555] (-404.696) (-407.183) (-405.485) * (-403.166) [-406.863] (-404.436) (-406.461) -- 0:00:34
      448000 -- (-405.018) [-405.755] (-404.607) (-406.756) * (-404.777) (-410.573) [-403.596] (-405.613) -- 0:00:34
      448500 -- [-405.685] (-404.660) (-405.585) (-404.731) * (-406.047) (-406.033) (-405.384) [-405.634] -- 0:00:34
      449000 -- (-404.837) (-406.078) (-406.207) [-407.746] * (-408.379) [-404.272] (-404.093) (-405.977) -- 0:00:34
      449500 -- [-405.195] (-405.668) (-404.361) (-404.452) * (-405.661) (-403.495) (-404.249) [-405.049] -- 0:00:34
      450000 -- [-405.435] (-405.071) (-405.530) (-404.815) * (-404.669) (-405.464) [-403.585] (-405.435) -- 0:00:34

      Average standard deviation of split frequencies: 0.007873

      450500 -- [-406.607] (-404.375) (-405.954) (-405.964) * (-404.405) (-409.317) [-403.805] (-405.628) -- 0:00:34
      451000 -- [-405.687] (-404.708) (-407.493) (-403.425) * (-403.941) [-405.081] (-407.302) (-404.835) -- 0:00:34
      451500 -- [-406.090] (-406.340) (-404.223) (-405.924) * (-403.586) [-404.630] (-405.375) (-407.232) -- 0:00:34
      452000 -- [-407.863] (-405.293) (-404.363) (-406.693) * (-404.934) (-406.913) [-407.292] (-404.976) -- 0:00:33
      452500 -- (-408.567) [-404.643] (-404.043) (-410.347) * (-404.242) (-406.432) (-405.012) [-404.776] -- 0:00:33
      453000 -- (-405.620) [-406.234] (-405.077) (-405.683) * (-409.364) [-406.058] (-407.226) (-404.914) -- 0:00:33
      453500 -- (-403.607) [-407.468] (-407.145) (-404.901) * (-405.010) (-404.235) [-406.928] (-406.422) -- 0:00:33
      454000 -- [-403.062] (-407.111) (-405.448) (-405.704) * [-404.542] (-404.204) (-410.378) (-408.479) -- 0:00:33
      454500 -- (-403.355) [-405.755] (-405.596) (-406.099) * (-403.182) (-407.220) [-406.099] (-409.691) -- 0:00:33
      455000 -- [-404.767] (-403.114) (-408.489) (-407.070) * (-408.357) (-408.650) (-403.330) [-408.017] -- 0:00:33

      Average standard deviation of split frequencies: 0.007672

      455500 -- (-403.749) (-405.127) [-405.249] (-404.601) * [-405.414] (-411.363) (-404.680) (-405.670) -- 0:00:33
      456000 -- (-407.145) (-406.018) [-404.571] (-408.154) * (-404.523) (-405.538) [-404.153] (-406.748) -- 0:00:33
      456500 -- (-403.493) (-405.103) (-405.673) [-404.394] * (-405.720) [-406.892] (-405.920) (-405.958) -- 0:00:33
      457000 -- (-407.104) (-404.780) [-404.688] (-405.203) * (-406.869) (-405.248) (-405.030) [-404.582] -- 0:00:33
      457500 -- (-406.558) [-407.487] (-405.041) (-407.021) * (-407.212) (-404.979) (-405.355) [-407.808] -- 0:00:33
      458000 -- (-405.156) (-403.595) [-406.613] (-406.912) * (-407.281) (-405.769) (-404.363) [-405.079] -- 0:00:33
      458500 -- [-404.429] (-405.653) (-404.835) (-404.088) * [-406.628] (-410.535) (-404.958) (-410.635) -- 0:00:33
      459000 -- [-404.496] (-404.743) (-404.258) (-407.531) * (-404.411) (-403.784) (-404.206) [-406.969] -- 0:00:33
      459500 -- [-406.424] (-404.266) (-408.608) (-406.406) * (-411.033) (-404.563) (-404.690) [-407.764] -- 0:00:32
      460000 -- (-406.550) (-403.529) (-404.747) [-405.322] * (-407.293) [-404.895] (-405.579) (-404.774) -- 0:00:32

      Average standard deviation of split frequencies: 0.007959

      460500 -- [-406.304] (-403.852) (-409.026) (-405.834) * (-404.886) (-410.215) (-407.044) [-404.132] -- 0:00:32
      461000 -- [-405.491] (-405.892) (-407.413) (-406.206) * (-405.804) (-408.692) (-406.227) [-404.220] -- 0:00:32
      461500 -- (-409.884) (-404.369) (-405.783) [-405.116] * [-406.042] (-404.217) (-406.748) (-411.407) -- 0:00:32
      462000 -- (-404.430) (-405.071) (-404.631) [-403.046] * (-404.149) (-404.081) (-406.277) [-408.180] -- 0:00:33
      462500 -- (-404.567) (-404.595) [-404.216] (-403.605) * [-407.536] (-407.697) (-405.048) (-405.979) -- 0:00:33
      463000 -- (-406.255) [-406.271] (-405.234) (-404.861) * (-406.539) (-404.045) (-406.257) [-403.837] -- 0:00:33
      463500 -- (-406.606) (-404.291) (-406.651) [-403.726] * (-406.044) (-408.299) (-411.710) [-405.158] -- 0:00:33
      464000 -- (-404.246) (-405.153) (-404.145) [-404.898] * (-405.869) (-409.853) (-406.605) [-406.247] -- 0:00:33
      464500 -- (-407.703) (-403.730) (-404.203) [-405.711] * (-404.754) (-404.924) (-403.610) [-406.183] -- 0:00:33
      465000 -- (-404.147) (-406.109) (-404.651) [-404.167] * (-406.716) (-405.089) [-404.839] (-408.702) -- 0:00:33

      Average standard deviation of split frequencies: 0.006856

      465500 -- (-406.188) (-404.737) (-407.690) [-404.942] * (-407.589) (-405.936) (-405.155) [-406.272] -- 0:00:33
      466000 -- (-404.628) [-405.873] (-404.467) (-403.822) * (-405.489) (-404.852) (-406.001) [-403.885] -- 0:00:33
      466500 -- (-404.209) (-406.993) [-406.226] (-403.750) * (-404.674) (-405.053) (-404.455) [-404.641] -- 0:00:33
      467000 -- [-405.473] (-406.150) (-405.806) (-404.964) * [-411.259] (-403.474) (-404.858) (-405.872) -- 0:00:33
      467500 -- (-406.406) [-403.845] (-403.750) (-404.364) * (-404.600) (-403.383) [-406.443] (-406.125) -- 0:00:33
      468000 -- (-404.818) (-403.247) (-406.244) [-405.389] * (-405.206) [-404.459] (-405.123) (-403.459) -- 0:00:32
      468500 -- (-403.354) (-409.492) (-404.718) [-406.546] * (-404.546) [-404.130] (-404.072) (-409.962) -- 0:00:32
      469000 -- (-406.229) [-406.587] (-406.283) (-404.578) * (-404.078) (-405.848) (-404.891) [-408.469] -- 0:00:32
      469500 -- (-405.538) [-404.979] (-405.653) (-405.802) * (-403.841) [-406.144] (-403.850) (-405.139) -- 0:00:32
      470000 -- (-404.351) [-404.690] (-408.282) (-409.831) * (-404.949) [-406.327] (-406.729) (-404.610) -- 0:00:32

      Average standard deviation of split frequencies: 0.007067

      470500 -- (-405.680) (-404.659) (-404.858) [-404.821] * (-408.326) (-407.446) (-404.749) [-403.866] -- 0:00:32
      471000 -- (-409.900) [-404.394] (-408.281) (-409.184) * (-403.338) [-407.383] (-407.303) (-407.990) -- 0:00:32
      471500 -- [-404.820] (-404.386) (-406.749) (-404.370) * [-403.890] (-407.924) (-406.927) (-403.668) -- 0:00:32
      472000 -- (-405.214) [-405.362] (-405.888) (-405.575) * (-406.576) (-404.824) (-408.859) [-404.841] -- 0:00:32
      472500 -- (-407.081) [-406.645] (-406.355) (-404.942) * (-407.178) (-407.450) (-405.180) [-404.283] -- 0:00:32
      473000 -- (-405.144) (-403.655) [-410.358] (-406.109) * (-407.794) (-405.964) (-405.375) [-404.506] -- 0:00:32
      473500 -- (-409.775) [-405.252] (-411.880) (-403.606) * [-405.216] (-406.058) (-404.975) (-404.938) -- 0:00:32
      474000 -- (-408.627) [-404.493] (-405.378) (-406.027) * [-406.706] (-403.908) (-407.687) (-405.933) -- 0:00:32
      474500 -- (-407.413) [-404.760] (-406.262) (-404.675) * [-404.315] (-403.819) (-405.930) (-405.586) -- 0:00:32
      475000 -- (-409.273) [-404.720] (-404.084) (-407.088) * (-409.172) [-403.473] (-405.625) (-403.897) -- 0:00:32

      Average standard deviation of split frequencies: 0.007538

      475500 -- (-404.603) (-409.441) (-405.077) [-410.262] * (-404.352) [-404.015] (-404.452) (-404.972) -- 0:00:31
      476000 -- (-403.948) [-404.024] (-403.885) (-407.914) * (-406.157) (-405.328) (-404.154) [-404.278] -- 0:00:31
      476500 -- (-405.148) (-403.166) [-404.075] (-406.780) * [-404.865] (-405.704) (-406.851) (-404.845) -- 0:00:31
      477000 -- (-404.920) (-406.117) [-403.648] (-407.491) * [-403.520] (-405.129) (-403.792) (-405.539) -- 0:00:31
      477500 -- (-409.879) (-406.431) (-403.629) [-405.705] * (-405.534) [-405.097] (-408.896) (-404.194) -- 0:00:31
      478000 -- (-408.110) (-406.898) [-404.536] (-405.566) * [-405.110] (-405.138) (-407.298) (-404.001) -- 0:00:32
      478500 -- [-404.394] (-404.929) (-403.834) (-404.235) * (-405.373) [-406.046] (-404.572) (-403.540) -- 0:00:32
      479000 -- (-408.557) [-404.419] (-412.220) (-404.845) * [-404.564] (-407.638) (-406.280) (-405.316) -- 0:00:32
      479500 -- (-406.195) (-403.770) [-410.065] (-403.776) * (-404.284) [-404.342] (-407.219) (-404.281) -- 0:00:32
      480000 -- (-405.273) (-410.997) [-405.770] (-406.488) * [-403.699] (-405.439) (-403.561) (-404.477) -- 0:00:32

      Average standard deviation of split frequencies: 0.008009

      480500 -- (-410.313) (-403.881) [-405.065] (-404.464) * (-403.401) [-407.438] (-406.761) (-405.131) -- 0:00:32
      481000 -- (-405.135) (-404.917) (-403.616) [-404.815] * (-403.826) [-403.584] (-406.058) (-407.753) -- 0:00:32
      481500 -- (-404.302) (-404.342) (-405.246) [-403.711] * [-404.328] (-403.681) (-405.880) (-406.383) -- 0:00:32
      482000 -- (-410.507) (-406.108) [-407.351] (-403.925) * [-404.191] (-405.320) (-403.747) (-404.647) -- 0:00:32
      482500 -- (-409.448) (-403.882) (-409.158) [-405.896] * (-406.644) [-405.819] (-408.878) (-406.771) -- 0:00:32
      483000 -- (-405.266) (-403.236) [-406.655] (-407.033) * (-405.790) (-404.028) [-408.083] (-405.201) -- 0:00:32
      483500 -- (-406.633) [-405.876] (-406.642) (-406.158) * (-404.398) (-404.810) [-405.299] (-406.077) -- 0:00:32
      484000 -- (-405.681) (-407.201) (-407.753) [-404.732] * [-406.707] (-407.216) (-404.386) (-406.949) -- 0:00:31
      484500 -- (-405.421) (-404.014) [-408.279] (-403.927) * [-408.064] (-407.023) (-404.575) (-404.159) -- 0:00:31
      485000 -- (-406.958) [-404.188] (-406.037) (-408.982) * [-403.403] (-404.196) (-405.601) (-410.434) -- 0:00:31

      Average standard deviation of split frequencies: 0.008029

      485500 -- (-407.138) (-404.302) (-404.588) [-403.344] * [-406.522] (-406.949) (-408.541) (-403.880) -- 0:00:31
      486000 -- [-407.178] (-406.457) (-404.134) (-403.699) * [-404.587] (-405.887) (-403.584) (-406.175) -- 0:00:31
      486500 -- [-406.899] (-406.245) (-403.326) (-403.669) * (-405.346) (-408.669) [-406.330] (-406.653) -- 0:00:31
      487000 -- (-406.855) [-405.488] (-405.634) (-404.758) * (-407.122) (-406.211) [-405.116] (-405.519) -- 0:00:31
      487500 -- (-406.555) (-404.246) [-406.226] (-406.528) * (-405.116) (-408.256) [-404.862] (-407.659) -- 0:00:31
      488000 -- (-405.074) (-404.383) (-404.777) [-404.273] * (-404.368) (-404.617) (-405.914) [-404.703] -- 0:00:31
      488500 -- (-405.572) (-404.005) (-404.191) [-405.730] * (-405.912) (-404.705) [-403.960] (-403.665) -- 0:00:31
      489000 -- (-404.901) [-406.694] (-408.003) (-406.522) * (-405.710) (-404.307) (-405.386) [-407.024] -- 0:00:31
      489500 -- [-404.561] (-407.557) (-405.553) (-404.660) * (-404.997) (-405.454) [-406.094] (-411.178) -- 0:00:31
      490000 -- (-404.126) (-407.081) [-404.466] (-404.514) * (-405.659) [-407.309] (-405.733) (-408.303) -- 0:00:31

