--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:30:07 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2537/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2537/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2537/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/9res/ML2537/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2639.33         -2643.04
2      -2639.40         -2642.82
--------------------------------------
TOTAL    -2639.36         -2642.94
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/9res/ML2537/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2537/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2537/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.892521    0.091376    0.357115    1.495448    0.860821   1315.22   1408.11    1.000
r(A<->C){all}   0.141263    0.016133    0.000038    0.399033    0.105146    193.24    228.20    1.001
r(A<->G){all}   0.161646    0.018467    0.000060    0.433948    0.125844    143.77    215.20    1.001
r(A<->T){all}   0.175793    0.020541    0.000184    0.455270    0.139436    104.21    147.29    1.001
r(C<->G){all}   0.151989    0.018079    0.000018    0.432559    0.114562    250.17    273.40    1.000
r(C<->T){all}   0.196575    0.021284    0.000158    0.469057    0.170057    207.00    227.74    1.002
r(G<->T){all}   0.172734    0.020642    0.000006    0.467884    0.133888    193.15    244.49    1.000
pi(A){all}      0.195075    0.000085    0.176667    0.213093    0.195200   1243.70   1315.44    1.000
pi(C){all}      0.288225    0.000106    0.268940    0.308310    0.288159   1093.55   1183.87    1.000
pi(G){all}      0.308841    0.000110    0.288030    0.328445    0.309170   1180.24   1288.91    1.000
pi(T){all}      0.207859    0.000085    0.190143    0.226298    0.207666   1319.83   1337.09    1.002
alpha{1,2}      0.312121    0.142043    0.000872    1.086301    0.191813   1416.38   1458.69    1.000
alpha{3}        0.417720    0.224424    0.000189    1.384348    0.246862   1446.43   1473.71    1.001
pinvar{all}     0.998380    0.000002    0.995919    0.999971    0.998717   1136.14   1263.93    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-2543.815263
Model 2: PositiveSelection	-2543.402232
Model 0: one-ratio	-2543.402847
Model 7: beta	-2543.815263
Model 8: beta&w>1	-2543.402232


Model 0 vs 1	0.8248320000002423

Model 2 vs 1	0.8260620000000927

Model 8 vs 7	0.8260620000000927
>C1
MLISGRSGWAILGTGGKAAVNRGDAGKLGGQSVIARAHVKVDGDVVSRFA
TCCRALGLAVYDRQRPADLAAARSGFTALARIAHDQCDVWIGLAAAGDVS
TPVLAAISCTADTAGMLQRQVELAPAALGFHYDTGLYLQFRAIGPDDFHL
AYAASLASTGGPGPYAEADQIVTGIIDRRPGWRDARWVAAVIHYRAGRWS
DVVKLLTPIVNDPDIDEAYTHAAKIALGTALARLGMFAPALSYLEEPAGP
VAVAAVDGALAKALVLRAHTDEESASEVLQDLYAAHPDNEQIEQALSDTS
FGIVTTTAARIDARTDPWDPETEPGVEDFIDPAAHERKAVLLHEAERQLA
EFIGLDEVKNQVSRLKSSVAMELVRKQRGLMVAQRAHHLVFAGPPGTGKT
TIARVVAKVYCGLGLLKKENIREVHRADLIGQHIGETEAKTNAVIDSALD
GVLFLDEAYALVATGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRADL
DKFLDTNEGLRSRFTRNIDFPSYASHELVEIAHKMAEQRDSVFEQAALDE
LEVLFANLATSSTPDSNGISRRSLDIAGNGRFVRNIVERSEEEREFRLDH
SNNVGTGELSDEELMTVTSEDVRRSVEPLLRGLGLMVPHD
>C2
MLISGRSGWAILGTGGKAAVNRGDAGKLGGQSVIARAHVKVDGDVVSRFA
TCCRALGLAVYDRQRPADLAAARSGFTALARIAHDQCDVWIGLAAAGDVS
TPVLAAISCTADTAGMLQRQVELAPAALGFHYDTGLYLQFRAIGPDDFHL
AYAASLASTGGPGPYAEADQIVTGIIDRRPGWRDARWVAAVIHYRAGRWS
DVVKLLTPIVNDPDIDEAYTHAAKIALGTALARLGMFAPALSYLEEPAGP
VAVAAVDGALAKALVLRAHTDEESASEVLQDLYAAHPDNEQIEQALSDTS
FGIVTTTAARIDARTDPWDPETEPGVEDFIDPAAHERKAVLLHEAERQLA
EFIGLDEVKNQVSRLKSSVAMELVRKQRGLMVAQRAHHLVFAGPPGTGKT
TIARVVAKVYCGLGLLKKENIREVHRADLIGQHIGETEAKTNAVIDSALD
GVLFLDEAYALVATGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRADL
DKFLDTNEGLRSRFTRNIDFPSYASHELVEIAHKMAEQRDSVFEQAALDE
LEVLFANLATSSTPDSNGISRRSLDIAGNGRFVRNIVERSEEEREFRLDH
SNNVGTGELSDEELMTVTSEDVRRSVEPLLRGLGLMVPHD
>C3
MLISGRSGWAILGTGGKAAVNRGDAGKLGGQSVIARAHVKVDGDVVSRFA
TCCRALGLAVYDRQRPADLAAARSGFTALARIAHDQCDVWIGLAAAGDVS
TPVLAAISCTADTAGMLQRQVELAPAALGFHYDTGLYLQFRAIGPDDFHL
AYAASLASTGGPGPYAEADQIVTGIIDRRPGWRDARWVAAVIHYRAGRWS
DVVKLLTPIVNDPDIDEAYTHAAKIALGTALARLGMFAPALSYLEEPAGP
VAVAAVDGALAKALVLRAHTDEESASEVLQDLYAAHPDNEQIEQALSDTS
FGIVTTTAARIDARTDPWDPETEPGVEDFIDPAAHERKAVLLHEAERQLA
EFIGLDEVKNQVSRLKSSVAMELVRKQRGLMVAQRAHHLVFAGPPGTGKT
TIARVVAKVYCGLGLLKKENIREVHRADLIGQHIGETEAKTNAVIDSALD
GVLFLDEAYALVATGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRADL
DKFLDTNEGLRSRFTRNIDFPSYASHELVEIAHKMAEQRDSVFEQAALDE
LEVLFANLATSSTPDSNGISRRSLDIAGNGRFVRNIVERSEEEREFRLDH
SNNVGTGELSDEELMTVTSEDVRRSVEPLLRGLGLMVPHD
>C4
MLISGRSGWAILGTGGKAAVNRGDAGKLGGQSVIARAHVKVDGDVVSRFA
TCCRALGLAVYDRQRPADLAAARSGFTALARIAHDQCDVWIGLAAAGDVS
TPVLAAISCTADTAGMLQRQVELAPAALGFHYDTGLYLQFRAIGPDDFHL
AYAASLASTGGPGPYAEADQIVTGIIDRRPGWRDARWVAAVIHYRAGRWS
DVVKLLTPIVNDPDIDEAYTHAAKIALGTALARLGMFAPALSYLEEPAGP
VAVAAVDGALAKALVLRAHTDEESASEVLQDLYAAHPDNEQIEQALSDTS
FGIVTTTAARIDARTDPWDPETEPGVEDFIDPAAHERKAVLLHEAERQLA
EFIGLDEVKNQVSRLKSSVAMELVRKQRGLMVAQRAHHLVFAGPPGTGKT
TIARVVAKVYCGLGLLKKENIREVHRADLIGQHIGETEAKTNAVIDSALD
GVLFLDEAYALVATGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRADL
DKFLDTNEGLRSRFTRNIDFPSYASHELVEIAHKMAEQRDSVFEQAALDE
LEVLFANLATSSTPDSNGISRRSLDIAGNGRFVRNIVERSEEEREFRLDH
SNNVGTGELSDEELMTVTSEDVRRSVEPLLRGLGLMVPHD
>C5
MLISGRSGWAILGTGGKAAVNRGDAGKLGGQSVIARAHVKVDGDVVSRFA
TCCRALGLAVYDRQRPADLAAARSGFTALARIAHDQCDVWIGLAAAGDVS
TPVLAAISCTADTAGMLQRQVELAPAALGFHYDTGLYLQFRAIGPDDFHL
AYAASLASTGGPGPYAEADQIVTGIIDRRPGWRDARWVAAVIHYRAGRWS
DVVKLLTPIVNDPDIDEAYTHAAKIALGTALARLGMFAPALSYLEEPAGP
VAVAAVDGALAKALVLRAHTDEESASEVLQDLYAAHPDNEQIEQALSDTS
FGIVTTTAARIDARTDPWDPETEPGVEDFIDPAAHERKAVLLHEAERQLA
EFIGLDEVKNQVSRLKSSVAMELVRKQRGLMVAQRAHHLVFAGPPGTGKT
TIARVVAKVYCGLGLLKKENIREVHRADLIGQHIGETEAKTNAVIDSALD
GVLFLDEAYALVATGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRADL
DKFLDTNEGLRSRFTRNIDFPSYASHELVEIAHKMAEQRDSVFEQAALDE
LEVLFANLATSSTPDSNGISRRSLDIAGNGRFVRNIVERSEEEREFRLDH
SNNVGTGELSDEELMTVTSEDVRRSVEPLLRGLGLMVPHD
>C6
MLISGRSGWAILGTGGKAAVNRGDAGKLGGQSVIARAHVKVDGDVVSRFA
TCCRALGLAVYDRQRPADLAAARSGFTALARIAHDQCDVWIGLAAAGDVS
TPVLAAISCTADTAGMLQRQVELAPAALGFHYDTGLYLQFRAIGPDDFHL
AYAASLASTGGPGPYAEADQIVTGIIDRRPGWRDARWVAAVIHYRAGRWS
DVVKLLTPIVNDPDIDEAYTHAAKIALGTALARLGMFAPALSYLEEPAGP
VAVAAVDGALAKALVLRAHTDEESASEVLQDLYAAHPDNEQIEQALSDTS
FGIVTTTAARIDARTDPWDPETEPGVEDFIDPAAHERKAVLLHEAERQLA
EFIGLDEVKNQVSRLKSSVAMELVRKQRGLMVAQRAHHLVFAGPPGTGKT
TIARVVAKVYCGLGLLKKENIREVHRADLIGQHIGETEAKTNAVIDSALD
GVLFLDEAYALVATGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRADL
DKFLDTNEGLRSRFTRNIDFPSYASHELVEIAHKMAEQRDSVFEQAALDE
LEVLFANLATSSTLDSNGISRRSLDIAGNGRFVRNIVERSEEEREFRLDH
SNNVGTGELSDEELMTVTSEDVRRSVEPLLRGLGLMVPHD
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=640 