      Average standard deviation of split frequencies: 0.007686

      490500 -- (-407.143) [-405.190] (-404.839) (-404.153) * [-405.417] (-411.583) (-403.637) (-406.579) -- 0:00:31
      491000 -- (-409.078) (-405.823) [-406.480] (-412.468) * (-404.118) (-405.249) [-404.112] (-409.990) -- 0:00:31
      491500 -- [-407.029] (-408.063) (-406.115) (-413.755) * (-405.268) (-404.336) [-404.794] (-404.175) -- 0:00:31
      492000 -- [-403.673] (-404.764) (-405.122) (-407.805) * (-407.477) (-403.703) [-405.093] (-406.299) -- 0:00:30
      492500 -- (-405.719) (-407.900) (-405.777) [-407.266] * [-404.643] (-407.398) (-406.106) (-408.216) -- 0:00:30
      493000 -- (-405.535) (-404.579) (-404.942) [-403.722] * (-405.074) (-405.550) [-406.299] (-404.012) -- 0:00:31
      493500 -- (-405.869) [-404.335] (-407.726) (-403.133) * (-404.381) (-404.297) (-404.790) [-404.059] -- 0:00:31
      494000 -- (-405.243) (-410.948) (-407.421) [-405.839] * (-403.699) (-403.099) [-404.419] (-405.065) -- 0:00:31
      494500 -- (-404.776) [-403.935] (-406.720) (-404.784) * (-405.893) [-405.020] (-403.936) (-407.092) -- 0:00:31
      495000 -- (-407.736) (-403.451) [-407.083] (-403.610) * (-404.034) (-404.932) [-403.486] (-403.833) -- 0:00:31

      Average standard deviation of split frequencies: 0.007603

      495500 -- (-405.469) (-403.448) [-405.868] (-406.548) * (-404.505) (-405.234) [-407.084] (-406.431) -- 0:00:31
      496000 -- (-405.886) (-407.163) (-408.022) [-404.367] * (-406.442) (-406.719) [-404.426] (-409.197) -- 0:00:31
      496500 -- (-404.981) [-404.710] (-404.049) (-406.090) * [-404.224] (-406.935) (-403.920) (-408.349) -- 0:00:31
      497000 -- (-406.133) [-404.717] (-404.668) (-408.477) * (-408.596) (-406.536) (-404.586) [-404.336] -- 0:00:31
      497500 -- (-404.153) (-403.772) [-407.349] (-409.564) * (-406.046) (-403.825) [-405.524] (-407.830) -- 0:00:31
      498000 -- (-404.152) (-403.981) (-407.177) [-405.612] * [-405.023] (-406.080) (-403.323) (-404.312) -- 0:00:31
      498500 -- (-412.120) (-405.204) [-409.236] (-405.406) * (-404.546) (-406.782) [-403.528] (-410.403) -- 0:00:31
      499000 -- [-407.589] (-405.997) (-404.719) (-405.594) * (-405.738) (-404.764) [-408.093] (-403.782) -- 0:00:31
      499500 -- (-407.611) (-409.752) [-404.956] (-408.930) * [-405.214] (-405.128) (-411.024) (-405.492) -- 0:00:31
      500000 -- (-407.544) (-405.069) (-405.190) [-408.506] * (-405.384) (-404.459) [-404.439] (-403.600) -- 0:00:31

      Average standard deviation of split frequencies: 0.007794

      500500 -- (-406.749) (-405.232) (-407.949) [-403.717] * (-404.200) [-404.811] (-407.790) (-404.639) -- 0:00:30
      501000 -- (-405.758) [-404.910] (-407.621) (-408.213) * (-406.834) (-405.616) (-407.104) [-408.675] -- 0:00:30
      501500 -- (-406.960) (-404.218) [-410.158] (-405.344) * [-407.135] (-406.389) (-404.990) (-407.512) -- 0:00:30
      502000 -- (-405.761) (-404.007) (-404.499) [-404.143] * [-405.209] (-404.684) (-405.933) (-404.094) -- 0:00:30
      502500 -- (-403.969) [-404.743] (-405.407) (-408.814) * (-405.578) (-405.896) (-407.566) [-405.158] -- 0:00:30
      503000 -- (-403.694) (-403.516) [-407.300] (-408.597) * (-404.783) (-403.549) [-404.059] (-410.184) -- 0:00:30
      503500 -- [-404.647] (-405.169) (-404.138) (-405.183) * (-405.708) (-405.236) [-403.822] (-406.690) -- 0:00:30
      504000 -- [-404.290] (-406.086) (-403.773) (-407.945) * (-408.069) (-408.316) (-403.691) [-404.781] -- 0:00:30
      504500 -- (-406.177) (-406.124) (-404.528) [-407.369] * (-406.565) [-404.382] (-403.782) (-403.452) -- 0:00:30
      505000 -- (-403.582) [-406.373] (-405.484) (-406.292) * (-405.537) (-405.556) [-405.626] (-405.820) -- 0:00:30

      Average standard deviation of split frequencies: 0.008090

      505500 -- (-407.038) (-405.326) [-404.558] (-405.144) * [-405.006] (-406.284) (-403.761) (-406.258) -- 0:00:30
      506000 -- (-406.502) (-404.848) [-403.594] (-403.536) * (-405.553) (-404.234) (-405.374) [-405.554] -- 0:00:30
      506500 -- [-404.825] (-404.273) (-408.594) (-406.091) * (-410.048) (-408.024) (-405.216) [-407.242] -- 0:00:30
      507000 -- [-404.421] (-406.196) (-403.664) (-407.143) * [-407.153] (-409.306) (-404.473) (-408.998) -- 0:00:30
      507500 -- [-403.516] (-406.033) (-405.169) (-408.476) * [-404.982] (-404.547) (-405.142) (-411.899) -- 0:00:30
      508000 -- (-407.028) (-405.270) (-404.188) [-407.990] * (-405.721) [-403.956] (-403.788) (-404.689) -- 0:00:30
      508500 -- [-408.087] (-404.558) (-405.182) (-407.541) * (-404.606) [-404.381] (-403.896) (-403.870) -- 0:00:29
      509000 -- (-406.302) (-404.331) (-407.100) [-406.214] * [-408.471] (-407.947) (-404.800) (-405.243) -- 0:00:30
      509500 -- (-406.175) (-407.445) [-406.548] (-406.399) * (-408.290) [-404.705] (-404.227) (-409.026) -- 0:00:30
      510000 -- [-406.548] (-405.858) (-405.400) (-411.462) * (-407.786) [-404.650] (-406.476) (-404.812) -- 0:00:30

      Average standard deviation of split frequencies: 0.007774

      510500 -- [-405.802] (-404.801) (-403.654) (-406.906) * (-410.729) (-404.882) (-408.943) [-407.248] -- 0:00:30
      511000 -- (-405.528) (-404.822) [-403.520] (-405.281) * (-406.031) (-403.343) [-405.973] (-409.906) -- 0:00:30
      511500 -- (-404.796) (-403.855) (-404.174) [-404.650] * (-406.089) [-404.723] (-403.394) (-405.768) -- 0:00:30
      512000 -- (-405.180) [-407.462] (-404.262) (-407.677) * (-404.991) (-404.249) (-406.373) [-406.589] -- 0:00:30
      512500 -- (-405.474) (-404.155) (-407.788) [-407.308] * (-404.230) (-404.103) (-405.330) [-411.921] -- 0:00:30
      513000 -- [-404.747] (-408.762) (-407.053) (-403.754) * (-405.701) (-403.262) (-404.720) [-404.226] -- 0:00:30
      513500 -- (-406.088) (-405.289) (-404.386) [-403.732] * (-405.066) (-403.388) (-408.831) [-406.395] -- 0:00:30
      514000 -- (-417.140) [-403.627] (-406.005) (-407.151) * (-405.300) (-405.777) [-403.961] (-404.425) -- 0:00:30
      514500 -- (-407.524) (-404.461) [-405.508] (-403.833) * (-403.201) (-407.326) (-406.783) [-404.335] -- 0:00:30
      515000 -- (-405.945) (-403.587) [-404.721] (-406.356) * (-406.028) [-407.547] (-404.688) (-405.693) -- 0:00:30

      Average standard deviation of split frequencies: 0.006953

      515500 -- [-404.848] (-406.084) (-405.643) (-405.948) * (-405.053) [-405.342] (-406.147) (-409.538) -- 0:00:30
      516000 -- (-405.915) [-403.252] (-404.209) (-408.268) * (-405.574) (-407.477) [-404.223] (-404.217) -- 0:00:30
      516500 -- (-404.006) (-407.176) [-404.220] (-407.791) * [-407.148] (-406.341) (-403.184) (-405.200) -- 0:00:29
      517000 -- (-404.187) (-405.380) [-408.082] (-403.641) * (-403.431) [-405.747] (-403.992) (-403.829) -- 0:00:29
      517500 -- [-405.982] (-404.702) (-404.422) (-404.163) * (-403.423) (-410.161) (-404.163) [-406.794] -- 0:00:29
      518000 -- (-405.608) [-407.209] (-405.789) (-406.096) * (-406.873) (-406.705) [-403.755] (-408.402) -- 0:00:29
      518500 -- (-408.524) [-404.279] (-406.847) (-404.301) * (-409.318) [-408.414] (-403.804) (-403.368) -- 0:00:29
      519000 -- (-409.084) [-404.801] (-407.669) (-403.193) * [-407.229] (-408.186) (-404.793) (-409.134) -- 0:00:29
      519500 -- (-410.812) (-404.452) [-406.311] (-408.406) * (-405.201) (-404.831) [-406.421] (-409.003) -- 0:00:29
      520000 -- (-406.642) [-406.749] (-406.715) (-404.421) * (-407.947) (-408.304) [-404.743] (-404.034) -- 0:00:29

      Average standard deviation of split frequencies: 0.006740

      520500 -- (-406.371) [-405.693] (-403.491) (-406.094) * (-403.736) [-405.446] (-404.632) (-407.198) -- 0:00:29
      521000 -- (-403.506) [-404.014] (-403.350) (-405.928) * (-403.477) [-405.089] (-404.709) (-404.566) -- 0:00:29
      521500 -- [-405.702] (-403.918) (-405.056) (-406.023) * (-405.349) (-408.744) (-406.862) [-403.820] -- 0:00:29
      522000 -- [-409.805] (-404.755) (-408.075) (-405.664) * (-406.657) (-406.589) (-411.225) [-403.541] -- 0:00:29
      522500 -- (-406.040) (-406.781) (-406.228) [-407.425] * (-406.028) [-405.312] (-405.456) (-405.185) -- 0:00:29
      523000 -- [-405.155] (-405.219) (-405.572) (-404.498) * (-406.068) [-405.701] (-404.368) (-406.350) -- 0:00:29
      523500 -- (-405.095) (-404.554) (-405.992) [-403.245] * (-406.609) (-405.488) [-405.208] (-409.367) -- 0:00:29
      524000 -- (-404.325) (-404.145) [-404.417] (-404.089) * (-416.865) (-403.490) [-407.957] (-406.492) -- 0:00:29
      524500 -- (-407.626) (-405.142) [-406.992] (-404.732) * [-404.950] (-406.288) (-406.301) (-406.336) -- 0:00:29
      525000 -- [-404.168] (-406.004) (-405.130) (-405.446) * [-404.448] (-406.280) (-408.418) (-406.564) -- 0:00:29

      Average standard deviation of split frequencies: 0.006722

      525500 -- [-411.041] (-405.943) (-403.911) (-406.357) * (-405.089) (-407.200) [-405.867] (-403.292) -- 0:00:29
      526000 -- (-406.874) [-404.253] (-404.723) (-403.943) * (-407.365) (-409.008) (-405.183) [-404.261] -- 0:00:29
      526500 -- [-409.129] (-403.850) (-404.474) (-404.807) * [-403.656] (-409.018) (-407.424) (-406.429) -- 0:00:29
      527000 -- (-404.149) [-403.965] (-404.305) (-404.015) * (-404.683) [-405.490] (-404.765) (-406.824) -- 0:00:29
      527500 -- (-408.663) [-403.984] (-403.361) (-410.410) * (-403.661) (-404.994) (-403.738) [-404.503] -- 0:00:29
      528000 -- (-405.549) (-404.486) [-404.045] (-407.719) * [-405.817] (-408.615) (-406.444) (-404.003) -- 0:00:29
      528500 -- (-405.456) [-406.630] (-406.079) (-407.847) * (-404.515) (-403.728) (-413.696) [-405.469] -- 0:00:29
      529000 -- (-405.175) (-412.821) (-405.574) [-406.104] * (-407.137) (-405.459) (-408.703) [-405.740] -- 0:00:29
      529500 -- (-404.748) (-406.603) [-403.771] (-405.813) * (-408.004) [-404.877] (-409.330) (-404.737) -- 0:00:29
      530000 -- (-404.811) [-406.033] (-403.714) (-405.831) * (-413.334) [-406.960] (-404.299) (-404.343) -- 0:00:29

      Average standard deviation of split frequencies: 0.007255

      530500 -- (-407.658) [-406.471] (-407.250) (-406.044) * (-407.086) (-404.221) (-407.916) [-404.076] -- 0:00:29
      531000 -- [-403.586] (-404.433) (-406.188) (-405.713) * [-407.272] (-407.195) (-405.267) (-406.131) -- 0:00:29
      531500 -- (-404.891) (-405.904) (-405.579) [-406.894] * (-403.967) [-408.797] (-403.722) (-404.409) -- 0:00:29
      532000 -- (-406.181) (-405.147) [-407.650] (-403.935) * [-406.727] (-406.255) (-403.631) (-405.269) -- 0:00:29
      532500 -- (-404.452) [-404.308] (-407.410) (-404.140) * (-404.494) [-407.092] (-403.549) (-405.385) -- 0:00:28
      533000 -- [-407.975] (-404.088) (-403.955) (-408.068) * (-403.970) (-404.272) (-406.973) [-404.291] -- 0:00:28
      533500 -- (-408.426) [-406.139] (-404.255) (-408.761) * (-406.228) (-403.729) (-407.352) [-406.711] -- 0:00:28
      534000 -- [-404.463] (-403.753) (-407.322) (-405.610) * [-405.414] (-407.415) (-404.898) (-404.685) -- 0:00:28
      534500 -- (-405.429) [-405.630] (-407.230) (-404.934) * [-405.727] (-406.257) (-409.247) (-403.509) -- 0:00:28
      535000 -- [-404.193] (-406.014) (-405.847) (-405.567) * (-403.254) [-406.654] (-405.207) (-404.242) -- 0:00:28

      Average standard deviation of split frequencies: 0.006938

      535500 -- (-405.349) (-409.599) [-405.825] (-407.133) * (-403.757) (-411.753) (-407.269) [-406.447] -- 0:00:28
      536000 -- (-404.391) [-409.714] (-408.227) (-404.168) * [-408.020] (-404.423) (-404.625) (-405.429) -- 0:00:28
      536500 -- (-405.445) (-407.565) (-408.348) [-403.857] * (-407.466) (-408.000) (-404.250) [-405.146] -- 0:00:28
      537000 -- (-403.994) (-406.395) [-405.559] (-404.662) * [-404.830] (-406.420) (-405.791) (-403.502) -- 0:00:28
      537500 -- [-404.985] (-405.933) (-403.733) (-405.278) * [-405.517] (-405.929) (-405.630) (-407.288) -- 0:00:28
      538000 -- [-407.106] (-405.024) (-404.235) (-406.972) * [-406.544] (-403.888) (-403.900) (-405.278) -- 0:00:28
      538500 -- (-404.111) [-405.444] (-404.017) (-407.322) * (-404.383) [-404.887] (-404.991) (-408.154) -- 0:00:28
      539000 -- (-408.813) [-406.206] (-403.752) (-404.861) * [-404.292] (-406.667) (-405.899) (-405.803) -- 0:00:28
      539500 -- [-403.461] (-406.700) (-403.248) (-406.436) * (-408.611) [-404.611] (-404.440) (-404.060) -- 0:00:28
      540000 -- (-403.768) (-404.652) [-404.030] (-407.496) * (-404.746) (-405.403) [-406.830] (-406.226) -- 0:00:28

      Average standard deviation of split frequencies: 0.006411

      540500 -- (-405.304) (-405.795) [-406.536] (-405.872) * (-407.162) (-407.992) (-403.835) [-404.464] -- 0:00:28
      541000 -- (-405.458) [-403.917] (-414.701) (-404.554) * [-411.179] (-404.329) (-406.848) (-403.980) -- 0:00:27
      541500 -- (-406.521) (-405.386) [-405.498] (-404.139) * (-408.050) [-404.696] (-405.360) (-403.774) -- 0:00:28
      542000 -- (-404.629) (-409.263) [-404.152] (-409.202) * (-405.054) (-405.113) (-405.194) [-405.206] -- 0:00:28
      542500 -- (-404.727) [-405.025] (-405.401) (-407.364) * (-403.507) [-404.485] (-404.853) (-405.151) -- 0:00:28
      543000 -- (-405.906) [-403.862] (-406.718) (-403.812) * [-404.856] (-406.301) (-406.192) (-404.342) -- 0:00:28
      543500 -- (-405.121) [-407.147] (-413.546) (-405.560) * [-403.342] (-405.225) (-404.023) (-411.255) -- 0:00:28
      544000 -- [-404.758] (-404.659) (-404.855) (-403.253) * (-404.305) (-403.741) (-408.670) [-408.454] -- 0:00:28
      544500 -- [-404.939] (-404.406) (-406.470) (-407.128) * [-407.337] (-403.593) (-409.452) (-407.607) -- 0:00:28
      545000 -- [-404.174] (-404.103) (-407.398) (-405.362) * (-404.397) [-405.045] (-409.724) (-405.190) -- 0:00:28

      Average standard deviation of split frequencies: 0.006667

      545500 -- (-405.969) (-403.459) [-405.094] (-405.088) * (-407.270) (-413.481) [-407.325] (-406.375) -- 0:00:28
      546000 -- (-406.707) (-404.118) [-404.688] (-406.199) * (-406.357) (-404.544) [-407.739] (-405.420) -- 0:00:28
      546500 -- (-407.440) (-404.192) (-410.080) [-405.315] * (-406.006) (-403.554) [-403.659] (-404.162) -- 0:00:28
      547000 -- (-404.587) (-405.018) (-405.594) [-403.511] * (-407.341) (-404.238) [-403.615] (-406.334) -- 0:00:28
      547500 -- [-405.559] (-404.202) (-405.063) (-406.501) * [-403.596] (-405.310) (-403.481) (-407.734) -- 0:00:28
      548000 -- (-405.058) (-406.927) [-404.642] (-408.034) * (-405.739) [-408.640] (-404.426) (-404.807) -- 0:00:28
      548500 -- (-405.450) [-406.697] (-408.794) (-406.867) * [-409.231] (-407.659) (-405.030) (-405.048) -- 0:00:27
      549000 -- (-410.871) (-405.290) (-404.771) [-405.399] * (-406.787) [-408.247] (-406.731) (-407.510) -- 0:00:27
      549500 -- (-405.581) (-406.064) (-407.213) [-406.069] * (-406.380) (-408.483) (-408.576) [-403.280] -- 0:00:27
      550000 -- (-403.443) [-406.108] (-406.132) (-406.686) * (-409.118) (-406.078) [-405.763] (-405.063) -- 0:00:27

      Average standard deviation of split frequencies: 0.007134

      550500 -- (-405.026) (-404.671) (-405.621) [-407.581] * (-408.736) (-403.862) (-404.991) [-406.918] -- 0:00:27
      551000 -- (-405.002) (-405.682) (-412.075) [-405.823] * (-408.223) [-405.837] (-404.050) (-405.196) -- 0:00:27
      551500 -- [-404.225] (-404.816) (-408.768) (-406.123) * (-404.407) [-407.699] (-405.581) (-406.420) -- 0:00:27
      552000 -- (-403.830) (-405.863) (-407.171) [-405.799] * (-404.432) [-407.113] (-404.621) (-406.468) -- 0:00:27
      552500 -- [-407.301] (-404.126) (-404.398) (-405.119) * (-405.835) (-404.265) [-404.553] (-407.138) -- 0:00:27
      553000 -- (-406.791) (-404.105) [-404.072] (-404.989) * (-407.255) (-405.423) [-404.610] (-403.251) -- 0:00:27
      553500 -- (-404.176) (-407.988) [-403.506] (-405.176) * (-405.519) (-406.841) (-405.074) [-406.450] -- 0:00:27
      554000 -- (-407.547) [-407.052] (-407.185) (-404.353) * (-404.004) [-403.776] (-406.081) (-407.284) -- 0:00:27
      554500 -- (-407.543) (-407.836) [-407.598] (-408.452) * (-404.359) [-405.900] (-405.001) (-405.778) -- 0:00:27
      555000 -- (-407.211) [-403.179] (-404.020) (-405.780) * (-404.479) (-409.029) [-407.011] (-408.676) -- 0:00:27

      Average standard deviation of split frequencies: 0.005835

      555500 -- (-406.017) (-404.262) [-404.750] (-403.548) * (-408.326) (-405.772) [-405.320] (-404.009) -- 0:00:27
      556000 -- (-404.491) [-409.024] (-411.193) (-405.231) * (-408.706) (-405.406) (-403.585) [-404.374] -- 0:00:27
      556500 -- [-405.842] (-404.938) (-409.878) (-404.780) * (-407.117) (-404.317) (-405.459) [-404.855] -- 0:00:27
      557000 -- (-405.948) [-404.357] (-408.552) (-406.440) * (-406.015) (-407.979) (-410.489) [-404.603] -- 0:00:27
      557500 -- (-408.515) (-407.489) [-403.964] (-404.794) * (-404.799) [-405.792] (-407.014) (-403.887) -- 0:00:26
      558000 -- (-405.197) (-408.642) [-405.228] (-405.521) * (-407.534) (-412.618) [-404.046] (-403.914) -- 0:00:26
      558500 -- (-405.530) [-403.330] (-404.783) (-405.599) * (-407.948) (-406.278) [-403.848] (-407.269) -- 0:00:27
      559000 -- (-404.659) [-403.746] (-403.637) (-406.359) * (-405.240) (-406.752) [-405.483] (-405.916) -- 0:00:27
      559500 -- (-404.467) (-404.478) (-407.611) [-404.279] * (-405.963) (-404.891) [-405.778] (-407.099) -- 0:00:27
      560000 -- (-403.649) [-405.710] (-407.529) (-404.035) * (-405.105) [-406.861] (-404.993) (-407.146) -- 0:00:27

      Average standard deviation of split frequencies: 0.005675

      560500 -- (-406.939) [-404.647] (-405.265) (-404.151) * (-404.075) (-407.588) (-407.981) [-406.830] -- 0:00:27
      561000 -- (-404.335) (-405.921) [-406.477] (-403.942) * (-404.876) (-405.830) [-407.932] (-405.677) -- 0:00:27
      561500 -- (-404.434) (-405.624) [-403.741] (-405.099) * (-405.882) (-409.683) [-403.815] (-404.666) -- 0:00:27
      562000 -- (-404.587) (-405.038) (-405.216) [-403.708] * (-405.841) [-407.697] (-404.655) (-407.286) -- 0:00:27
      562500 -- (-405.440) [-403.935] (-405.896) (-406.053) * (-406.358) [-404.292] (-410.236) (-404.821) -- 0:00:27
      563000 -- (-405.323) (-407.795) [-406.383] (-408.479) * (-405.010) [-406.013] (-404.277) (-404.809) -- 0:00:27
      563500 -- [-404.997] (-406.557) (-405.028) (-404.727) * (-405.143) [-405.985] (-405.258) (-404.486) -- 0:00:27
      564000 -- (-405.560) (-404.707) [-404.772] (-404.357) * (-409.010) (-408.157) [-403.874] (-404.186) -- 0:00:27
      564500 -- (-404.636) [-403.660] (-404.212) (-406.881) * (-408.617) (-407.302) (-403.890) [-407.940] -- 0:00:27
      565000 -- (-406.949) [-403.420] (-409.763) (-408.982) * (-406.210) (-408.926) [-407.106] (-406.867) -- 0:00:26

      Average standard deviation of split frequencies: 0.005830

      565500 -- (-406.114) [-404.081] (-409.306) (-408.298) * [-406.518] (-404.507) (-405.895) (-405.020) -- 0:00:26
      566000 -- (-407.526) [-403.980] (-410.239) (-412.779) * [-406.996] (-408.285) (-406.346) (-405.458) -- 0:00:26
      566500 -- (-405.539) (-406.081) (-409.333) [-415.274] * [-405.753] (-406.378) (-405.652) (-407.926) -- 0:00:26
      567000 -- (-407.590) [-403.795] (-405.802) (-406.543) * [-403.520] (-407.347) (-406.450) (-408.628) -- 0:00:26
      567500 -- (-405.819) (-404.471) [-405.903] (-403.192) * (-404.250) (-405.565) (-404.753) [-405.409] -- 0:00:26
      568000 -- [-404.787] (-405.745) (-407.906) (-404.467) * (-406.043) (-407.765) (-405.259) [-403.479] -- 0:00:26
      568500 -- (-404.495) [-403.555] (-405.890) (-405.344) * (-403.937) [-407.523] (-406.618) (-404.875) -- 0:00:26
      569000 -- (-403.753) (-406.186) [-404.025] (-405.741) * [-404.123] (-403.882) (-404.775) (-404.347) -- 0:00:26
      569500 -- (-406.956) [-403.753] (-405.759) (-405.320) * (-405.983) (-406.037) (-404.441) [-405.215] -- 0:00:26
      570000 -- (-404.226) [-404.620] (-408.331) (-406.921) * (-405.240) [-405.445] (-408.749) (-404.683) -- 0:00:26

      Average standard deviation of split frequencies: 0.006608

      570500 -- (-405.876) [-404.793] (-404.573) (-405.511) * (-405.811) [-406.086] (-405.744) (-406.722) -- 0:00:26
      571000 -- (-409.506) [-405.212] (-404.043) (-404.905) * (-404.208) (-404.331) [-407.570] (-408.329) -- 0:00:26
      571500 -- (-405.646) (-403.669) [-404.053] (-405.794) * (-404.731) (-411.270) [-405.534] (-403.760) -- 0:00:26
      572000 -- (-403.950) (-404.711) (-405.542) [-404.476] * [-406.473] (-406.477) (-403.522) (-406.688) -- 0:00:26
      572500 -- [-404.728] (-409.891) (-408.224) (-404.512) * (-412.368) [-403.778] (-406.584) (-406.009) -- 0:00:26
      573000 -- (-404.649) (-408.210) [-408.550] (-404.840) * (-407.996) [-404.930] (-407.139) (-406.270) -- 0:00:26
      573500 -- [-403.575] (-405.000) (-404.435) (-407.002) * (-405.020) (-407.694) [-405.847] (-407.024) -- 0:00:26
      574000 -- (-405.322) (-406.909) (-404.682) [-405.660] * (-404.869) (-406.052) (-406.189) [-405.026] -- 0:00:25
      574500 -- (-405.716) (-403.992) [-407.360] (-405.781) * (-407.644) (-404.433) [-406.380] (-404.145) -- 0:00:25
      575000 -- (-412.308) [-405.099] (-404.859) (-405.052) * (-406.420) [-404.413] (-409.089) (-403.046) -- 0:00:25