C1              MLISGRSGWAILGTGGKAAVNRGDAGKLGGQSVIARAHVKVDGDVVSRFA
C2              MLISGRSGWAILGTGGKAAVNRGDAGKLGGQSVIARAHVKVDGDVVSRFA
C3              MLISGRSGWAILGTGGKAAVNRGDAGKLGGQSVIARAHVKVDGDVVSRFA
C4              MLISGRSGWAILGTGGKAAVNRGDAGKLGGQSVIARAHVKVDGDVVSRFA
C5              MLISGRSGWAILGTGGKAAVNRGDAGKLGGQSVIARAHVKVDGDVVSRFA
C6              MLISGRSGWAILGTGGKAAVNRGDAGKLGGQSVIARAHVKVDGDVVSRFA
                **************************************************

C1              TCCRALGLAVYDRQRPADLAAARSGFTALARIAHDQCDVWIGLAAAGDVS
C2              TCCRALGLAVYDRQRPADLAAARSGFTALARIAHDQCDVWIGLAAAGDVS
C3              TCCRALGLAVYDRQRPADLAAARSGFTALARIAHDQCDVWIGLAAAGDVS
C4              TCCRALGLAVYDRQRPADLAAARSGFTALARIAHDQCDVWIGLAAAGDVS
C5              TCCRALGLAVYDRQRPADLAAARSGFTALARIAHDQCDVWIGLAAAGDVS
C6              TCCRALGLAVYDRQRPADLAAARSGFTALARIAHDQCDVWIGLAAAGDVS
                **************************************************

C1              TPVLAAISCTADTAGMLQRQVELAPAALGFHYDTGLYLQFRAIGPDDFHL
C2              TPVLAAISCTADTAGMLQRQVELAPAALGFHYDTGLYLQFRAIGPDDFHL
C3              TPVLAAISCTADTAGMLQRQVELAPAALGFHYDTGLYLQFRAIGPDDFHL
C4              TPVLAAISCTADTAGMLQRQVELAPAALGFHYDTGLYLQFRAIGPDDFHL
C5              TPVLAAISCTADTAGMLQRQVELAPAALGFHYDTGLYLQFRAIGPDDFHL
C6              TPVLAAISCTADTAGMLQRQVELAPAALGFHYDTGLYLQFRAIGPDDFHL
                **************************************************

C1              AYAASLASTGGPGPYAEADQIVTGIIDRRPGWRDARWVAAVIHYRAGRWS
C2              AYAASLASTGGPGPYAEADQIVTGIIDRRPGWRDARWVAAVIHYRAGRWS
C3              AYAASLASTGGPGPYAEADQIVTGIIDRRPGWRDARWVAAVIHYRAGRWS
C4              AYAASLASTGGPGPYAEADQIVTGIIDRRPGWRDARWVAAVIHYRAGRWS
C5              AYAASLASTGGPGPYAEADQIVTGIIDRRPGWRDARWVAAVIHYRAGRWS
C6              AYAASLASTGGPGPYAEADQIVTGIIDRRPGWRDARWVAAVIHYRAGRWS
                **************************************************

C1              DVVKLLTPIVNDPDIDEAYTHAAKIALGTALARLGMFAPALSYLEEPAGP
C2              DVVKLLTPIVNDPDIDEAYTHAAKIALGTALARLGMFAPALSYLEEPAGP
C3              DVVKLLTPIVNDPDIDEAYTHAAKIALGTALARLGMFAPALSYLEEPAGP
C4              DVVKLLTPIVNDPDIDEAYTHAAKIALGTALARLGMFAPALSYLEEPAGP
C5              DVVKLLTPIVNDPDIDEAYTHAAKIALGTALARLGMFAPALSYLEEPAGP
C6              DVVKLLTPIVNDPDIDEAYTHAAKIALGTALARLGMFAPALSYLEEPAGP
                **************************************************

C1              VAVAAVDGALAKALVLRAHTDEESASEVLQDLYAAHPDNEQIEQALSDTS
C2              VAVAAVDGALAKALVLRAHTDEESASEVLQDLYAAHPDNEQIEQALSDTS
C3              VAVAAVDGALAKALVLRAHTDEESASEVLQDLYAAHPDNEQIEQALSDTS
C4              VAVAAVDGALAKALVLRAHTDEESASEVLQDLYAAHPDNEQIEQALSDTS
C5              VAVAAVDGALAKALVLRAHTDEESASEVLQDLYAAHPDNEQIEQALSDTS
C6              VAVAAVDGALAKALVLRAHTDEESASEVLQDLYAAHPDNEQIEQALSDTS
                **************************************************

C1              FGIVTTTAARIDARTDPWDPETEPGVEDFIDPAAHERKAVLLHEAERQLA
C2              FGIVTTTAARIDARTDPWDPETEPGVEDFIDPAAHERKAVLLHEAERQLA
C3              FGIVTTTAARIDARTDPWDPETEPGVEDFIDPAAHERKAVLLHEAERQLA
C4              FGIVTTTAARIDARTDPWDPETEPGVEDFIDPAAHERKAVLLHEAERQLA
C5              FGIVTTTAARIDARTDPWDPETEPGVEDFIDPAAHERKAVLLHEAERQLA
C6              FGIVTTTAARIDARTDPWDPETEPGVEDFIDPAAHERKAVLLHEAERQLA
                **************************************************

C1              EFIGLDEVKNQVSRLKSSVAMELVRKQRGLMVAQRAHHLVFAGPPGTGKT
C2              EFIGLDEVKNQVSRLKSSVAMELVRKQRGLMVAQRAHHLVFAGPPGTGKT
C3              EFIGLDEVKNQVSRLKSSVAMELVRKQRGLMVAQRAHHLVFAGPPGTGKT
C4              EFIGLDEVKNQVSRLKSSVAMELVRKQRGLMVAQRAHHLVFAGPPGTGKT
C5              EFIGLDEVKNQVSRLKSSVAMELVRKQRGLMVAQRAHHLVFAGPPGTGKT
C6              EFIGLDEVKNQVSRLKSSVAMELVRKQRGLMVAQRAHHLVFAGPPGTGKT
                **************************************************

C1              TIARVVAKVYCGLGLLKKENIREVHRADLIGQHIGETEAKTNAVIDSALD
C2              TIARVVAKVYCGLGLLKKENIREVHRADLIGQHIGETEAKTNAVIDSALD
C3              TIARVVAKVYCGLGLLKKENIREVHRADLIGQHIGETEAKTNAVIDSALD
C4              TIARVVAKVYCGLGLLKKENIREVHRADLIGQHIGETEAKTNAVIDSALD
C5              TIARVVAKVYCGLGLLKKENIREVHRADLIGQHIGETEAKTNAVIDSALD
C6              TIARVVAKVYCGLGLLKKENIREVHRADLIGQHIGETEAKTNAVIDSALD
                **************************************************

C1              GVLFLDEAYALVATGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRADL
C2              GVLFLDEAYALVATGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRADL
C3              GVLFLDEAYALVATGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRADL
C4              GVLFLDEAYALVATGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRADL
C5              GVLFLDEAYALVATGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRADL
C6              GVLFLDEAYALVATGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRADL
                **************************************************

C1              DKFLDTNEGLRSRFTRNIDFPSYASHELVEIAHKMAEQRDSVFEQAALDE
C2              DKFLDTNEGLRSRFTRNIDFPSYASHELVEIAHKMAEQRDSVFEQAALDE
C3              DKFLDTNEGLRSRFTRNIDFPSYASHELVEIAHKMAEQRDSVFEQAALDE
C4              DKFLDTNEGLRSRFTRNIDFPSYASHELVEIAHKMAEQRDSVFEQAALDE
C5              DKFLDTNEGLRSRFTRNIDFPSYASHELVEIAHKMAEQRDSVFEQAALDE
C6              DKFLDTNEGLRSRFTRNIDFPSYASHELVEIAHKMAEQRDSVFEQAALDE
                **************************************************

C1              LEVLFANLATSSTPDSNGISRRSLDIAGNGRFVRNIVERSEEEREFRLDH
C2              LEVLFANLATSSTPDSNGISRRSLDIAGNGRFVRNIVERSEEEREFRLDH
C3              LEVLFANLATSSTPDSNGISRRSLDIAGNGRFVRNIVERSEEEREFRLDH
C4              LEVLFANLATSSTPDSNGISRRSLDIAGNGRFVRNIVERSEEEREFRLDH
C5              LEVLFANLATSSTPDSNGISRRSLDIAGNGRFVRNIVERSEEEREFRLDH
C6              LEVLFANLATSSTLDSNGISRRSLDIAGNGRFVRNIVERSEEEREFRLDH
                ************* ************************************

C1              SNNVGTGELSDEELMTVTSEDVRRSVEPLLRGLGLMVPHD
C2              SNNVGTGELSDEELMTVTSEDVRRSVEPLLRGLGLMVPHD
C3              SNNVGTGELSDEELMTVTSEDVRRSVEPLLRGLGLMVPHD
C4              SNNVGTGELSDEELMTVTSEDVRRSVEPLLRGLGLMVPHD
C5              SNNVGTGELSDEELMTVTSEDVRRSVEPLLRGLGLMVPHD
C6              SNNVGTGELSDEELMTVTSEDVRRSVEPLLRGLGLMVPHD
                ****************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  640 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  640 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19200]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [19200]--->[19200]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.597 Mb, Max= 31.265 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MLISGRSGWAILGTGGKAAVNRGDAGKLGGQSVIARAHVKVDGDVVSRFA
C2              MLISGRSGWAILGTGGKAAVNRGDAGKLGGQSVIARAHVKVDGDVVSRFA
C3              MLISGRSGWAILGTGGKAAVNRGDAGKLGGQSVIARAHVKVDGDVVSRFA
C4              MLISGRSGWAILGTGGKAAVNRGDAGKLGGQSVIARAHVKVDGDVVSRFA
C5              MLISGRSGWAILGTGGKAAVNRGDAGKLGGQSVIARAHVKVDGDVVSRFA
C6              MLISGRSGWAILGTGGKAAVNRGDAGKLGGQSVIARAHVKVDGDVVSRFA
                **************************************************

C1              TCCRALGLAVYDRQRPADLAAARSGFTALARIAHDQCDVWIGLAAAGDVS
C2              TCCRALGLAVYDRQRPADLAAARSGFTALARIAHDQCDVWIGLAAAGDVS
C3              TCCRALGLAVYDRQRPADLAAARSGFTALARIAHDQCDVWIGLAAAGDVS
C4              TCCRALGLAVYDRQRPADLAAARSGFTALARIAHDQCDVWIGLAAAGDVS
C5              TCCRALGLAVYDRQRPADLAAARSGFTALARIAHDQCDVWIGLAAAGDVS
C6              TCCRALGLAVYDRQRPADLAAARSGFTALARIAHDQCDVWIGLAAAGDVS
                **************************************************

C1              TPVLAAISCTADTAGMLQRQVELAPAALGFHYDTGLYLQFRAIGPDDFHL
C2              TPVLAAISCTADTAGMLQRQVELAPAALGFHYDTGLYLQFRAIGPDDFHL
C3              TPVLAAISCTADTAGMLQRQVELAPAALGFHYDTGLYLQFRAIGPDDFHL
C4              TPVLAAISCTADTAGMLQRQVELAPAALGFHYDTGLYLQFRAIGPDDFHL
C5              TPVLAAISCTADTAGMLQRQVELAPAALGFHYDTGLYLQFRAIGPDDFHL
C6              TPVLAAISCTADTAGMLQRQVELAPAALGFHYDTGLYLQFRAIGPDDFHL
                **************************************************

C1              AYAASLASTGGPGPYAEADQIVTGIIDRRPGWRDARWVAAVIHYRAGRWS
C2              AYAASLASTGGPGPYAEADQIVTGIIDRRPGWRDARWVAAVIHYRAGRWS
C3              AYAASLASTGGPGPYAEADQIVTGIIDRRPGWRDARWVAAVIHYRAGRWS
C4              AYAASLASTGGPGPYAEADQIVTGIIDRRPGWRDARWVAAVIHYRAGRWS
C5              AYAASLASTGGPGPYAEADQIVTGIIDRRPGWRDARWVAAVIHYRAGRWS
C6              AYAASLASTGGPGPYAEADQIVTGIIDRRPGWRDARWVAAVIHYRAGRWS
                **************************************************

C1              DVVKLLTPIVNDPDIDEAYTHAAKIALGTALARLGMFAPALSYLEEPAGP
C2              DVVKLLTPIVNDPDIDEAYTHAAKIALGTALARLGMFAPALSYLEEPAGP
C3              DVVKLLTPIVNDPDIDEAYTHAAKIALGTALARLGMFAPALSYLEEPAGP
C4              DVVKLLTPIVNDPDIDEAYTHAAKIALGTALARLGMFAPALSYLEEPAGP
C5              DVVKLLTPIVNDPDIDEAYTHAAKIALGTALARLGMFAPALSYLEEPAGP
C6              DVVKLLTPIVNDPDIDEAYTHAAKIALGTALARLGMFAPALSYLEEPAGP
                **************************************************

C1              VAVAAVDGALAKALVLRAHTDEESASEVLQDLYAAHPDNEQIEQALSDTS
C2              VAVAAVDGALAKALVLRAHTDEESASEVLQDLYAAHPDNEQIEQALSDTS
C3              VAVAAVDGALAKALVLRAHTDEESASEVLQDLYAAHPDNEQIEQALSDTS
C4              VAVAAVDGALAKALVLRAHTDEESASEVLQDLYAAHPDNEQIEQALSDTS
C5              VAVAAVDGALAKALVLRAHTDEESASEVLQDLYAAHPDNEQIEQALSDTS
C6              VAVAAVDGALAKALVLRAHTDEESASEVLQDLYAAHPDNEQIEQALSDTS
                **************************************************

C1              FGIVTTTAARIDARTDPWDPETEPGVEDFIDPAAHERKAVLLHEAERQLA
C2              FGIVTTTAARIDARTDPWDPETEPGVEDFIDPAAHERKAVLLHEAERQLA
C3              FGIVTTTAARIDARTDPWDPETEPGVEDFIDPAAHERKAVLLHEAERQLA
C4              FGIVTTTAARIDARTDPWDPETEPGVEDFIDPAAHERKAVLLHEAERQLA
C5              FGIVTTTAARIDARTDPWDPETEPGVEDFIDPAAHERKAVLLHEAERQLA
C6              FGIVTTTAARIDARTDPWDPETEPGVEDFIDPAAHERKAVLLHEAERQLA
                **************************************************

C1              EFIGLDEVKNQVSRLKSSVAMELVRKQRGLMVAQRAHHLVFAGPPGTGKT
C2              EFIGLDEVKNQVSRLKSSVAMELVRKQRGLMVAQRAHHLVFAGPPGTGKT
C3              EFIGLDEVKNQVSRLKSSVAMELVRKQRGLMVAQRAHHLVFAGPPGTGKT
C4              EFIGLDEVKNQVSRLKSSVAMELVRKQRGLMVAQRAHHLVFAGPPGTGKT
C5              EFIGLDEVKNQVSRLKSSVAMELVRKQRGLMVAQRAHHLVFAGPPGTGKT
C6              EFIGLDEVKNQVSRLKSSVAMELVRKQRGLMVAQRAHHLVFAGPPGTGKT
                **************************************************

C1              TIARVVAKVYCGLGLLKKENIREVHRADLIGQHIGETEAKTNAVIDSALD
C2              TIARVVAKVYCGLGLLKKENIREVHRADLIGQHIGETEAKTNAVIDSALD
C3              TIARVVAKVYCGLGLLKKENIREVHRADLIGQHIGETEAKTNAVIDSALD
C4              TIARVVAKVYCGLGLLKKENIREVHRADLIGQHIGETEAKTNAVIDSALD
C5              TIARVVAKVYCGLGLLKKENIREVHRADLIGQHIGETEAKTNAVIDSALD
C6              TIARVVAKVYCGLGLLKKENIREVHRADLIGQHIGETEAKTNAVIDSALD
                **************************************************

C1              GVLFLDEAYALVATGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRADL
C2              GVLFLDEAYALVATGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRADL
C3              GVLFLDEAYALVATGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRADL
C4              GVLFLDEAYALVATGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRADL
C5              GVLFLDEAYALVATGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRADL
C6              GVLFLDEAYALVATGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRADL
                **************************************************

C1              DKFLDTNEGLRSRFTRNIDFPSYASHELVEIAHKMAEQRDSVFEQAALDE
C2              DKFLDTNEGLRSRFTRNIDFPSYASHELVEIAHKMAEQRDSVFEQAALDE
C3              DKFLDTNEGLRSRFTRNIDFPSYASHELVEIAHKMAEQRDSVFEQAALDE
C4              DKFLDTNEGLRSRFTRNIDFPSYASHELVEIAHKMAEQRDSVFEQAALDE
C5              DKFLDTNEGLRSRFTRNIDFPSYASHELVEIAHKMAEQRDSVFEQAALDE
C6              DKFLDTNEGLRSRFTRNIDFPSYASHELVEIAHKMAEQRDSVFEQAALDE
                **************************************************