      Average standard deviation of split frequencies: 0.005933

      575500 -- [-407.157] (-405.484) (-404.516) (-405.992) * (-407.089) (-407.176) (-407.219) [-405.339] -- 0:00:26
      576000 -- (-409.069) (-408.958) (-405.436) [-404.397] * (-409.800) (-405.842) [-405.568] (-407.019) -- 0:00:26
      576500 -- (-404.936) [-404.365] (-407.242) (-407.252) * (-404.808) [-405.986] (-408.236) (-406.422) -- 0:00:26
      577000 -- (-403.705) (-404.383) (-405.598) [-404.460] * (-412.207) [-405.946] (-405.377) (-403.386) -- 0:00:26
      577500 -- (-404.774) (-407.135) [-403.929] (-405.895) * (-405.970) (-407.823) [-404.538] (-404.271) -- 0:00:26
      578000 -- (-405.902) (-406.178) [-403.752] (-406.139) * (-405.794) (-406.282) [-405.121] (-405.289) -- 0:00:26
      578500 -- [-406.905] (-407.288) (-405.322) (-405.098) * [-406.143] (-405.569) (-403.243) (-403.875) -- 0:00:26
      579000 -- (-405.390) (-408.110) [-405.934] (-405.898) * (-406.879) (-405.632) (-412.049) [-405.226] -- 0:00:26
      579500 -- [-406.375] (-408.754) (-405.714) (-403.401) * [-405.595] (-405.202) (-404.652) (-409.247) -- 0:00:26
      580000 -- [-406.538] (-407.455) (-406.655) (-405.255) * (-404.414) (-406.235) (-406.640) [-408.687] -- 0:00:26

      Average standard deviation of split frequencies: 0.005581

      580500 -- [-405.794] (-405.348) (-405.754) (-405.050) * (-403.874) [-406.193] (-406.337) (-405.973) -- 0:00:26
      581000 -- [-407.939] (-404.191) (-403.985) (-404.796) * (-403.432) [-403.060] (-406.738) (-407.589) -- 0:00:25
      581500 -- (-406.986) (-408.706) [-403.958] (-406.309) * [-404.387] (-408.177) (-404.698) (-405.848) -- 0:00:25
      582000 -- (-407.489) (-405.738) [-406.900] (-404.423) * [-406.066] (-406.437) (-406.679) (-403.603) -- 0:00:25
      582500 -- (-405.400) [-406.732] (-405.461) (-403.900) * (-405.644) [-406.304] (-406.875) (-406.802) -- 0:00:25
      583000 -- (-405.200) (-406.738) (-406.247) [-407.273] * [-405.759] (-404.294) (-409.069) (-404.429) -- 0:00:25
      583500 -- (-406.899) (-404.652) [-408.278] (-403.840) * (-407.489) (-403.860) (-407.793) [-405.285] -- 0:00:25
      584000 -- (-407.331) (-406.349) (-404.588) [-404.947] * [-406.635] (-404.247) (-406.411) (-405.961) -- 0:00:25
      584500 -- [-406.940] (-407.437) (-404.768) (-406.353) * (-405.652) [-405.710] (-405.264) (-406.510) -- 0:00:25
      585000 -- [-406.846] (-405.397) (-404.951) (-404.254) * (-407.710) (-405.670) [-407.153] (-405.093) -- 0:00:25

      Average standard deviation of split frequencies: 0.005832

      585500 -- [-407.256] (-406.546) (-409.543) (-405.762) * (-404.436) (-405.072) (-404.434) [-404.338] -- 0:00:25
      586000 -- [-406.514] (-406.157) (-405.198) (-408.677) * (-409.138) (-405.530) [-404.637] (-404.186) -- 0:00:25
      586500 -- (-407.762) (-406.311) (-403.461) [-403.823] * (-404.960) (-409.003) [-404.403] (-411.581) -- 0:00:25
      587000 -- [-406.465] (-405.421) (-408.301) (-404.448) * (-404.131) (-407.038) [-405.852] (-405.242) -- 0:00:25
      587500 -- [-404.731] (-405.474) (-407.994) (-404.363) * (-405.344) (-408.363) (-408.553) [-403.811] -- 0:00:25
      588000 -- (-405.157) (-404.735) (-408.766) [-404.940] * (-403.940) [-405.112] (-405.209) (-404.151) -- 0:00:25
      588500 -- [-406.728] (-405.541) (-404.910) (-404.059) * (-404.702) (-404.317) [-406.893] (-407.350) -- 0:00:25
      589000 -- (-406.940) (-406.754) [-406.902] (-407.604) * (-406.080) [-405.409] (-408.097) (-408.943) -- 0:00:25
      589500 -- (-407.171) [-405.453] (-405.692) (-406.890) * (-403.882) (-404.581) (-406.436) [-407.148] -- 0:00:25
      590000 -- (-405.660) (-404.397) [-408.655] (-405.205) * (-406.250) [-406.097] (-409.079) (-411.037) -- 0:00:25

      Average standard deviation of split frequencies: 0.005936

      590500 -- (-405.358) [-406.798] (-407.583) (-404.122) * (-406.651) (-406.498) [-408.442] (-404.318) -- 0:00:24
      591000 -- [-405.155] (-405.552) (-405.286) (-405.613) * [-407.258] (-407.219) (-411.758) (-404.618) -- 0:00:24
      591500 -- (-406.101) (-405.117) (-407.050) [-405.003] * [-405.468] (-405.125) (-405.552) (-405.806) -- 0:00:24
      592000 -- (-406.052) (-409.832) (-408.058) [-405.820] * [-404.176] (-404.083) (-404.475) (-403.893) -- 0:00:25
      592500 -- [-407.219] (-406.198) (-406.525) (-404.514) * (-405.191) (-404.636) [-406.790] (-404.850) -- 0:00:25
      593000 -- [-403.472] (-407.664) (-410.894) (-407.228) * (-405.417) (-404.950) [-403.911] (-406.684) -- 0:00:25
      593500 -- (-404.081) (-404.715) [-404.464] (-403.993) * (-409.193) [-404.593] (-406.981) (-404.698) -- 0:00:25
      594000 -- (-404.020) [-405.355] (-405.944) (-405.984) * (-408.505) [-404.512] (-406.526) (-404.863) -- 0:00:25
      594500 -- (-404.818) (-404.730) [-405.392] (-403.954) * (-407.622) (-406.300) (-409.059) [-403.578] -- 0:00:25
      595000 -- (-407.723) [-405.979] (-406.743) (-409.137) * (-407.774) (-406.163) [-405.591] (-408.186) -- 0:00:25

      Average standard deviation of split frequencies: 0.007212

      595500 -- (-404.528) [-404.353] (-406.980) (-406.211) * (-407.415) (-405.378) (-405.400) [-407.698] -- 0:00:25
      596000 -- (-405.047) [-404.257] (-403.421) (-408.925) * (-405.963) (-404.543) [-403.957] (-407.507) -- 0:00:25
      596500 -- (-409.617) (-404.482) (-405.907) [-405.510] * (-405.033) (-404.485) (-404.018) [-405.643] -- 0:00:25
      597000 -- [-407.268] (-405.099) (-407.322) (-404.415) * [-405.571] (-405.462) (-404.610) (-403.329) -- 0:00:24
      597500 -- [-403.478] (-405.495) (-404.186) (-404.637) * (-405.729) (-405.198) [-405.632] (-406.005) -- 0:00:24
      598000 -- (-405.341) (-404.260) (-405.659) [-406.171] * (-407.131) [-404.443] (-404.902) (-407.099) -- 0:00:24
      598500 -- (-403.596) (-404.222) [-407.223] (-403.635) * (-406.098) [-407.493] (-404.097) (-406.544) -- 0:00:24
      599000 -- (-403.912) [-403.778] (-406.098) (-404.525) * (-409.018) (-404.846) [-405.035] (-405.409) -- 0:00:24
      599500 -- (-404.141) (-406.349) [-405.180] (-407.881) * (-404.357) (-404.124) [-406.775] (-405.146) -- 0:00:24
      600000 -- (-405.226) (-405.723) (-406.390) [-406.375] * (-407.540) (-406.079) (-405.910) [-404.746] -- 0:00:24

      Average standard deviation of split frequencies: 0.007109

      600500 -- [-404.568] (-407.065) (-407.606) (-405.536) * (-407.139) (-404.762) (-406.890) [-405.125] -- 0:00:24
      601000 -- [-407.008] (-405.445) (-408.922) (-404.007) * (-407.740) (-405.283) (-406.017) [-405.259] -- 0:00:24
      601500 -- [-405.814] (-404.105) (-403.257) (-407.380) * (-406.460) [-406.059] (-407.580) (-405.657) -- 0:00:24
      602000 -- (-406.379) (-404.675) (-403.241) [-405.483] * [-404.830] (-407.169) (-404.607) (-404.567) -- 0:00:24
      602500 -- (-404.962) [-404.816] (-407.059) (-404.220) * (-404.358) (-405.278) (-405.368) [-408.107] -- 0:00:24
      603000 -- [-408.419] (-403.410) (-404.355) (-404.576) * (-403.956) (-410.230) (-407.550) [-405.162] -- 0:00:24
      603500 -- (-405.131) (-405.566) [-403.789] (-404.102) * [-404.344] (-406.288) (-404.257) (-406.481) -- 0:00:24
      604000 -- [-404.434] (-405.720) (-403.445) (-403.789) * [-405.250] (-406.498) (-405.363) (-408.497) -- 0:00:24
      604500 -- (-407.171) [-404.760] (-404.570) (-405.570) * (-405.887) [-409.352] (-404.155) (-404.671) -- 0:00:24
      605000 -- (-404.868) (-410.857) (-405.313) [-405.966] * [-405.062] (-407.097) (-412.082) (-405.095) -- 0:00:24

      Average standard deviation of split frequencies: 0.007184

      605500 -- (-408.937) (-408.845) [-408.016] (-405.198) * (-406.058) (-407.098) [-405.845] (-405.235) -- 0:00:24
      606000 -- (-406.380) [-405.786] (-407.905) (-405.051) * (-409.148) (-406.588) (-407.023) [-406.140] -- 0:00:24
      606500 -- [-404.350] (-410.162) (-403.506) (-407.452) * [-404.655] (-407.935) (-405.791) (-410.273) -- 0:00:24
      607000 -- (-404.587) [-407.642] (-407.241) (-405.564) * (-406.490) (-404.029) [-403.454] (-406.663) -- 0:00:23
      607500 -- (-410.170) (-407.383) [-406.137] (-404.273) * (-404.644) [-404.700] (-403.742) (-405.502) -- 0:00:23
      608000 -- (-408.220) [-406.154] (-409.573) (-406.365) * (-405.290) [-406.240] (-403.527) (-414.032) -- 0:00:23
      608500 -- (-404.305) [-404.499] (-404.164) (-404.058) * (-411.228) [-405.907] (-403.994) (-409.589) -- 0:00:24
      609000 -- [-405.744] (-406.309) (-403.556) (-403.260) * (-403.830) (-404.708) (-404.580) [-404.490] -- 0:00:24
      609500 -- [-405.440] (-405.565) (-403.521) (-409.086) * (-404.749) [-405.695] (-404.620) (-405.764) -- 0:00:24
      610000 -- (-407.310) [-404.585] (-405.175) (-404.841) * (-408.029) [-405.979] (-411.230) (-404.543) -- 0:00:24

      Average standard deviation of split frequencies: 0.005934

      610500 -- [-406.756] (-404.434) (-405.593) (-403.607) * [-404.271] (-405.108) (-405.966) (-406.608) -- 0:00:24
      611000 -- (-407.663) (-405.171) (-409.954) [-404.183] * [-403.793] (-405.268) (-403.703) (-403.610) -- 0:00:24
      611500 -- (-405.425) (-405.090) (-405.994) [-403.380] * (-406.720) (-404.257) [-411.634] (-405.107) -- 0:00:24
      612000 -- [-405.484] (-403.661) (-406.576) (-403.997) * (-404.828) (-404.640) (-409.534) [-405.092] -- 0:00:24
      612500 -- (-406.447) [-403.829] (-406.198) (-409.122) * (-405.313) (-404.046) (-409.785) [-405.334] -- 0:00:24
      613000 -- (-410.332) (-408.063) [-407.162] (-405.486) * (-406.260) (-403.707) (-405.127) [-404.944] -- 0:00:23
      613500 -- (-408.187) (-405.191) (-404.999) [-407.142] * [-406.322] (-405.525) (-404.902) (-407.492) -- 0:00:23
      614000 -- (-407.152) [-404.236] (-405.471) (-407.088) * [-404.532] (-404.423) (-408.383) (-403.601) -- 0:00:23
      614500 -- (-405.176) (-405.672) [-406.070] (-406.383) * (-405.955) (-404.630) [-407.136] (-406.560) -- 0:00:23
      615000 -- (-404.292) (-404.975) (-407.040) [-409.739] * (-404.224) (-407.949) (-405.012) [-405.136] -- 0:00:23

      Average standard deviation of split frequencies: 0.006266

      615500 -- (-405.582) [-406.153] (-407.866) (-407.919) * (-408.377) (-404.813) (-406.408) [-404.046] -- 0:00:23
      616000 -- [-405.386] (-410.661) (-409.001) (-403.619) * (-408.178) (-404.827) (-407.396) [-405.255] -- 0:00:23
      616500 -- (-406.502) (-406.015) (-405.332) [-403.707] * [-403.920] (-405.803) (-406.088) (-405.156) -- 0:00:23
      617000 -- (-404.442) [-408.482] (-404.718) (-404.052) * [-404.257] (-407.344) (-403.844) (-411.528) -- 0:00:23
      617500 -- (-403.551) (-407.118) [-405.230] (-406.348) * (-403.507) [-403.560] (-404.057) (-410.338) -- 0:00:23
      618000 -- (-403.883) [-407.105] (-403.363) (-406.425) * (-406.615) [-405.912] (-406.242) (-406.175) -- 0:00:23
      618500 -- (-404.559) (-406.078) (-404.076) [-404.091] * [-405.704] (-409.984) (-404.077) (-405.793) -- 0:00:23
      619000 -- (-405.194) (-405.849) [-406.091] (-404.781) * (-405.619) (-407.542) (-406.729) [-406.266] -- 0:00:23
      619500 -- (-403.473) (-405.135) [-404.356] (-407.164) * [-406.138] (-405.085) (-410.398) (-404.141) -- 0:00:23
      620000 -- [-403.806] (-403.495) (-404.554) (-409.678) * [-405.932] (-407.885) (-408.973) (-406.181) -- 0:00:23