C1              LEVLFANLATSSTPDSNGISRRSLDIAGNGRFVRNIVERSEEEREFRLDH
C2              LEVLFANLATSSTPDSNGISRRSLDIAGNGRFVRNIVERSEEEREFRLDH
C3              LEVLFANLATSSTPDSNGISRRSLDIAGNGRFVRNIVERSEEEREFRLDH
C4              LEVLFANLATSSTPDSNGISRRSLDIAGNGRFVRNIVERSEEEREFRLDH
C5              LEVLFANLATSSTPDSNGISRRSLDIAGNGRFVRNIVERSEEEREFRLDH
C6              LEVLFANLATSSTLDSNGISRRSLDIAGNGRFVRNIVERSEEEREFRLDH
                ************* ************************************

C1              SNNVGTGELSDEELMTVTSEDVRRSVEPLLRGLGLMVPHD
C2              SNNVGTGELSDEELMTVTSEDVRRSVEPLLRGLGLMVPHD
C3              SNNVGTGELSDEELMTVTSEDVRRSVEPLLRGLGLMVPHD
C4              SNNVGTGELSDEELMTVTSEDVRRSVEPLLRGLGLMVPHD
C5              SNNVGTGELSDEELMTVTSEDVRRSVEPLLRGLGLMVPHD
C6              SNNVGTGELSDEELMTVTSEDVRRSVEPLLRGLGLMVPHD
                ****************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 99.84 C1	 C6	 99.84
TOP	    5    0	 99.84 C6	 C1	 99.84
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 99.84 C2	 C6	 99.84
TOP	    5    1	 99.84 C6	 C2	 99.84
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 99.84 C3	 C6	 99.84
TOP	    5    2	 99.84 C6	 C3	 99.84
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 99.84 C4	 C6	 99.84
TOP	    5    3	 99.84 C6	 C4	 99.84
BOT	    4    5	 99.84 C5	 C6	 99.84
TOP	    5    4	 99.84 C6	 C5	 99.84
AVG	 0	 C1	  *	 99.97
AVG	 1	 C2	  *	 99.97
AVG	 2	 C3	  *	 99.97
AVG	 3	 C4	  *	 99.97
AVG	 4	 C5	  *	 99.97
AVG	 5	 C6	  *	 99.84
TOT	 TOT	  *	 99.95
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGCTAATTTCAGGCAGGTCAGGTTGGGCGATACTAGGTACGGGAGGCAA
C2              ATGCTAATTTCAGGCAGGTCAGGTTGGGCGATACTAGGTACGGGAGGCAA
C3              ATGCTAATTTCAGGCAGGTCAGGTTGGGCGATACTAGGTACGGGAGGCAA
C4              ATGCTAATTTCAGGCAGGTCAGGTTGGGCGATACTAGGTACGGGAGGCAA
C5              ATGCTAATTTCAGGCAGGTCAGGTTGGGCGATACTAGGTACGGGAGGCAA
C6              ATGCTAATTTCAGGCAGGTCAGGTTGGGCGATACTAGGTACGGGAGGCAA
                **************************************************

C1              AGCGGCCGTGAACCGCGGTGACGCCGGCAAGCTTGGCGGGCAGTCTGTCA
C2              AGCGGCCGTGAACCGCGGTGACGCCGGCAAGCTTGGCGGGCAGTCTGTCA
C3              AGCGGCCGTGAACCGCGGTGACGCCGGCAAGCTTGGCGGGCAGTCTGTCA
C4              AGCGGCCGTGAACCGCGGTGACGCCGGCAAGCTTGGCGGGCAGTCTGTCA
C5              AGCGGCCGTGAACCGCGGTGACGCCGGCAAGCTTGGCGGGCAGTCTGTCA
C6              AGCGGCCGTGAACCGCGGTGACGCCGGCAAGCTTGGCGGGCAGTCTGTCA
                **************************************************

C1              TTGCTCGGGCGCACGTTAAGGTTGATGGCGACGTTGTTAGCCGATTCGCT
C2              TTGCTCGGGCGCACGTTAAGGTTGATGGCGACGTTGTTAGCCGATTCGCT
C3              TTGCTCGGGCGCACGTTAAGGTTGATGGCGACGTTGTTAGCCGATTCGCT
C4              TTGCTCGGGCGCACGTTAAGGTTGATGGCGACGTTGTTAGCCGATTCGCT
C5              TTGCTCGGGCGCACGTTAAGGTTGATGGCGACGTTGTTAGCCGATTCGCT
C6              TTGCTCGGGCGCACGTTAAGGTTGATGGCGACGTTGTTAGCCGATTCGCT
                **************************************************

C1              ACCTGTTGTCGCGCCCTCGGCCTTGCGGTCTACGACCGTCAACGTCCGGC
C2              ACCTGTTGTCGCGCCCTCGGCCTTGCGGTCTACGACCGTCAACGTCCGGC
C3              ACCTGTTGTCGCGCCCTCGGCCTTGCGGTCTACGACCGTCAACGTCCGGC
C4              ACCTGTTGTCGCGCCCTCGGCCTTGCGGTCTACGACCGTCAACGTCCGGC
C5              ACCTGTTGTCGCGCCCTCGGCCTTGCGGTCTACGACCGTCAACGTCCGGC
C6              ACCTGTTGTCGCGCCCTCGGCCTTGCGGTCTACGACCGTCAACGTCCGGC
                **************************************************

C1              CGACCTGGCCGCCGCTCGGTCGGGTTTCACCGCACTTGCCCGCATCGCGC
C2              CGACCTGGCCGCCGCTCGGTCGGGTTTCACCGCACTTGCCCGCATCGCGC
C3              CGACCTGGCCGCCGCTCGGTCGGGTTTCACCGCACTTGCCCGCATCGCGC
C4              CGACCTGGCCGCCGCTCGGTCGGGTTTCACCGCACTTGCCCGCATCGCGC
C5              CGACCTGGCCGCCGCTCGGTCGGGTTTCACCGCACTTGCCCGCATCGCGC
C6              CGACCTGGCCGCCGCTCGGTCGGGTTTCACCGCACTTGCCCGCATCGCGC
                **************************************************

C1              ATGATCAGTGTGATGTCTGGATCGGGTTAGCCGCTGCTGGTGACGTGTCC
C2              ATGATCAGTGTGATGTCTGGATCGGGTTAGCCGCTGCTGGTGACGTGTCC
C3              ATGATCAGTGTGATGTCTGGATCGGGTTAGCCGCTGCTGGTGACGTGTCC
C4              ATGATCAGTGTGATGTCTGGATCGGGTTAGCCGCTGCTGGTGACGTGTCC
C5              ATGATCAGTGTGATGTCTGGATCGGGTTAGCCGCTGCTGGTGACGTGTCC
C6              ATGATCAGTGTGATGTCTGGATCGGGTTAGCCGCTGCTGGTGACGTGTCC
                **************************************************

C1              ACCCCTGTACTGGCAGCGATTTCGTGTACCGCTGACACCGCGGGCATGCT
C2              ACCCCTGTACTGGCAGCGATTTCGTGTACCGCTGACACCGCGGGCATGCT
C3              ACCCCTGTACTGGCAGCGATTTCGTGTACCGCTGACACCGCGGGCATGCT
C4              ACCCCTGTACTGGCAGCGATTTCGTGTACCGCTGACACCGCGGGCATGCT
C5              ACCCCTGTACTGGCAGCGATTTCGTGTACCGCTGACACCGCGGGCATGCT
C6              ACCCCTGTACTGGCAGCGATTTCGTGTACCGCTGACACCGCGGGCATGCT
                **************************************************

C1              GCAACGTCAGGTGGAACTGGCCCCCGCCGCGTTGGGCTTTCACTACGACA
C2              GCAACGTCAGGTGGAACTGGCCCCCGCCGCGTTGGGCTTTCACTACGACA
C3              GCAACGTCAGGTGGAACTGGCCCCCGCCGCGTTGGGCTTTCACTACGACA
C4              GCAACGTCAGGTGGAACTGGCCCCCGCCGCGTTGGGCTTTCACTACGACA
C5              GCAACGTCAGGTGGAACTGGCCCCCGCCGCGTTGGGCTTTCACTACGACA
C6              GCAACGTCAGGTGGAACTGGCCCCCGCCGCGTTGGGCTTTCACTACGACA
                **************************************************

C1              CCGGACTGTACCTGCAGTTTCGAGCCATCGGTCCGGATGATTTCCATCTC
C2              CCGGACTGTACCTGCAGTTTCGAGCCATCGGTCCGGATGATTTCCATCTC
C3              CCGGACTGTACCTGCAGTTTCGAGCCATCGGTCCGGATGATTTCCATCTC
C4              CCGGACTGTACCTGCAGTTTCGAGCCATCGGTCCGGATGATTTCCATCTC
C5              CCGGACTGTACCTGCAGTTTCGAGCCATCGGTCCGGATGATTTCCATCTC
C6              CCGGACTGTACCTGCAGTTTCGAGCCATCGGTCCGGATGATTTCCATCTC
                **************************************************

C1              GCCTATGCGGCGTCACTAGCGTCAACCGGGGGGCCCGGACCCTATGCCGA
C2              GCCTATGCGGCGTCACTAGCGTCAACCGGGGGGCCCGGACCCTATGCCGA
C3              GCCTATGCGGCGTCACTAGCGTCAACCGGGGGGCCCGGACCCTATGCCGA
C4              GCCTATGCGGCGTCACTAGCGTCAACCGGGGGGCCCGGACCCTATGCCGA
C5              GCCTATGCGGCGTCACTAGCGTCAACCGGGGGGCCCGGACCCTATGCCGA
C6              GCCTATGCGGCGTCACTAGCGTCAACCGGGGGGCCCGGACCCTATGCCGA
                **************************************************

C1              GGCCGATCAGATAGTCACCGGTATCATCGACCGCCGGCCAGGTTGGCGGG
C2              GGCCGATCAGATAGTCACCGGTATCATCGACCGCCGGCCAGGTTGGCGGG
C3              GGCCGATCAGATAGTCACCGGTATCATCGACCGCCGGCCAGGTTGGCGGG
C4              GGCCGATCAGATAGTCACCGGTATCATCGACCGCCGGCCAGGTTGGCGGG
C5              GGCCGATCAGATAGTCACCGGTATCATCGACCGCCGGCCAGGTTGGCGGG
C6              GGCCGATCAGATAGTCACCGGTATCATCGACCGCCGGCCAGGTTGGCGGG
                **************************************************

C1              ATGCCCGTTGGGTCGCTGCCGTCATCCACTACCGCGCCGGGCGCTGGTCG
C2              ATGCCCGTTGGGTCGCTGCCGTCATCCACTACCGCGCCGGGCGCTGGTCG
C3              ATGCCCGTTGGGTCGCTGCCGTCATCCACTACCGCGCCGGGCGCTGGTCG
C4              ATGCCCGTTGGGTCGCTGCCGTCATCCACTACCGCGCCGGGCGCTGGTCG
C5              ATGCCCGTTGGGTCGCTGCCGTCATCCACTACCGCGCCGGGCGCTGGTCG
C6              ATGCCCGTTGGGTCGCTGCCGTCATCCACTACCGCGCCGGGCGCTGGTCG
                **************************************************

C1              GATGTCGTCAAGCTGTTGACTCCGATCGTGAATGACCCTGATATCGACGA
C2              GATGTCGTCAAGCTGTTGACTCCGATCGTGAATGACCCTGATATCGACGA
C3              GATGTCGTCAAGCTGTTGACTCCGATCGTGAATGACCCTGATATCGACGA
C4              GATGTCGTCAAGCTGTTGACTCCGATCGTGAATGACCCTGATATCGACGA
C5              GATGTCGTCAAGCTGTTGACTCCGATCGTGAATGACCCTGATATCGACGA
C6              GATGTCGTCAAGCTGTTGACTCCGATCGTGAATGACCCTGATATCGACGA
                **************************************************

C1              GGCTTACACGCACGCCGCCAAGATTGCATTGGGTACCGCGCTGGCCCGGC
C2              GGCTTACACGCACGCCGCCAAGATTGCATTGGGTACCGCGCTGGCCCGGC
C3              GGCTTACACGCACGCCGCCAAGATTGCATTGGGTACCGCGCTGGCCCGGC
C4              GGCTTACACGCACGCCGCCAAGATTGCATTGGGTACCGCGCTGGCCCGGC
C5              GGCTTACACGCACGCCGCCAAGATTGCATTGGGTACCGCGCTGGCCCGGC
C6              GGCTTACACGCACGCCGCCAAGATTGCATTGGGTACCGCGCTGGCCCGGC
                **************************************************

C1              TGGGTATGTTCGCCCCGGCATTGTCGTATCTGGAGGAGCCAGCGGGCCCG
C2              TGGGTATGTTCGCCCCGGCATTGTCGTATCTGGAGGAGCCAGCGGGCCCG
C3              TGGGTATGTTCGCCCCGGCATTGTCGTATCTGGAGGAGCCAGCGGGCCCG
C4              TGGGTATGTTCGCCCCGGCATTGTCGTATCTGGAGGAGCCAGCGGGCCCG
C5              TGGGTATGTTCGCCCCGGCATTGTCGTATCTGGAGGAGCCAGCGGGCCCG
C6              TGGGTATGTTCGCCCCGGCATTGTCGTATCTGGAGGAGCCAGCGGGCCCG
                **************************************************

C1              GTCGCGGTGGCGGCTGTCGATGGCGCGTTAGCCAAAGCGCTGGTGCTACG
C2              GTCGCGGTGGCGGCTGTCGATGGCGCGTTAGCCAAAGCGCTGGTGCTACG
C3              GTCGCGGTGGCGGCTGTCGATGGCGCGTTAGCCAAAGCGCTGGTGCTACG
C4              GTCGCGGTGGCGGCTGTCGATGGCGCGTTAGCCAAAGCGCTGGTGCTACG
C5              GTCGCGGTGGCGGCTGTCGATGGCGCGTTAGCCAAAGCGCTGGTGCTACG
C6              GTCGCGGTGGCGGCTGTCGATGGCGCGTTAGCCAAAGCGCTGGTGCTACG
                **************************************************

C1              TGCGCACACGGACGAGGAGTCGGCCAGCGAAGTTCTGCAAGATTTGTACG
C2              TGCGCACACGGACGAGGAGTCGGCCAGCGAAGTTCTGCAAGATTTGTACG
C3              TGCGCACACGGACGAGGAGTCGGCCAGCGAAGTTCTGCAAGATTTGTACG
C4              TGCGCACACGGACGAGGAGTCGGCCAGCGAAGTTCTGCAAGATTTGTACG
C5              TGCGCACACGGACGAGGAGTCGGCCAGCGAAGTTCTGCAAGATTTGTACG
C6              TGCGCACACGGACGAGGAGTCGGCCAGCGAAGTTCTGCAAGATTTGTACG
                **************************************************

C1              CGGCACATCCGGACAACGAGCAAATTGAGCAGGCCCTGTCCGACACTAGT
C2              CGGCACATCCGGACAACGAGCAAATTGAGCAGGCCCTGTCCGACACTAGT
C3              CGGCACATCCGGACAACGAGCAAATTGAGCAGGCCCTGTCCGACACTAGT
C4              CGGCACATCCGGACAACGAGCAAATTGAGCAGGCCCTGTCCGACACTAGT
C5              CGGCACATCCGGACAACGAGCAAATTGAGCAGGCCCTGTCCGACACTAGT
C6              CGGCACATCCGGACAACGAGCAAATTGAGCAGGCCCTGTCCGACACTAGT
                **************************************************

C1              TTTGGGATCGTTACCACTACCGCGGCCCGGATCGATGCTCGCACCGATCC
C2              TTTGGGATCGTTACCACTACCGCGGCCCGGATCGATGCTCGCACCGATCC
C3              TTTGGGATCGTTACCACTACCGCGGCCCGGATCGATGCTCGCACCGATCC
C4              TTTGGGATCGTTACCACTACCGCGGCCCGGATCGATGCTCGCACCGATCC
C5              TTTGGGATCGTTACCACTACCGCGGCCCGGATCGATGCTCGCACCGATCC
C6              TTTGGGATCGTTACCACTACCGCGGCCCGGATCGATGCTCGCACCGATCC
                **************************************************

C1              ATGGGATCCCGAGACCGAACCTGGTGTGGAAGATTTCATCGACCCCGCAG
C2              ATGGGATCCCGAGACCGAACCTGGTGTGGAAGATTTCATCGACCCCGCAG
C3              ATGGGATCCCGAGACCGAACCTGGTGTGGAAGATTTCATCGACCCCGCAG
C4              ATGGGATCCCGAGACCGAACCTGGTGTGGAAGATTTCATCGACCCCGCAG
C5              ATGGGATCCCGAGACCGAACCTGGTGTGGAAGATTTCATCGACCCCGCAG
C6              ATGGGATCCCGAGACCGAACCTGGTGTGGAAGATTTCATCGACCCCGCAG
                **************************************************

C1              CCCACGAACGCAAAGCCGTGCTGCTTCATGAGGCCGAGCGCCAGCTCGCC
C2              CCCACGAACGCAAAGCCGTGCTGCTTCATGAGGCCGAGCGCCAGCTCGCC
C3              CCCACGAACGCAAAGCCGTGCTGCTTCATGAGGCCGAGCGCCAGCTCGCC
C4              CCCACGAACGCAAAGCCGTGCTGCTTCATGAGGCCGAGCGCCAGCTCGCC
C5              CCCACGAACGCAAAGCCGTGCTGCTTCATGAGGCCGAGCGCCAGCTCGCC
C6              CCCACGAACGCAAAGCCGTGCTGCTTCATGAGGCCGAGCGCCAGCTCGCC
                **************************************************

C1              GAATTCATCGGCCTGGATGAGGTCAAAAACCAGGTGTCACGGCTGAAGAG
C2              GAATTCATCGGCCTGGATGAGGTCAAAAACCAGGTGTCACGGCTGAAGAG
C3              GAATTCATCGGCCTGGATGAGGTCAAAAACCAGGTGTCACGGCTGAAGAG
C4              GAATTCATCGGCCTGGATGAGGTCAAAAACCAGGTGTCACGGCTGAAGAG
C5              GAATTCATCGGCCTGGATGAGGTCAAAAACCAGGTGTCACGGCTGAAGAG
C6              GAATTCATCGGCCTGGATGAGGTCAAAAACCAGGTGTCACGGCTGAAGAG
                **************************************************