      Average standard deviation of split frequencies: 0.006551

      620500 -- [-404.041] (-404.665) (-404.286) (-406.622) * (-404.270) [-407.911] (-406.641) (-403.390) -- 0:00:23
      621000 -- [-403.969] (-406.019) (-407.130) (-406.412) * [-405.096] (-406.354) (-405.296) (-403.281) -- 0:00:23
      621500 -- (-405.318) [-407.445] (-408.633) (-409.934) * (-406.164) (-403.814) [-404.724] (-404.283) -- 0:00:23
      622000 -- (-405.099) (-406.554) (-404.121) [-404.219] * (-408.507) [-407.893] (-407.242) (-403.710) -- 0:00:23
      622500 -- [-405.519] (-407.917) (-407.251) (-406.562) * (-405.319) [-408.758] (-407.720) (-414.678) -- 0:00:23
      623000 -- [-405.581] (-407.283) (-403.189) (-404.543) * (-405.582) (-409.377) [-404.865] (-405.156) -- 0:00:22
      623500 -- [-409.404] (-404.405) (-404.609) (-405.539) * (-407.004) (-407.582) (-405.170) [-403.932] -- 0:00:22
      624000 -- (-405.410) (-403.522) [-407.245] (-409.012) * (-408.601) (-406.472) [-403.547] (-404.547) -- 0:00:22
      624500 -- (-407.999) (-406.223) (-407.763) [-404.537] * (-408.990) [-405.415] (-406.332) (-404.427) -- 0:00:22
      625000 -- [-403.976] (-405.695) (-406.958) (-404.637) * [-405.975] (-403.850) (-405.416) (-403.727) -- 0:00:22

      Average standard deviation of split frequencies: 0.006824

      625500 -- [-403.218] (-404.980) (-407.027) (-404.574) * (-405.765) (-403.561) [-405.628] (-406.513) -- 0:00:23
      626000 -- [-403.218] (-404.138) (-406.005) (-403.436) * (-407.115) [-403.744] (-405.851) (-405.811) -- 0:00:23
      626500 -- (-404.767) (-405.003) [-406.555] (-406.262) * (-410.079) (-404.881) (-405.175) [-404.333] -- 0:00:23
      627000 -- [-405.141] (-404.360) (-406.116) (-406.310) * (-407.606) [-409.410] (-404.639) (-403.236) -- 0:00:23
      627500 -- [-405.186] (-405.776) (-405.443) (-405.208) * (-404.565) (-403.538) (-403.351) [-403.826] -- 0:00:23
      628000 -- (-406.941) (-405.495) (-404.243) [-405.052] * (-407.935) [-404.005] (-410.365) (-405.389) -- 0:00:23
      628500 -- (-405.670) (-404.385) (-404.689) [-405.535] * (-411.813) (-404.183) [-405.458] (-405.171) -- 0:00:23
      629000 -- [-403.590] (-404.608) (-404.401) (-404.175) * (-405.157) [-404.487] (-409.285) (-406.438) -- 0:00:23
      629500 -- (-404.758) (-405.339) [-406.262] (-403.174) * (-407.203) [-403.637] (-404.203) (-410.022) -- 0:00:22
      630000 -- (-406.477) (-405.328) [-404.690] (-407.087) * (-406.017) (-404.253) (-405.827) [-408.290] -- 0:00:22

      Average standard deviation of split frequencies: 0.007428

      630500 -- (-407.600) (-404.111) (-405.218) [-405.932] * (-406.365) (-405.095) (-405.440) [-404.909] -- 0:00:22
      631000 -- [-406.828] (-408.577) (-407.085) (-403.746) * (-414.569) [-406.479] (-405.484) (-406.872) -- 0:00:22
      631500 -- [-409.207] (-404.718) (-406.285) (-406.357) * (-408.603) (-404.327) (-404.101) [-404.864] -- 0:00:22
      632000 -- (-408.243) (-405.245) [-404.399] (-405.161) * [-405.281] (-406.277) (-404.140) (-404.963) -- 0:00:22
      632500 -- (-405.113) [-404.643] (-403.727) (-405.075) * (-403.695) (-404.867) [-404.727] (-405.265) -- 0:00:22
      633000 -- (-405.679) (-404.471) [-403.432] (-404.189) * (-405.343) (-405.957) [-405.321] (-406.179) -- 0:00:22
      633500 -- (-406.499) [-405.071] (-403.382) (-407.253) * [-406.150] (-404.453) (-403.550) (-410.201) -- 0:00:22
      634000 -- (-407.110) (-403.821) (-404.997) [-405.553] * (-404.764) [-405.680] (-405.524) (-409.085) -- 0:00:22
      634500 -- (-405.483) [-404.688] (-409.301) (-409.754) * (-403.683) [-403.326] (-403.948) (-407.529) -- 0:00:22
      635000 -- (-404.324) (-406.039) [-407.357] (-410.084) * [-405.184] (-404.759) (-404.468) (-412.459) -- 0:00:22

      Average standard deviation of split frequencies: 0.007366

      635500 -- [-407.260] (-405.567) (-407.919) (-407.825) * [-404.262] (-404.579) (-408.598) (-412.895) -- 0:00:22
      636000 -- [-406.351] (-407.904) (-410.320) (-407.228) * (-404.559) (-406.931) [-406.183] (-411.426) -- 0:00:22
      636500 -- (-404.643) [-403.767] (-406.416) (-407.941) * [-404.888] (-405.846) (-408.350) (-406.292) -- 0:00:22
      637000 -- [-409.085] (-404.793) (-405.088) (-408.097) * (-407.050) [-405.445] (-404.035) (-404.126) -- 0:00:22
      637500 -- [-405.727] (-407.378) (-408.887) (-410.756) * [-407.238] (-403.479) (-408.011) (-404.828) -- 0:00:22
      638000 -- (-403.149) (-403.614) [-404.401] (-404.320) * [-409.959] (-404.139) (-403.265) (-404.844) -- 0:00:22
      638500 -- (-404.382) (-406.408) [-404.097] (-403.269) * (-404.312) (-404.284) (-408.838) [-405.536] -- 0:00:22
      639000 -- (-406.402) [-403.930] (-406.595) (-404.147) * (-404.422) (-404.793) (-406.831) [-407.493] -- 0:00:22
      639500 -- (-405.696) (-404.174) [-404.981] (-409.502) * (-404.797) (-404.408) [-406.065] (-410.488) -- 0:00:21
      640000 -- (-404.666) [-406.082] (-408.988) (-409.356) * (-405.303) (-404.996) (-405.872) [-407.308] -- 0:00:21

      Average standard deviation of split frequencies: 0.007588

      640500 -- (-404.001) (-407.972) (-408.442) [-405.448] * [-406.307] (-406.473) (-406.521) (-405.685) -- 0:00:21
      641000 -- (-404.713) (-404.006) (-408.120) [-405.626] * (-404.055) (-405.096) (-407.014) [-403.905] -- 0:00:21
      641500 -- (-406.002) (-403.904) [-405.870] (-407.912) * (-404.616) [-404.939] (-409.088) (-403.219) -- 0:00:21
      642000 -- [-404.253] (-405.424) (-404.603) (-409.683) * (-404.412) [-403.985] (-407.389) (-405.926) -- 0:00:22
      642500 -- (-405.310) [-406.056] (-405.390) (-409.301) * (-404.557) (-408.758) (-406.300) [-404.214] -- 0:00:22
      643000 -- [-403.992] (-404.121) (-408.294) (-407.190) * [-403.329] (-405.142) (-407.291) (-404.870) -- 0:00:22
      643500 -- [-407.208] (-404.147) (-404.866) (-405.381) * [-404.504] (-405.603) (-405.778) (-410.805) -- 0:00:22
      644000 -- [-406.774] (-413.246) (-407.610) (-405.610) * (-405.333) [-405.086] (-405.533) (-406.584) -- 0:00:22
      644500 -- (-404.203) [-406.129] (-407.638) (-408.590) * (-407.419) (-409.462) (-405.264) [-405.960] -- 0:00:22
      645000 -- [-404.429] (-406.282) (-406.270) (-410.949) * (-405.822) [-405.869] (-405.174) (-406.100) -- 0:00:22

      Average standard deviation of split frequencies: 0.008199

      645500 -- [-404.017] (-407.299) (-407.428) (-407.666) * (-403.371) (-405.643) [-404.386] (-410.184) -- 0:00:21
      646000 -- (-405.589) (-404.229) (-405.633) [-406.908] * (-408.779) (-407.006) [-403.874] (-410.398) -- 0:00:21
      646500 -- (-404.427) [-403.875] (-406.824) (-406.795) * (-410.241) (-406.263) [-403.737] (-406.818) -- 0:00:21
      647000 -- [-403.523] (-406.012) (-404.537) (-410.182) * (-406.341) (-407.163) [-404.486] (-405.477) -- 0:00:21
      647500 -- [-403.405] (-405.224) (-405.931) (-407.208) * (-410.460) [-409.802] (-404.090) (-405.906) -- 0:00:21
      648000 -- (-404.317) (-407.359) [-405.768] (-409.441) * (-407.395) (-405.413) [-404.748] (-404.902) -- 0:00:21
      648500 -- (-405.058) [-405.573] (-405.736) (-403.934) * (-407.313) [-406.814] (-405.610) (-406.194) -- 0:00:21
      649000 -- (-404.889) (-406.188) [-407.247] (-411.650) * (-407.416) (-405.818) [-403.694] (-407.123) -- 0:00:21
      649500 -- [-403.888] (-406.433) (-409.510) (-408.743) * (-406.896) [-405.304] (-405.182) (-404.972) -- 0:00:21
      650000 -- (-404.839) [-404.333] (-405.077) (-405.406) * [-406.439] (-407.403) (-409.735) (-406.195) -- 0:00:21

      Average standard deviation of split frequencies: 0.008566

      650500 -- [-406.440] (-404.840) (-404.762) (-407.106) * (-406.187) (-407.080) (-408.932) [-405.087] -- 0:00:21
      651000 -- (-405.024) (-412.664) [-405.049] (-403.977) * (-408.283) (-404.301) (-407.694) [-405.378] -- 0:00:21
      651500 -- (-403.803) [-404.633] (-404.538) (-403.330) * [-406.618] (-404.809) (-405.753) (-411.011) -- 0:00:21
      652000 -- (-405.142) (-405.349) [-404.917] (-409.935) * (-409.465) (-409.476) [-408.502] (-405.702) -- 0:00:21
      652500 -- [-405.940] (-404.597) (-406.940) (-404.786) * [-404.850] (-406.173) (-405.618) (-403.561) -- 0:00:21
      653000 -- [-404.677] (-404.458) (-410.126) (-403.642) * (-407.195) (-406.778) [-406.314] (-407.474) -- 0:00:21
      653500 -- (-403.605) (-406.903) [-405.305] (-404.973) * (-406.344) [-405.750] (-405.785) (-405.401) -- 0:00:21
      654000 -- (-403.366) (-405.062) [-405.169] (-406.614) * (-405.664) (-406.955) (-406.731) [-404.547] -- 0:00:21
      654500 -- (-409.881) (-406.367) [-404.915] (-407.350) * [-404.076] (-406.061) (-405.618) (-408.129) -- 0:00:21
      655000 -- (-409.292) (-404.991) [-404.220] (-411.692) * (-405.042) (-405.186) [-405.026] (-406.510) -- 0:00:21

      Average standard deviation of split frequencies: 0.007411

      655500 -- (-406.043) (-403.815) (-403.936) [-405.864] * (-413.525) (-406.262) [-405.753] (-403.823) -- 0:00:21
      656000 -- (-404.441) (-407.647) (-404.129) [-404.327] * [-405.779] (-405.843) (-406.824) (-404.286) -- 0:00:20
      656500 -- (-404.324) (-409.525) (-406.148) [-405.732] * [-405.540] (-405.029) (-407.152) (-404.635) -- 0:00:20
      657000 -- (-406.904) [-409.429] (-404.724) (-404.528) * (-408.685) [-403.540] (-406.571) (-405.147) -- 0:00:20
      657500 -- (-406.085) (-410.624) [-404.874] (-407.824) * (-406.186) (-405.730) (-404.641) [-406.233] -- 0:00:20
      658000 -- [-406.385] (-408.035) (-406.087) (-405.794) * [-404.282] (-405.126) (-404.281) (-408.381) -- 0:00:20
      658500 -- (-407.052) (-404.587) [-404.219] (-405.433) * [-405.993] (-403.423) (-408.962) (-404.229) -- 0:00:20
      659000 -- (-404.102) [-405.354] (-404.205) (-404.172) * (-404.499) (-404.496) [-406.149] (-405.043) -- 0:00:21
      659500 -- (-405.459) (-410.712) (-406.592) [-408.594] * (-405.007) [-403.258] (-404.234) (-404.017) -- 0:00:21
      660000 -- (-404.225) [-405.649] (-404.181) (-405.890) * (-405.082) [-404.287] (-408.570) (-405.626) -- 0:00:21