C1              TTCGGTGGCTATGGAGCTAGTGCGTAAGCAGCGTGGGCTCATGGTAGCGC
C2              TTCGGTGGCTATGGAGCTAGTGCGTAAGCAGCGTGGGCTCATGGTAGCGC
C3              TTCGGTGGCTATGGAGCTAGTGCGTAAGCAGCGTGGGCTCATGGTAGCGC
C4              TTCGGTGGCTATGGAGCTAGTGCGTAAGCAGCGTGGGCTCATGGTAGCGC
C5              TTCGGTGGCTATGGAGCTAGTGCGTAAGCAGCGTGGGCTCATGGTAGCGC
C6              TTCGGTGGCTATGGAGCTAGTGCGTAAGCAGCGTGGGCTCATGGTAGCGC
                **************************************************

C1              AACGTGCCCACCACCTCGTCTTTGCTGGCCCACCTGGGACAGGCAAGACC
C2              AACGTGCCCACCACCTCGTCTTTGCTGGCCCACCTGGGACAGGCAAGACC
C3              AACGTGCCCACCACCTCGTCTTTGCTGGCCCACCTGGGACAGGCAAGACC
C4              AACGTGCCCACCACCTCGTCTTTGCTGGCCCACCTGGGACAGGCAAGACC
C5              AACGTGCCCACCACCTCGTCTTTGCTGGCCCACCTGGGACAGGCAAGACC
C6              AACGTGCCCACCACCTCGTCTTTGCTGGCCCACCTGGGACAGGCAAGACC
                **************************************************

C1              ACAATCGCCCGTGTGGTCGCCAAAGTTTATTGTGGCCTAGGCCTTTTGAA
C2              ACAATCGCCCGTGTGGTCGCCAAAGTTTATTGTGGCCTAGGCCTTTTGAA
C3              ACAATCGCCCGTGTGGTCGCCAAAGTTTATTGTGGCCTAGGCCTTTTGAA
C4              ACAATCGCCCGTGTGGTCGCCAAAGTTTATTGTGGCCTAGGCCTTTTGAA
C5              ACAATCGCCCGTGTGGTCGCCAAAGTTTATTGTGGCCTAGGCCTTTTGAA
C6              ACAATCGCCCGTGTGGTCGCCAAAGTTTATTGTGGCCTAGGCCTTTTGAA
                **************************************************

C1              GAAAGAGAATATCCGAGAAGTGCATCGCGCCGACCTTATCGGCCAGCACA
C2              GAAAGAGAATATCCGAGAAGTGCATCGCGCCGACCTTATCGGCCAGCACA
C3              GAAAGAGAATATCCGAGAAGTGCATCGCGCCGACCTTATCGGCCAGCACA
C4              GAAAGAGAATATCCGAGAAGTGCATCGCGCCGACCTTATCGGCCAGCACA
C5              GAAAGAGAATATCCGAGAAGTGCATCGCGCCGACCTTATCGGCCAGCACA
C6              GAAAGAGAATATCCGAGAAGTGCATCGCGCCGACCTTATCGGCCAGCACA
                **************************************************

C1              TCGGTGAGACCGAGGCCAAAACCAACGCGGTCATCGACAGTGCACTAGAC
C2              TCGGTGAGACCGAGGCCAAAACCAACGCGGTCATCGACAGTGCACTAGAC
C3              TCGGTGAGACCGAGGCCAAAACCAACGCGGTCATCGACAGTGCACTAGAC
C4              TCGGTGAGACCGAGGCCAAAACCAACGCGGTCATCGACAGTGCACTAGAC
C5              TCGGTGAGACCGAGGCCAAAACCAACGCGGTCATCGACAGTGCACTAGAC
C6              TCGGTGAGACCGAGGCCAAAACCAACGCGGTCATCGACAGTGCACTAGAC
                **************************************************

C1              GGAGTGTTGTTTCTTGACGAAGCCTACGCCCTAGTGGCTACGGGCGCTAA
C2              GGAGTGTTGTTTCTTGACGAAGCCTACGCCCTAGTGGCTACGGGCGCTAA
C3              GGAGTGTTGTTTCTTGACGAAGCCTACGCCCTAGTGGCTACGGGCGCTAA
C4              GGAGTGTTGTTTCTTGACGAAGCCTACGCCCTAGTGGCTACGGGCGCTAA
C5              GGAGTGTTGTTTCTTGACGAAGCCTACGCCCTAGTGGCTACGGGCGCTAA
C6              GGAGTGTTGTTTCTTGACGAAGCCTACGCCCTAGTGGCTACGGGCGCTAA
                **************************************************

C1              AAACGACTTCGGTTTGGTGGCCATCGACACTTTGCTGGCACGGATGGAGA
C2              AAACGACTTCGGTTTGGTGGCCATCGACACTTTGCTGGCACGGATGGAGA
C3              AAACGACTTCGGTTTGGTGGCCATCGACACTTTGCTGGCACGGATGGAGA
C4              AAACGACTTCGGTTTGGTGGCCATCGACACTTTGCTGGCACGGATGGAGA
C5              AAACGACTTCGGTTTGGTGGCCATCGACACTTTGCTGGCACGGATGGAGA
C6              AAACGACTTCGGTTTGGTGGCCATCGACACTTTGCTGGCACGGATGGAGA
                **************************************************

C1              ACGATCGTGACCGGCTAGTCGTGATCATCGCCGGCTACCGCGCCGATCTG
C2              ACGATCGTGACCGGCTAGTCGTGATCATCGCCGGCTACCGCGCCGATCTG
C3              ACGATCGTGACCGGCTAGTCGTGATCATCGCCGGCTACCGCGCCGATCTG
C4              ACGATCGTGACCGGCTAGTCGTGATCATCGCCGGCTACCGCGCCGATCTG
C5              ACGATCGTGACCGGCTAGTCGTGATCATCGCCGGCTACCGCGCCGATCTG
C6              ACGATCGTGACCGGCTAGTCGTGATCATCGCCGGCTACCGCGCCGATCTG
                **************************************************

C1              GATAAGTTCCTGGACACTAACGAAGGCTTGCGGTCGCGGTTCACCCGTAA
C2              GATAAGTTCCTGGACACTAACGAAGGCTTGCGGTCGCGGTTCACCCGTAA
C3              GATAAGTTCCTGGACACTAACGAAGGCTTGCGGTCGCGGTTCACCCGTAA
C4              GATAAGTTCCTGGACACTAACGAAGGCTTGCGGTCGCGGTTCACCCGTAA
C5              GATAAGTTCCTGGACACTAACGAAGGCTTGCGGTCGCGGTTCACCCGTAA
C6              GATAAGTTCCTGGACACTAACGAAGGCTTGCGGTCGCGGTTCACCCGTAA
                **************************************************

C1              TATCGATTTTCCTTCATACGCATCGCATGAGTTGGTCGAGATCGCGCACA
C2              TATCGATTTTCCTTCATACGCATCGCATGAGTTGGTCGAGATCGCGCACA
C3              TATCGATTTTCCTTCATACGCATCGCATGAGTTGGTCGAGATCGCGCACA
C4              TATCGATTTTCCTTCATACGCATCGCATGAGTTGGTCGAGATCGCGCACA
C5              TATCGATTTTCCTTCATACGCATCGCATGAGTTGGTCGAGATCGCGCACA
C6              TATCGATTTTCCTTCATACGCATCGCATGAGTTGGTCGAGATCGCGCACA
                **************************************************

C1              AGATGGCCGAACAGCGAGACAGCGTCTTCGAGCAGGCTGCGCTCGACGAG
C2              AGATGGCCGAACAGCGAGACAGCGTCTTCGAGCAGGCTGCGCTCGACGAG
C3              AGATGGCCGAACAGCGAGACAGCGTCTTCGAGCAGGCTGCGCTCGACGAG
C4              AGATGGCCGAACAGCGAGACAGCGTCTTCGAGCAGGCTGCGCTCGACGAG
C5              AGATGGCCGAACAGCGAGACAGCGTCTTCGAGCAGGCTGCGCTCGACGAG
C6              AGATGGCCGAACAGCGAGACAGCGTCTTCGAGCAGGCTGCGCTCGACGAG
                **************************************************

C1              TTGGAGGTTCTGTTCGCTAATTTGGCGACATCGTCTACCCCTGACTCCAA
C2              TTGGAGGTTCTGTTCGCTAATTTGGCGACATCGTCTACCCCTGACTCCAA
C3              TTGGAGGTTCTGTTCGCTAATTTGGCGACATCGTCTACCCCTGACTCCAA
C4              TTGGAGGTTCTGTTCGCTAATTTGGCGACATCGTCTACCCCTGACTCCAA
C5              TTGGAGGTTCTGTTCGCTAATTTGGCGACATCGTCTACCCCTGACTCCAA
C6              TTGGAGGTTCTGTTCGCTAATTTGGCGACATCGTCTACCCTTGACTCCAA
                **************************************** *********