      Average standard deviation of split frequencies: 0.007314

      660500 -- (-403.822) (-404.446) [-406.678] (-408.143) * (-405.635) (-406.013) (-405.246) [-405.321] -- 0:00:21
      661000 -- (-404.296) (-404.441) (-406.220) [-403.337] * (-411.353) [-405.020] (-403.732) (-404.713) -- 0:00:21
      661500 -- (-405.373) (-405.731) (-404.453) [-406.768] * [-407.284] (-404.038) (-405.641) (-405.720) -- 0:00:20
      662000 -- [-404.151] (-406.209) (-404.269) (-407.588) * (-405.761) (-403.457) [-405.250] (-405.646) -- 0:00:20
      662500 -- (-404.355) [-403.727] (-404.797) (-407.062) * [-403.252] (-403.945) (-404.710) (-408.060) -- 0:00:20
      663000 -- [-404.237] (-404.180) (-405.732) (-407.966) * [-409.334] (-404.023) (-404.996) (-408.247) -- 0:00:20
      663500 -- (-403.290) [-404.312] (-407.982) (-406.240) * (-404.789) [-405.451] (-407.908) (-407.307) -- 0:00:20
      664000 -- (-405.105) (-406.141) [-405.664] (-409.429) * [-403.943] (-407.489) (-403.975) (-404.027) -- 0:00:20
      664500 -- (-404.490) (-405.697) (-406.698) [-404.804] * (-406.215) (-404.663) [-403.676] (-406.043) -- 0:00:20
      665000 -- (-404.063) (-406.351) (-403.534) [-406.659] * (-406.419) [-403.863] (-404.327) (-405.195) -- 0:00:20

      Average standard deviation of split frequencies: 0.007255

      665500 -- (-403.251) (-407.427) (-404.265) [-407.473] * (-404.465) (-406.239) [-406.216] (-403.915) -- 0:00:20
      666000 -- (-409.193) (-404.957) [-404.462] (-409.458) * (-405.782) [-404.558] (-403.719) (-407.274) -- 0:00:20
      666500 -- (-406.911) (-404.098) [-408.092] (-409.107) * (-409.978) (-404.830) (-404.004) [-403.126] -- 0:00:20
      667000 -- (-408.526) (-404.829) (-404.316) [-409.356] * [-408.386] (-404.491) (-405.465) (-409.815) -- 0:00:20
      667500 -- (-404.340) (-405.207) [-404.112] (-406.185) * [-404.333] (-404.136) (-405.025) (-407.584) -- 0:00:20
      668000 -- (-404.689) [-404.774] (-404.716) (-404.695) * (-404.878) (-406.902) [-405.345] (-405.484) -- 0:00:20
      668500 -- [-404.841] (-403.667) (-404.413) (-406.088) * (-404.357) [-403.499] (-405.549) (-406.030) -- 0:00:20
      669000 -- [-407.080] (-403.908) (-404.702) (-406.796) * (-405.512) [-403.729] (-405.184) (-407.496) -- 0:00:20
      669500 -- (-405.560) (-403.890) (-410.894) [-409.208] * [-404.359] (-404.128) (-406.432) (-404.549) -- 0:00:20
      670000 -- (-403.551) (-406.814) (-403.614) [-406.948] * [-405.376] (-405.303) (-406.317) (-404.302) -- 0:00:20

      Average standard deviation of split frequencies: 0.006634

      670500 -- (-403.624) (-405.792) [-404.833] (-408.172) * [-405.928] (-405.727) (-405.072) (-406.345) -- 0:00:20
      671000 -- (-409.184) [-408.205] (-407.860) (-405.047) * (-403.567) (-406.559) [-404.146] (-404.699) -- 0:00:20
      671500 -- (-406.434) (-407.995) (-412.327) [-405.203] * (-403.955) (-404.160) [-407.927] (-407.149) -- 0:00:20
      672000 -- (-404.493) (-408.106) [-403.712] (-403.990) * (-405.961) [-404.654] (-405.113) (-404.712) -- 0:00:20
      672500 -- (-405.522) (-404.167) (-403.798) [-404.396] * [-404.656] (-403.790) (-403.784) (-404.227) -- 0:00:19
      673000 -- (-406.024) [-407.473] (-404.753) (-403.747) * (-405.696) [-404.904] (-405.731) (-410.823) -- 0:00:19
      673500 -- (-404.690) [-405.441] (-408.126) (-405.919) * (-404.846) [-407.400] (-403.187) (-406.482) -- 0:00:19
      674000 -- (-405.336) (-403.632) [-406.922] (-408.266) * [-405.068] (-403.874) (-405.238) (-406.724) -- 0:00:19
      674500 -- (-404.276) [-403.619] (-406.827) (-405.242) * [-405.836] (-406.762) (-406.871) (-404.812) -- 0:00:19
      675000 -- (-415.057) [-406.069] (-405.185) (-404.615) * (-409.194) (-406.078) [-406.759] (-404.745) -- 0:00:19

      Average standard deviation of split frequencies: 0.006581

      675500 -- (-408.828) (-406.444) [-405.483] (-406.393) * (-403.265) [-409.543] (-406.188) (-408.375) -- 0:00:19
      676000 -- (-407.432) [-405.107] (-407.982) (-404.177) * (-403.521) (-408.222) (-405.644) [-406.958] -- 0:00:20
      676500 -- (-405.739) (-412.279) (-405.840) [-405.966] * (-406.535) (-406.039) [-404.973] (-413.415) -- 0:00:20
      677000 -- [-405.437] (-405.566) (-404.546) (-408.379) * (-405.864) (-404.782) (-405.070) [-404.966] -- 0:00:20
      677500 -- (-404.909) (-409.165) (-404.718) [-403.611] * (-405.489) (-405.408) [-403.835] (-404.075) -- 0:00:19
      678000 -- (-406.564) (-409.785) [-405.250] (-407.359) * [-407.155] (-407.005) (-404.125) (-407.840) -- 0:00:19
      678500 -- (-410.520) (-404.042) (-405.417) [-405.037] * (-406.099) [-407.516] (-404.283) (-407.311) -- 0:00:19
      679000 -- (-406.887) (-404.134) (-404.401) [-405.084] * [-406.984] (-405.113) (-404.505) (-405.591) -- 0:00:19
      679500 -- (-409.314) (-407.885) [-406.190] (-406.151) * (-405.501) [-404.124] (-406.212) (-404.725) -- 0:00:19
      680000 -- [-406.478] (-410.058) (-404.876) (-407.072) * (-404.585) [-405.350] (-407.837) (-404.725) -- 0:00:19

      Average standard deviation of split frequencies: 0.006363

      680500 -- [-406.503] (-404.077) (-403.699) (-405.217) * (-404.254) [-405.100] (-406.073) (-403.431) -- 0:00:19
      681000 -- (-404.705) [-404.846] (-404.871) (-405.499) * (-407.244) [-406.136] (-403.778) (-404.883) -- 0:00:19
      681500 -- [-403.326] (-405.379) (-407.485) (-404.582) * [-406.924] (-404.098) (-408.285) (-407.592) -- 0:00:19
      682000 -- [-403.920] (-404.421) (-406.470) (-407.413) * [-404.772] (-405.942) (-403.768) (-405.972) -- 0:00:19
      682500 -- (-404.042) [-403.732] (-404.298) (-405.906) * [-404.465] (-405.770) (-408.046) (-403.790) -- 0:00:19
      683000 -- (-404.546) (-405.275) [-404.961] (-405.652) * (-405.349) [-404.759] (-406.815) (-406.362) -- 0:00:19
      683500 -- (-407.659) (-407.553) [-404.696] (-405.985) * (-407.247) (-407.420) [-403.980] (-404.901) -- 0:00:19
      684000 -- [-406.568] (-404.677) (-406.287) (-405.282) * (-413.780) [-404.666] (-404.465) (-405.362) -- 0:00:19
      684500 -- (-405.856) [-405.818] (-406.731) (-407.741) * (-408.613) (-404.424) (-408.651) [-403.775] -- 0:00:19
      685000 -- (-406.933) [-404.625] (-403.670) (-403.967) * (-404.236) [-404.932] (-404.659) (-406.079) -- 0:00:19

      Average standard deviation of split frequencies: 0.006614

      685500 -- (-408.937) [-405.952] (-404.271) (-405.597) * (-407.943) (-403.907) [-404.958] (-406.559) -- 0:00:19
      686000 -- (-404.229) (-405.002) [-405.924] (-405.532) * [-406.027] (-405.422) (-411.746) (-407.753) -- 0:00:19
      686500 -- [-405.306] (-403.896) (-405.597) (-404.879) * (-409.505) (-403.961) (-407.161) [-406.132] -- 0:00:19
      687000 -- (-408.134) (-403.910) [-408.075] (-404.519) * (-408.879) [-405.563] (-406.847) (-405.649) -- 0:00:19
      687500 -- (-410.284) (-404.690) (-407.270) [-405.832] * (-406.668) (-404.729) (-403.952) [-408.686] -- 0:00:19
      688000 -- [-405.053] (-409.427) (-408.290) (-405.310) * (-407.216) (-405.660) (-403.957) [-407.940] -- 0:00:19
      688500 -- (-403.814) [-406.549] (-404.639) (-405.239) * (-408.408) [-409.407] (-404.839) (-405.453) -- 0:00:19
      689000 -- (-404.674) (-404.581) [-406.349] (-404.515) * (-404.168) (-405.090) (-404.818) [-405.403] -- 0:00:18
      689500 -- (-403.570) (-403.226) [-405.720] (-407.376) * (-405.255) (-404.346) (-405.852) [-406.507] -- 0:00:18
      690000 -- [-403.322] (-404.344) (-407.001) (-405.387) * (-404.357) (-404.114) [-404.540] (-407.592) -- 0:00:18

      Average standard deviation of split frequencies: 0.006271

      690500 -- (-405.296) [-406.434] (-407.067) (-404.546) * [-403.358] (-407.536) (-405.648) (-413.428) -- 0:00:18
      691000 -- (-404.549) [-404.045] (-406.603) (-406.776) * [-404.595] (-404.410) (-405.390) (-404.653) -- 0:00:18
      691500 -- [-405.215] (-405.080) (-407.496) (-404.398) * (-406.127) (-405.671) [-407.260] (-411.102) -- 0:00:18
      692000 -- (-405.674) (-404.739) [-403.695] (-406.262) * (-407.370) (-406.065) (-408.154) [-405.550] -- 0:00:18
      692500 -- [-406.171] (-405.759) (-406.136) (-405.171) * (-404.466) [-403.604] (-407.715) (-405.551) -- 0:00:18
      693000 -- (-406.847) [-405.105] (-408.645) (-404.941) * [-404.658] (-404.646) (-410.960) (-406.532) -- 0:00:19
      693500 -- (-404.121) (-403.084) (-404.611) [-405.846] * (-407.273) (-409.124) [-404.570] (-405.488) -- 0:00:19
      694000 -- (-406.475) (-403.098) (-404.575) [-406.283] * (-411.587) (-406.700) (-403.762) [-403.712] -- 0:00:18
      694500 -- (-406.629) (-405.225) [-406.080] (-406.854) * (-408.434) (-408.181) (-403.263) [-406.267] -- 0:00:18
      695000 -- (-407.190) (-405.119) [-408.790] (-404.485) * (-403.450) (-403.954) [-407.061] (-406.111) -- 0:00:18

      Average standard deviation of split frequencies: 0.005969

      695500 -- (-407.972) (-406.574) [-405.300] (-403.884) * [-403.942] (-403.806) (-408.962) (-408.669) -- 0:00:18
      696000 -- (-404.945) (-407.642) (-408.039) [-405.180] * (-409.382) (-408.285) (-405.868) [-403.860] -- 0:00:18
      696500 -- [-403.852] (-405.087) (-404.688) (-403.386) * (-407.463) (-407.848) (-406.350) [-408.426] -- 0:00:18
      697000 -- (-404.591) [-406.749] (-405.890) (-404.352) * (-407.024) (-406.188) (-408.534) [-404.195] -- 0:00:18
      697500 -- (-404.271) (-407.990) [-405.528] (-405.022) * [-406.230] (-404.302) (-405.797) (-405.560) -- 0:00:18
      698000 -- (-405.512) (-404.324) [-404.036] (-406.127) * [-404.501] (-406.132) (-404.629) (-406.788) -- 0:00:18
      698500 -- [-404.396] (-409.726) (-406.148) (-408.081) * (-406.174) (-404.538) (-405.658) [-406.813] -- 0:00:18
      699000 -- (-405.619) [-405.660] (-414.895) (-405.289) * [-405.508] (-403.854) (-404.088) (-404.787) -- 0:00:18
      699500 -- (-410.015) (-408.215) [-407.006] (-404.008) * [-404.619] (-404.086) (-406.965) (-406.538) -- 0:00:18
      700000 -- (-410.272) (-409.838) [-407.162] (-404.286) * (-403.854) (-404.936) [-406.982] (-403.481) -- 0:00:18

      Average standard deviation of split frequencies: 0.005971

      700500 -- (-407.684) [-407.745] (-404.557) (-405.663) * (-408.832) [-403.834] (-404.822) (-405.285) -- 0:00:18
      701000 -- (-405.855) (-404.932) [-405.799] (-404.467) * (-408.702) (-405.640) [-405.779] (-405.291) -- 0:00:18
      701500 -- (-405.599) (-404.704) (-408.127) [-403.579] * (-405.782) (-404.196) (-404.005) [-407.217] -- 0:00:18
      702000 -- (-404.906) (-406.406) (-407.203) [-404.659] * (-405.508) (-404.854) [-403.121] (-404.802) -- 0:00:18
      702500 -- (-405.276) (-407.668) [-405.228] (-405.351) * (-405.941) [-404.162] (-403.180) (-405.719) -- 0:00:18
      703000 -- [-403.420] (-405.921) (-403.537) (-406.521) * (-410.368) (-406.142) [-404.204] (-404.250) -- 0:00:18
      703500 -- (-404.409) (-405.520) [-410.483] (-406.302) * [-404.134] (-408.370) (-403.917) (-404.333) -- 0:00:18
      704000 -- (-405.638) (-408.626) (-409.563) [-404.878] * (-403.684) (-407.733) (-405.811) [-404.782] -- 0:00:18
      704500 -- [-405.128] (-404.866) (-405.287) (-403.646) * (-407.057) (-405.493) [-406.088] (-404.679) -- 0:00:18
      705000 -- [-404.533] (-404.447) (-403.914) (-404.998) * [-407.779] (-404.621) (-404.563) (-404.226) -- 0:00:17