C1              TGGAATCTCTCGGCGCAGCCTCGACATCGCGGGCAACGGGCGGTTTGTCC
C2              TGGAATCTCTCGGCGCAGCCTCGACATCGCGGGCAACGGGCGGTTTGTCC
C3              TGGAATCTCTCGGCGCAGCCTCGACATCGCGGGCAACGGGCGGTTTGTCC
C4              TGGAATCTCTCGGCGCAGCCTCGACATCGCGGGCAACGGGCGGTTTGTCC
C5              TGGAATCTCTCGGCGCAGCCTCGACATCGCGGGCAACGGGCGGTTTGTCC
C6              TGGAATCTCTCGGCGCAGCCTCGACATCGCGGGCAACGGGCGGTTTGTCC
                **************************************************

C1              GCAACATCGTTGAACGTTCAGAAGAAGAACGTGAATTCCGGTTGGACCAT
C2              GCAACATCGTTGAACGTTCAGAAGAAGAACGTGAATTCCGGTTGGACCAT
C3              GCAACATCGTTGAACGTTCAGAAGAAGAACGTGAATTCCGGTTGGACCAT
C4              GCAACATCGTTGAACGTTCAGAAGAAGAACGTGAATTCCGGTTGGACCAT
C5              GCAACATCGTTGAACGTTCAGAAGAAGAACGTGAATTCCGGTTGGACCAT
C6              GCAACATCGTTGAACGTTCAGAAGAAGAACGTGAATTCCGGTTGGACCAT
                **************************************************

C1              TCGAACAATGTCGGTACTGGTGAGTTAAGTGACGAGGAACTCATGACCGT
C2              TCGAACAATGTCGGTACTGGTGAGTTAAGTGACGAGGAACTCATGACCGT
C3              TCGAACAATGTCGGTACTGGTGAGTTAAGTGACGAGGAACTCATGACCGT
C4              TCGAACAATGTCGGTACTGGTGAGTTAAGTGACGAGGAACTCATGACCGT
C5              TCGAACAATGTCGGTACTGGTGAGTTAAGTGACGAGGAACTCATGACCGT
C6              TCGAACAATGTCGGTACTGGTGAGTTAAGTGACGAGGAACTCATGACCGT
                **************************************************

C1              AACGTCCGAGGATGTACGGAGATCGGTAGAGCCGTTGCTGCGCGGTCTCG
C2              AACGTCCGAGGATGTACGGAGATCGGTAGAGCCGTTGCTGCGCGGTCTCG
C3              AACGTCCGAGGATGTACGGAGATCGGTAGAGCCGTTGCTGCGCGGTCTCG
C4              AACGTCCGAGGATGTACGGAGATCGGTAGAGCCGTTGCTGCGCGGTCTCG
C5              AACGTCCGAGGATGTACGGAGATCGGTAGAGCCGTTGCTGCGCGGTCTCG
C6              AACGTCCGAGGATGTACGGAGATCGGTAGAGCCGTTGCTGCGCGGTCTCG
                **************************************************

C1              GACTTATGGTACCGCATGAC
C2              GACTTATGGTACCGCATGAC
C3              GACTTATGGTACCGCATGAC
C4              GACTTATGGTACCGCATGAC
C5              GACTTATGGTACCGCATGAC
C6              GACTTATGGTACCGCATGAC
                ********************