      Average standard deviation of split frequencies: 0.005676

      705500 -- [-404.171] (-406.835) (-404.377) (-406.279) * (-408.393) (-406.578) (-406.114) [-404.946] -- 0:00:17
      706000 -- (-404.523) [-403.553] (-405.350) (-405.343) * (-405.095) (-404.665) [-404.485] (-407.002) -- 0:00:17
      706500 -- (-404.256) (-406.888) (-413.764) [-403.297] * (-405.026) [-409.095] (-404.167) (-405.743) -- 0:00:17
      707000 -- (-405.744) [-404.091] (-406.693) (-405.456) * [-407.901] (-405.416) (-410.988) (-410.237) -- 0:00:17
      707500 -- (-406.307) (-403.747) (-408.672) [-404.600] * (-410.547) (-405.387) (-404.495) [-404.786] -- 0:00:17
      708000 -- (-406.910) [-405.880] (-407.081) (-404.390) * [-407.640] (-405.762) (-403.813) (-403.807) -- 0:00:17
      708500 -- [-404.952] (-407.818) (-406.821) (-408.886) * (-406.818) [-407.306] (-406.070) (-404.006) -- 0:00:17
      709000 -- [-407.778] (-406.173) (-406.770) (-404.548) * (-404.681) (-407.042) (-407.171) [-405.494] -- 0:00:17
      709500 -- (-405.486) (-403.993) [-407.367] (-409.706) * (-405.702) (-405.348) (-408.253) [-405.715] -- 0:00:18
      710000 -- (-405.916) (-405.145) [-406.791] (-405.379) * (-405.000) (-404.292) (-406.233) [-407.286] -- 0:00:17

      Average standard deviation of split frequencies: 0.005265

      710500 -- (-407.619) [-404.037] (-404.053) (-404.782) * (-404.853) (-405.894) [-405.101] (-405.925) -- 0:00:17
      711000 -- [-405.740] (-407.032) (-403.518) (-405.105) * (-404.791) (-403.345) (-403.981) [-404.827] -- 0:00:17
      711500 -- (-406.247) (-406.256) [-405.103] (-404.310) * [-404.066] (-407.448) (-406.805) (-407.942) -- 0:00:17
      712000 -- (-405.272) (-403.190) [-407.076] (-406.591) * [-405.829] (-403.904) (-408.503) (-405.539) -- 0:00:17
      712500 -- [-404.828] (-404.407) (-404.922) (-404.283) * (-403.687) [-406.547] (-404.952) (-409.333) -- 0:00:17
      713000 -- (-410.835) [-404.577] (-413.242) (-406.279) * (-404.243) [-404.086] (-406.276) (-406.269) -- 0:00:17
      713500 -- (-408.072) (-403.446) (-403.815) [-404.796] * (-403.939) [-404.574] (-403.207) (-406.840) -- 0:00:17
      714000 -- (-404.657) (-404.365) [-405.154] (-405.354) * [-404.276] (-411.034) (-406.213) (-403.468) -- 0:00:17
      714500 -- (-405.426) [-404.105] (-405.318) (-404.198) * (-404.509) (-404.174) [-406.720] (-403.304) -- 0:00:17
      715000 -- (-408.155) (-407.456) [-403.668] (-404.818) * [-405.498] (-404.298) (-405.940) (-403.539) -- 0:00:17

      Average standard deviation of split frequencies: 0.005349

      715500 -- (-405.262) (-404.994) [-403.668] (-405.103) * (-404.024) (-405.981) (-406.853) [-406.517] -- 0:00:17
      716000 -- (-410.126) (-406.173) [-404.920] (-408.359) * (-409.141) [-405.465] (-404.621) (-403.336) -- 0:00:17
      716500 -- (-406.586) (-404.701) (-404.681) [-406.459] * (-408.812) (-410.132) [-404.926] (-403.508) -- 0:00:17
      717000 -- (-404.421) (-408.922) [-405.776] (-404.965) * [-403.883] (-404.553) (-407.422) (-406.574) -- 0:00:17
      717500 -- (-404.392) [-403.331] (-405.467) (-407.853) * (-406.029) (-404.768) (-408.755) [-408.328] -- 0:00:17
      718000 -- (-408.248) (-405.496) [-404.827] (-407.713) * [-405.588] (-403.493) (-404.751) (-410.491) -- 0:00:17
      718500 -- (-408.686) [-404.718] (-404.843) (-405.464) * (-405.133) (-406.169) [-403.896] (-403.744) -- 0:00:17
      719000 -- (-407.080) [-404.540] (-408.083) (-404.516) * (-410.310) (-409.534) [-403.848] (-404.670) -- 0:00:17
      719500 -- (-406.388) (-404.861) [-406.251] (-404.500) * (-408.031) (-404.868) [-405.918] (-412.497) -- 0:00:17
      720000 -- (-407.577) (-404.464) (-404.861) [-406.660] * [-406.848] (-404.316) (-405.337) (-403.988) -- 0:00:17

      Average standard deviation of split frequencies: 0.005642

      720500 -- (-405.597) (-404.513) [-403.861] (-404.699) * [-407.489] (-404.452) (-404.029) (-407.258) -- 0:00:17
      721000 -- (-405.013) (-404.769) [-403.225] (-404.918) * [-406.564] (-405.422) (-404.750) (-404.898) -- 0:00:17
      721500 -- [-405.643] (-405.567) (-404.858) (-404.590) * (-408.074) (-404.394) [-406.268] (-406.297) -- 0:00:16
      722000 -- (-405.000) [-406.519] (-405.543) (-403.676) * [-409.262] (-407.511) (-404.625) (-404.399) -- 0:00:16
      722500 -- [-403.766] (-404.040) (-406.468) (-404.945) * (-408.579) (-410.108) [-404.681] (-403.665) -- 0:00:16
      723000 -- (-404.273) [-407.070] (-411.902) (-405.562) * (-404.618) (-408.354) (-404.089) [-404.671] -- 0:00:16
      723500 -- [-410.923] (-405.712) (-404.231) (-405.165) * (-404.571) (-404.842) [-404.481] (-409.682) -- 0:00:16
      724000 -- (-405.657) (-407.901) [-407.674] (-404.397) * (-407.596) [-405.127] (-404.042) (-406.329) -- 0:00:16
      724500 -- (-404.841) (-406.838) (-406.881) [-404.790] * [-407.421] (-404.048) (-403.214) (-407.974) -- 0:00:16
      725000 -- (-404.568) [-404.869] (-406.648) (-404.779) * [-409.456] (-404.068) (-404.873) (-403.785) -- 0:00:16

      Average standard deviation of split frequencies: 0.005803

      725500 -- (-411.550) (-405.289) (-411.750) [-406.635] * (-410.363) (-405.179) (-404.987) [-404.068] -- 0:00:16
      726000 -- (-405.030) (-405.356) [-406.410] (-404.912) * (-407.461) [-405.237] (-404.843) (-406.478) -- 0:00:16
      726500 -- (-406.173) (-404.977) [-405.117] (-403.614) * (-403.197) [-406.840] (-403.671) (-404.602) -- 0:00:16
      727000 -- (-406.063) [-405.386] (-405.223) (-408.329) * (-404.501) (-408.682) [-404.815] (-404.166) -- 0:00:16
      727500 -- [-405.735] (-406.046) (-405.644) (-408.002) * (-410.640) [-406.372] (-404.474) (-407.005) -- 0:00:16
      728000 -- (-411.230) (-407.742) (-404.151) [-404.464] * (-410.548) (-405.560) [-404.513] (-404.727) -- 0:00:16
      728500 -- (-408.081) (-405.274) [-408.482] (-406.893) * (-404.899) (-405.651) [-404.654] (-407.930) -- 0:00:16
      729000 -- [-405.983] (-404.104) (-407.656) (-404.905) * [-404.670] (-407.457) (-405.669) (-405.330) -- 0:00:16
      729500 -- (-405.513) (-406.074) (-408.036) [-403.517] * (-407.411) (-405.149) [-403.883] (-404.795) -- 0:00:16
      730000 -- (-404.626) (-405.258) (-408.821) [-407.076] * (-408.552) [-410.263] (-403.210) (-405.022) -- 0:00:16

      Average standard deviation of split frequencies: 0.005887

      730500 -- (-406.705) [-405.449] (-404.462) (-403.596) * [-404.117] (-408.887) (-411.270) (-404.607) -- 0:00:16
      731000 -- [-403.686] (-405.184) (-404.862) (-404.494) * (-406.073) (-405.936) (-406.075) [-404.021] -- 0:00:16
      731500 -- [-406.761] (-407.376) (-404.371) (-404.702) * (-405.420) (-413.405) [-405.497] (-404.795) -- 0:00:16
      732000 -- (-405.547) (-405.664) (-408.066) [-407.359] * (-406.679) [-405.277] (-405.755) (-406.587) -- 0:00:16
      732500 -- [-406.019] (-407.655) (-404.722) (-405.453) * (-407.178) [-405.415] (-405.979) (-407.473) -- 0:00:16
      733000 -- (-404.859) (-404.766) [-404.382] (-407.180) * [-407.648] (-407.760) (-406.173) (-405.240) -- 0:00:16
      733500 -- (-404.355) (-404.438) (-403.240) [-405.031] * (-409.687) [-408.159] (-404.560) (-407.669) -- 0:00:16
      734000 -- (-404.373) [-405.594] (-406.519) (-403.711) * (-406.885) [-404.104] (-404.215) (-412.002) -- 0:00:16
      734500 -- (-405.282) (-404.341) [-404.369] (-403.219) * (-404.769) (-404.827) [-407.769] (-406.021) -- 0:00:16
      735000 -- (-404.584) (-406.167) (-408.041) [-404.601] * (-405.182) [-404.750] (-406.312) (-406.888) -- 0:00:16

      Average standard deviation of split frequencies: 0.005604

      735500 -- (-403.407) (-404.111) (-404.254) [-404.366] * (-405.993) (-404.342) (-404.955) [-404.644] -- 0:00:16
      736000 -- (-405.788) (-407.961) (-407.204) [-404.426] * (-403.951) (-409.361) (-404.441) [-404.451] -- 0:00:16
      736500 -- (-404.270) (-408.326) (-404.138) [-404.509] * (-408.379) (-406.452) (-406.615) [-404.992] -- 0:00:16
      737000 -- (-403.463) (-405.610) (-404.223) [-404.491] * (-407.341) [-404.957] (-406.205) (-406.007) -- 0:00:16
      737500 -- [-404.248] (-407.396) (-405.343) (-406.157) * (-407.937) [-403.813] (-403.534) (-404.905) -- 0:00:16
      738000 -- (-404.887) (-406.704) (-404.833) [-403.381] * (-403.683) [-404.243] (-404.192) (-407.959) -- 0:00:15
      738500 -- (-407.184) (-406.959) (-408.135) [-403.859] * (-404.755) (-406.571) (-408.925) [-403.251] -- 0:00:15
      739000 -- (-403.353) [-404.755] (-409.513) (-404.554) * (-404.690) [-407.158] (-410.818) (-403.205) -- 0:00:15
      739500 -- (-404.621) (-404.118) (-404.876) [-404.514] * [-404.979] (-404.812) (-405.636) (-404.974) -- 0:00:15
      740000 -- (-404.933) (-404.549) [-403.439] (-404.379) * (-405.635) (-404.569) (-405.841) [-405.541] -- 0:00:15

      Average standard deviation of split frequencies: 0.005887

      740500 -- (-406.336) (-409.998) (-405.076) [-403.973] * (-404.281) [-406.629] (-404.791) (-404.689) -- 0:00:15
      741000 -- (-405.982) [-405.693] (-405.357) (-404.239) * (-406.767) [-406.339] (-403.420) (-404.874) -- 0:00:15
      741500 -- [-403.596] (-405.174) (-404.255) (-407.035) * (-404.728) [-405.034] (-404.195) (-406.020) -- 0:00:15
      742000 -- (-406.020) (-405.367) [-406.195] (-405.228) * (-403.878) [-406.318] (-405.934) (-404.642) -- 0:00:15
      742500 -- (-408.556) (-406.369) [-404.760] (-403.903) * (-406.326) [-406.766] (-413.288) (-407.672) -- 0:00:15
      743000 -- [-404.343] (-405.312) (-409.297) (-403.429) * (-406.587) [-411.682] (-407.909) (-405.322) -- 0:00:15
      743500 -- (-404.655) (-404.210) [-404.800] (-403.207) * [-405.861] (-408.160) (-407.973) (-406.255) -- 0:00:15
      744000 -- (-407.709) (-407.330) (-403.609) [-403.244] * (-404.072) (-408.438) (-408.125) [-403.855] -- 0:00:15
      744500 -- (-408.303) (-407.961) (-408.930) [-405.750] * (-403.693) (-404.292) (-407.518) [-406.789] -- 0:00:15
      745000 -- [-409.452] (-407.655) (-405.119) (-406.367) * (-403.703) (-407.201) [-408.543] (-405.480) -- 0:00:15

      Average standard deviation of split frequencies: 0.006556

      745500 -- (-404.810) (-404.725) (-405.055) [-404.579] * (-407.576) [-405.930] (-406.195) (-404.354) -- 0:00:15
      746000 -- [-404.153] (-405.498) (-407.722) (-405.066) * (-406.453) [-409.499] (-406.204) (-404.183) -- 0:00:15
      746500 -- (-408.839) (-409.177) (-404.939) [-403.728] * [-405.157] (-405.163) (-408.755) (-405.093) -- 0:00:15
      747000 -- (-404.873) (-403.805) (-406.889) [-404.617] * (-406.143) (-407.325) (-404.724) [-405.211] -- 0:00:15
      747500 -- (-404.072) (-406.397) (-404.910) [-403.891] * (-404.790) (-404.495) (-403.797) [-403.473] -- 0:00:15
      748000 -- (-404.580) (-406.695) (-406.305) [-404.308] * (-404.530) [-403.240] (-405.949) (-406.703) -- 0:00:15
      748500 -- (-403.325) [-404.498] (-405.279) (-404.984) * (-404.785) [-405.242] (-405.480) (-407.084) -- 0:00:15
      749000 -- (-403.939) (-408.026) [-407.238] (-404.449) * (-406.178) (-404.753) [-406.908] (-405.021) -- 0:00:15
      749500 -- (-407.367) (-406.553) [-407.709] (-403.630) * [-405.620] (-406.123) (-403.648) (-410.030) -- 0:00:15
      750000 -- [-407.912] (-404.740) (-405.405) (-403.332) * (-405.450) [-406.910] (-407.180) (-405.290) -- 0:00:15

      Average standard deviation of split frequencies: 0.006829

      750500 -- (-406.861) (-407.707) [-404.800] (-403.910) * [-403.877] (-405.214) (-403.564) (-404.682) -- 0:00:15
      751000 -- (-407.783) (-406.911) (-407.864) [-405.000] * (-406.977) (-405.780) [-403.903] (-404.699) -- 0:00:15
      751500 -- (-404.215) [-405.128] (-407.307) (-410.537) * (-404.424) (-405.964) [-405.757] (-403.928) -- 0:00:15
      752000 -- (-404.391) (-403.966) (-404.301) [-406.038] * (-405.116) [-406.908] (-409.571) (-404.946) -- 0:00:15
      752500 -- (-404.562) (-406.323) (-405.830) [-407.280] * (-409.072) [-405.564] (-407.167) (-406.699) -- 0:00:15
      753000 -- [-404.919] (-409.846) (-406.961) (-405.539) * (-411.324) (-405.758) (-405.377) [-404.450] -- 0:00:15
      753500 -- (-405.850) [-404.057] (-405.756) (-404.327) * (-405.856) (-404.569) (-406.500) [-405.679] -- 0:00:15
      754000 -- (-404.628) (-404.196) (-406.724) [-406.638] * (-408.643) (-405.681) [-404.054] (-407.183) -- 0:00:15
      754500 -- (-406.068) (-409.170) (-409.524) [-405.329] * (-407.596) (-404.684) (-404.844) [-404.477] -- 0:00:14
      755000 -- (-408.434) [-407.984] (-405.097) (-403.607) * (-404.780) (-404.534) (-405.673) [-404.593] -- 0:00:14

      Average standard deviation of split frequencies: 0.006859

      755500 -- (-404.250) [-404.066] (-406.598) (-404.923) * (-405.446) (-409.536) (-404.825) [-405.421] -- 0:00:14
      756000 -- (-403.685) (-404.524) (-407.427) [-408.668] * (-403.770) (-410.504) [-406.758] (-403.944) -- 0:00:14
      756500 -- [-404.017] (-404.865) (-405.951) (-411.854) * [-404.416] (-408.199) (-406.372) (-407.103) -- 0:00:14
      757000 -- (-405.310) (-406.486) [-406.053] (-404.845) * (-405.196) (-411.947) (-405.927) [-404.507] -- 0:00:14
      757500 -- (-404.303) (-410.053) [-406.112] (-404.546) * (-407.177) (-407.359) (-406.077) [-407.225] -- 0:00:14
      758000 -- [-403.543] (-404.440) (-408.717) (-405.092) * (-406.452) (-404.890) [-405.561] (-408.861) -- 0:00:14
      758500 -- (-403.672) (-405.915) (-404.596) [-407.324] * (-407.582) (-403.518) [-406.499] (-417.009) -- 0:00:14
      759000 -- (-406.963) [-403.422] (-404.277) (-404.731) * (-408.032) [-406.029] (-406.571) (-411.330) -- 0:00:14
      759500 -- [-404.115] (-406.579) (-404.127) (-403.393) * [-404.630] (-411.496) (-403.612) (-407.019) -- 0:00:14
      760000 -- (-404.281) [-404.933] (-405.864) (-403.696) * [-404.169] (-405.446) (-403.929) (-405.555) -- 0:00:14

      Average standard deviation of split frequencies: 0.006933

      760500 -- [-403.230] (-406.706) (-405.145) (-404.022) * (-405.897) (-405.862) (-407.176) [-404.896] -- 0:00:14
      761000 -- (-405.056) (-404.713) (-413.871) [-406.814] * (-406.750) (-406.246) (-406.252) [-404.781] -- 0:00:14
      761500 -- [-407.525] (-405.079) (-414.178) (-404.259) * (-406.520) (-406.076) (-408.960) [-404.401] -- 0:00:14
      762000 -- (-406.072) (-406.118) (-408.400) [-403.542] * (-405.486) [-407.301] (-406.190) (-404.316) -- 0:00:14
      762500 -- (-405.463) (-407.797) (-408.203) [-404.369] * [-405.923] (-405.699) (-407.078) (-405.649) -- 0:00:14
      763000 -- (-409.101) (-404.100) (-406.891) [-404.414] * (-405.534) [-403.605] (-404.407) (-406.599) -- 0:00:14
      763500 -- (-407.817) [-405.857] (-404.418) (-405.432) * (-413.316) (-404.527) [-403.927] (-406.621) -- 0:00:14
      764000 -- (-408.648) (-404.532) [-405.188] (-404.312) * (-403.910) (-407.500) (-409.624) [-406.367] -- 0:00:14
      764500 -- (-405.145) (-407.720) [-404.500] (-405.092) * (-403.533) (-405.294) (-403.330) [-408.671] -- 0:00:14
      765000 -- (-404.653) (-408.136) (-405.621) [-405.228] * [-403.270] (-406.493) (-408.254) (-405.088) -- 0:00:14

      Average standard deviation of split frequencies: 0.006116

      765500 -- (-406.944) (-403.229) [-404.227] (-407.393) * [-404.436] (-405.156) (-405.798) (-405.406) -- 0:00:14
      766000 -- [-406.167] (-404.381) (-405.224) (-408.583) * (-406.716) [-407.000] (-404.094) (-404.528) -- 0:00:14
      766500 -- [-408.366] (-403.836) (-403.872) (-403.895) * (-405.292) (-406.557) [-404.890] (-405.795) -- 0:00:14
      767000 -- [-405.210] (-408.499) (-405.194) (-404.596) * [-408.057] (-405.267) (-403.271) (-405.456) -- 0:00:14
      767500 -- (-406.091) (-405.867) [-407.163] (-405.633) * (-405.709) (-404.031) [-404.970] (-410.439) -- 0:00:14
      768000 -- [-403.743] (-406.388) (-409.339) (-405.408) * (-404.663) [-406.395] (-404.074) (-404.076) -- 0:00:14
      768500 -- [-407.856] (-405.529) (-405.055) (-403.888) * [-404.662] (-406.995) (-403.525) (-404.733) -- 0:00:14
      769000 -- (-407.157) (-406.485) (-405.700) [-403.900] * [-404.695] (-405.336) (-405.537) (-405.437) -- 0:00:14
      769500 -- (-410.197) (-408.087) [-405.050] (-411.844) * (-404.969) (-407.670) (-408.063) [-409.651] -- 0:00:14
      770000 -- (-404.833) (-405.869) [-405.198] (-408.426) * (-405.065) (-409.831) [-404.986] (-408.455) -- 0:00:14

      Average standard deviation of split frequencies: 0.005658

      770500 -- [-405.232] (-407.101) (-408.097) (-409.614) * (-404.194) (-412.725) [-407.531] (-405.942) -- 0:00:13
      771000 -- (-405.750) (-405.087) [-408.598] (-407.356) * [-404.977] (-409.621) (-408.695) (-405.764) -- 0:00:13
      771500 -- (-410.229) [-403.570] (-408.793) (-408.520) * (-406.848) [-407.120] (-412.622) (-405.681) -- 0:00:13
      772000 -- (-404.344) [-405.047] (-403.907) (-405.461) * (-405.511) (-408.422) (-408.236) [-405.683] -- 0:00:13
      772500 -- (-405.811) (-406.521) (-403.687) [-408.688] * (-404.768) (-405.373) (-404.771) [-406.270] -- 0:00:13
      773000 -- [-404.972] (-405.454) (-407.639) (-407.245) * (-409.548) (-404.808) [-404.014] (-405.245) -- 0:00:13
      773500 -- [-406.900] (-405.638) (-405.399) (-406.508) * (-405.874) (-405.388) (-403.467) [-405.408] -- 0:00:13
      774000 -- (-405.297) (-405.227) [-405.070] (-407.070) * (-408.676) (-405.178) [-405.652] (-407.438) -- 0:00:13
      774500 -- (-406.573) (-407.279) [-404.566] (-410.572) * (-404.668) (-405.791) [-405.300] (-405.775) -- 0:00:13
      775000 -- (-407.284) (-409.394) [-404.323] (-403.594) * (-404.919) (-404.997) (-404.401) [-405.510] -- 0:00:13

      Average standard deviation of split frequencies: 0.005847

      775500 -- (-405.602) (-406.237) [-406.201] (-409.252) * (-405.542) (-403.418) [-404.912] (-404.880) -- 0:00:13
      776000 -- (-404.526) (-404.835) (-403.678) [-403.417] * [-405.420] (-405.408) (-404.447) (-406.607) -- 0:00:13
      776500 -- (-406.339) [-403.653] (-404.379) (-405.339) * (-408.490) (-403.298) (-404.732) [-404.131] -- 0:00:13
      777000 -- (-404.001) [-403.861] (-405.057) (-404.119) * (-405.836) [-404.646] (-406.293) (-405.316) -- 0:00:13
      777500 -- (-403.663) [-406.316] (-410.463) (-404.220) * [-408.223] (-407.196) (-406.527) (-405.065) -- 0:00:13
      778000 -- [-403.566] (-407.948) (-414.793) (-405.670) * (-406.816) (-408.239) [-404.413] (-405.315) -- 0:00:13
      778500 -- (-403.606) (-405.817) [-406.848] (-405.575) * (-405.603) (-406.243) [-403.664] (-404.922) -- 0:00:13
      779000 -- (-407.904) (-404.365) [-403.959] (-403.410) * (-405.572) (-405.158) [-405.155] (-406.812) -- 0:00:13
      779500 -- (-405.405) (-405.389) [-403.736] (-403.533) * [-405.264] (-405.535) (-404.840) (-405.810) -- 0:00:13
      780000 -- (-408.547) (-406.430) [-404.322] (-407.047) * (-404.728) [-403.702] (-408.054) (-406.479) -- 0:00:13

      Average standard deviation of split frequencies: 0.006227

      780500 -- (-406.976) [-404.988] (-403.590) (-405.113) * (-405.762) [-403.285] (-403.870) (-407.512) -- 0:00:13
      781000 -- (-406.082) (-405.707) [-411.572] (-404.463) * (-408.034) (-411.338) [-403.878] (-404.396) -- 0:00:13
      781500 -- (-407.424) [-406.417] (-408.223) (-403.465) * (-405.717) (-406.480) [-405.909] (-405.291) -- 0:00:13
      782000 -- (-405.841) (-405.845) [-405.382] (-404.623) * (-404.154) (-407.359) (-405.856) [-404.964] -- 0:00:13
      782500 -- (-408.664) (-404.149) (-408.533) [-405.134] * (-405.138) [-407.227] (-406.117) (-404.673) -- 0:00:13
      783000 -- (-403.817) (-409.188) [-406.466] (-404.216) * [-405.058] (-407.312) (-408.116) (-404.329) -- 0:00:13
      783500 -- (-403.251) [-406.968] (-407.923) (-405.719) * (-406.158) [-405.167] (-404.228) (-406.036) -- 0:00:13
      784000 -- (-406.190) [-405.466] (-405.101) (-404.888) * (-405.701) (-405.944) (-406.401) [-406.777] -- 0:00:13
      784500 -- (-410.157) (-406.905) (-409.151) [-404.458] * (-407.322) (-403.312) (-404.245) [-404.578] -- 0:00:13
      785000 -- (-405.526) (-405.649) [-405.931] (-405.008) * [-404.058] (-403.158) (-406.931) (-407.995) -- 0:00:13

      Average standard deviation of split frequencies: 0.005848

      785500 -- (-405.607) (-404.482) (-407.949) [-407.610] * (-404.572) [-406.441] (-407.442) (-403.268) -- 0:00:13
      786000 -- (-405.387) (-403.614) [-405.590] (-408.531) * (-403.528) (-406.168) (-404.263) [-403.790] -- 0:00:13
      786500 -- (-408.528) (-405.321) [-405.304] (-404.169) * (-406.608) [-405.095] (-404.266) (-405.870) -- 0:00:13
      787000 -- (-406.624) (-406.140) [-403.327] (-406.585) * (-404.040) [-407.974] (-405.106) (-405.340) -- 0:00:12
      787500 -- [-405.131] (-406.067) (-404.762) (-408.960) * (-406.116) (-411.869) (-404.045) [-404.770] -- 0:00:12
      788000 -- (-403.889) [-404.767] (-409.160) (-404.975) * (-405.333) (-407.162) (-405.806) [-405.537] -- 0:00:12
      788500 -- [-404.776] (-407.442) (-405.097) (-404.82