>C1
ATGCTAATTTCAGGCAGGTCAGGTTGGGCGATACTAGGTACGGGAGGCAA
AGCGGCCGTGAACCGCGGTGACGCCGGCAAGCTTGGCGGGCAGTCTGTCA
TTGCTCGGGCGCACGTTAAGGTTGATGGCGACGTTGTTAGCCGATTCGCT
ACCTGTTGTCGCGCCCTCGGCCTTGCGGTCTACGACCGTCAACGTCCGGC
CGACCTGGCCGCCGCTCGGTCGGGTTTCACCGCACTTGCCCGCATCGCGC
ATGATCAGTGTGATGTCTGGATCGGGTTAGCCGCTGCTGGTGACGTGTCC
ACCCCTGTACTGGCAGCGATTTCGTGTACCGCTGACACCGCGGGCATGCT
GCAACGTCAGGTGGAACTGGCCCCCGCCGCGTTGGGCTTTCACTACGACA
CCGGACTGTACCTGCAGTTTCGAGCCATCGGTCCGGATGATTTCCATCTC
GCCTATGCGGCGTCACTAGCGTCAACCGGGGGGCCCGGACCCTATGCCGA
GGCCGATCAGATAGTCACCGGTATCATCGACCGCCGGCCAGGTTGGCGGG
ATGCCCGTTGGGTCGCTGCCGTCATCCACTACCGCGCCGGGCGCTGGTCG
GATGTCGTCAAGCTGTTGACTCCGATCGTGAATGACCCTGATATCGACGA
GGCTTACACGCACGCCGCCAAGATTGCATTGGGTACCGCGCTGGCCCGGC
TGGGTATGTTCGCCCCGGCATTGTCGTATCTGGAGGAGCCAGCGGGCCCG
GTCGCGGTGGCGGCTGTCGATGGCGCGTTAGCCAAAGCGCTGGTGCTACG
TGCGCACACGGACGAGGAGTCGGCCAGCGAAGTTCTGCAAGATTTGTACG
CGGCACATCCGGACAACGAGCAAATTGAGCAGGCCCTGTCCGACACTAGT
TTTGGGATCGTTACCACTACCGCGGCCCGGATCGATGCTCGCACCGATCC
ATGGGATCCCGAGACCGAACCTGGTGTGGAAGATTTCATCGACCCCGCAG
CCCACGAACGCAAAGCCGTGCTGCTTCATGAGGCCGAGCGCCAGCTCGCC
GAATTCATCGGCCTGGATGAGGTCAAAAACCAGGTGTCACGGCTGAAGAG
TTCGGTGGCTATGGAGCTAGTGCGTAAGCAGCGTGGGCTCATGGTAGCGC
AACGTGCCCACCACCTCGTCTTTGCTGGCCCACCTGGGACAGGCAAGACC
ACAATCGCCCGTGTGGTCGCCAAAGTTTATTGTGGCCTAGGCCTTTTGAA
GAAAGAGAATATCCGAGAAGTGCATCGCGCCGACCTTATCGGCCAGCACA
TCGGTGAGACCGAGGCCAAAACCAACGCGGTCATCGACAGTGCACTAGAC
GGAGTGTTGTTTCTTGACGAAGCCTACGCCCTAGTGGCTACGGGCGCTAA
AAACGACTTCGGTTTGGTGGCCATCGACACTTTGCTGGCACGGATGGAGA
ACGATCGTGACCGGCTAGTCGTGATCATCGCCGGCTACCGCGCCGATCTG
GATAAGTTCCTGGACACTAACGAAGGCTTGCGGTCGCGGTTCACCCGTAA
TATCGATTTTCCTTCATACGCATCGCATGAGTTGGTCGAGATCGCGCACA
AGATGGCCGAACAGCGAGACAGCGTCTTCGAGCAGGCTGCGCTCGACGAG
TTGGAGGTTCTGTTCGCTAATTTGGCGACATCGTCTACCCCTGACTCCAA
TGGAATCTCTCGGCGCAGCCTCGACATCGCGGGCAACGGGCGGTTTGTCC
GCAACATCGTTGAACGTTCAGAAGAAGAACGTGAATTCCGGTTGGACCAT
TCGAACAATGTCGGTACTGGTGAGTTAAGTGACGAGGAACTCATGACCGT
AACGTCCGAGGATGTACGGAGATCGGTAGAGCCGTTGCTGCGCGGTCTCG
GACTTATGGTACCGCATGAC
>C2
ATGCTAATTTCAGGCAGGTCAGGTTGGGCGATACTAGGTACGGGAGGCAA
AGCGGCCGTGAACCGCGGTGACGCCGGCAAGCTTGGCGGGCAGTCTGTCA
TTGCTCGGGCGCACGTTAAGGTTGATGGCGACGTTGTTAGCCGATTCGCT
ACCTGTTGTCGCGCCCTCGGCCTTGCGGTCTACGACCGTCAACGTCCGGC
CGACCTGGCCGCCGCTCGGTCGGGTTTCACCGCACTTGCCCGCATCGCGC
ATGATCAGTGTGATGTCTGGATCGGGTTAGCCGCTGCTGGTGACGTGTCC
ACCCCTGTACTGGCAGCGATTTCGTGTACCGCTGACACCGCGGGCATGCT
GCAACGTCAGGTGGAACTGGCCCCCGCCGCGTTGGGCTTTCACTACGACA
CCGGACTGTACCTGCAGTTTCGAGCCATCGGTCCGGATGATTTCCATCTC
GCCTATGCGGCGTCACTAGCGTCAACCGGGGGGCCCGGACCCTATGCCGA
GGCCGATCAGATAGTCACCGGTATCATCGACCGCCGGCCAGGTTGGCGGG
ATGCCCGTTGGGTCGCTGCCGTCATCCACTACCGCGCCGGGCGCTGGTCG
GATGTCGTCAAGCTGTTGACTCCGATCGTGAATGACCCTGATATCGACGA
GGCTTACACGCACGCCGCCAAGATTGCATTGGGTACCGCGCTGGCCCGGC
TGGGTATGTTCGCCCCGGCATTGTCGTATCTGGAGGAGCCAGCGGGCCCG
GTCGCGGTGGCGGCTGTCGATGGCGCGTTAGCCAAAGCGCTGGTGCTACG
TGCGCACACGGACGAGGAGTCGGCCAGCGAAGTTCTGCAAGATTTGTACG
CGGCACATCCGGACAACGAGCAAATTGAGCAGGCCCTGTCCGACACTAGT
TTTGGGATCGTTACCACTACCGCGGCCCGGATCGATGCTCGCACCGATCC
ATGGGATCCCGAGACCGAACCTGGTGTGGAAGATTTCATCGACCCCGCAG
CCCACGAACGCAAAGCCGTGCTGCTTCATGAGGCCGAGCGCCAGCTCGCC
GAATTCATCGGCCTGGATGAGGTCAAAAACCAGGTGTCACGGCTGAAGAG
TTCGGTGGCTATGGAGCTAGTGCGTAAGCAGCGTGGGCTCATGGTAGCGC
AACGTGCCCACCACCTCGTCTTTGCTGGCCCACCTGGGACAGGCAAGACC
ACAATCGCCCGTGTGGTCGCCAAAGTTTATTGTGGCCTAGGCCTTTTGAA
GAAAGAGAATATCCGAGAAGTGCATCGCGCCGACCTTATCGGCCAGCACA
TCGGTGAGACCGAGGCCAAAACCAACGCGGTCATCGACAGTGCACTAGAC
GGAGTGTTGTTTCTTGACGAAGCCTACGCCCTAGTGGCTACGGGCGCTAA
AAACGACTTCGGTTTGGTGGCCATCGACACTTTGCTGGCACGGATGGAGA
ACGATCGTGACCGGCTAGTCGTGATCATCGCCGGCTACCGCGCCGATCTG
GATAAGTTCCTGGACACTAACGAAGGCTTGCGGTCGCGGTTCACCCGTAA
TATCGATTTTCCTTCATACGCATCGCATGAGTTGGTCGAGATCGCGCACA
AGATGGCCGAACAGCGAGACAGCGTCTTCGAGCAGGCTGCGCTCGACGAG
TTGGAGGTTCTGTTCGCTAATTTGGCGACATCGTCTACCCCTGACTCCAA
TGGAATCTCTCGGCGCAGCCTCGACATCGCGGGCAACGGGCGGTTTGTCC
GCAACATCGTTGAACGTTCAGAAGAAGAACGTGAATTCCGGTTGGACCAT
TCGAACAATGTCGGTACTGGTGAGTTAAGTGACGAGGAACTCATGACCGT
AACGTCCGAGGATGTACGGAGATCGGTAGAGCCGTTGCTGCGCGGTCTCG
GACTTATGGTACCGCATGAC
>C3
ATGCTAATTTCAGGCAGGTCAGGTTGGGCGATACTAGGTACGGGAGGCAA
AGCGGCCGTGAACCGCGGTGACGCCGGCAAGCTTGGCGGGCAGTCTGTCA
TTGCTCGGGCGCACGTTAAGGTTGATGGCGACGTTGTTAGCCGATTCGCT
ACCTGTTGTCGCGCCCTCGGCCTTGCGGTCTACGACCGTCAACGTCCGGC
CGACCTGGCCGCCGCTCGGTCGGGTTTCACCGCACTTGCCCGCATCGCGC
ATGATCAGTGTGATGTCTGGATCGGGTTAGCCGCTGCTGGTGACGTGTCC
ACCCCTGTACTGGCAGCGATTTCGTGTACCGCTGACACCGCGGGCATGCT
GCAACGTCAGGTGGAACTGGCCCCCGCCGCGTTGGGCTTTCACTACGACA
CCGGACTGTACCTGCAGTTTCGAGCCATCGGTCCGGATGATTTCCATCTC
GCCTATGCGGCGTCACTAGCGTCAACCGGGGGGCCCGGACCCTATGCCGA
GGCCGATCAGATAGTCACCGGTATCATCGACCGCCGGCCAGGTTGGCGGG
ATGCCCGTTGGGTCGCTGCCGTCATCCACTACCGCGCCGGGCGCTGGTCG
GATGTCGTCAAGCTGTTGACTCCGATCGTGAATGACCCTGATATCGACGA
GGCTTACACGCACGCCGCCAAGATTGCATTGGGTACCGCGCTGGCCCGGC
TGGGTATGTTCGCCCCGGCATTGTCGTATCTGGAGGAGCCAGCGGGCCCG
GTCGCGGTGGCGGCTGTCGATGGCGCGTTAGCCAAAGCGCTGGTGCTACG
TGCGCACACGGACGAGGAGTCGGCCAGCGAAGTTCTGCAAGATTTGTACG
CGGCACATCCGGACAACGAGCAAATTGAGCAGGCCCTGTCCGACACTAGT
TTTGGGATCGTTACCACTACCGCGGCCCGGATCGATGCTCGCACCGATCC
ATGGGATCCCGAGACCGAACCTGGTGTGGAAGATTTCATCGACCCCGCAG
CCCACGAACGCAAAGCCGTGCTGCTTCATGAGGCCGAGCGCCAGCTCGCC
GAATTCATCGGCCTGGATGAGGTCAAAAACCAGGTGTCACGGCTGAAGAG
TTCGGTGGCTATGGAGCTAGTGCGTAAGCAGCGTGGGCTCATGGTAGCGC
AACGTGCCCACCACCTCGTCTTTGCTGGCCCACCTGGGACAGGCAAGACC
ACAATCGCCCGTGTGGTCGCCAAAGTTTATTGTGGCCTAGGCCTTTTGAA
GAAAGAGAATATCCGAGAAGTGCATCGCGCCGACCTTATCGGCCAGCACA
TCGGTGAGACCGAGGCCAAAACCAACGCGGTCATCGACAGTGCACTAGAC
GGAGTGTTGTTTCTTGACGAAGCCTACGCCCTAGTGGCTACGGGCGCTAA
AAACGACTTCGGTTTGGTGGCCATCGACACTTTGCTGGCACGGATGGAGA
ACGATCGTGACCGGCTAGTCGTGATCATCGCCGGCTACCGCGCCGATCTG
GATAAGTTCCTGGACACTAACGAAGGCTTGCGGTCGCGGTTCACCCGTAA
TATCGATTTTCCTTCATACGCATCGCATGAGTTGGTCGAGATCGCGCACA
AGATGGCCGAACAGCGAGACAGCGTCTTCGAGCAGGCTGCGCTCGACGAG
TTGGAGGTTCTGTTCGCTAATTTGGCGACATCGTCTACCCCTGACTCCAA
TGGAATCTCTCGGCGCAGCCTCGACATCGCGGGCAACGGGCGGTTTGTCC
GCAACATCGTTGAACGTTCAGAAGAAGAACGTGAATTCCGGTTGGACCAT
TCGAACAATGTCGGTACTGGTGAGTTAAGTGACGAGGAACTCATGACCGT
AACGTCCGAGGATGTACGGAGATCGGTAGAGCCGTTGCTGCGCGGTCTCG
GACTTATGGTACCGCATGAC
>C4
ATGCTAATTTCAGGCAGGTCAGGTTGGGCGATACTAGGTACGGGAGGCAA
AGCGGCCGTGAACCGCGGTGACGCCGGCAAGCTTGGCGGGCAGTCTGTCA
TTGCTCGGGCGCACGTTAAGGTTGATGGCGACGTTGTTAGCCGATTCGCT
ACCTGTTGTCGCGCCCTCGGCCTTGCGGTCTACGACCGTCAACGTCCGGC
CGACCTGGCCGCCGCTCGGTCGGGTTTCACCGCACTTGCCCGCATCGCGC
ATGATCAGTGTGATGTCTGGATCGGGTTAGCCGCTGCTGGTGACGTGTCC
ACCCCTGTACTGGCAGCGATTTCGTGTACCGCTGACACCGCGGGCATGCT
GCAACGTCAGGTGGAACTGGCCCCCGCCGCGTTGGGCTTTCACTACGACA
CCGGACTGTACCTGCAGTTTCGAGCCATCGGTCCGGATGATTTCCATCTC
GCCTATGCGGCGTCACTAGCGTCAACCGGGGGGCCCGGACCCTATGCCGA
GGCCGATCAGATAGTCACCGGTATCATCGACCGCCGGCCAGGTTGGCGGG
ATGCCCGTTGGGTCGCTGCCGTCATCCACTACCGCGCCGGGCGCTGGTCG
GATGTCGTCAAGCTGTTGACTCCGATCGTGAATGACCCTGATATCGACGA
GGCTTACACGCACGCCGCCAAGATTGCATTGGGTACCGCGCTGGCCCGGC
TGGGTATGTTCGCCCCGGCATTGTCGTATCTGGAGGAGCCAGCGGGCCCG
GTCGCGGTGGCGGCTGTCGATGGCGCGTTAGCCAAAGCGCTGGTGCTACG
TGCGCACACGGACGAGGAGTCGGCCAGCGAAGTTCTGCAAGATTTGTACG
CGGCACATCCGGACAACGAGCAAATTGAGCAGGCCCTGTCCGACACTAGT
TTTGGGATCGTTACCACTACCGCGGCCCGGATCGATGCTCGCACCGATCC
ATGGGATCCCGAGACCGAACCTGGTGTGGAAGATTTCATCGACCCCGCAG
CCCACGAACGCAAAGCCGTGCTGCTTCATGAGGCCGAGCGCCAGCTCGCC
GAATTCATCGGCCTGGATGAGGTCAAAAACCAGGTGTCACGGCTGAAGAG
TTCGGTGGCTATGGAGCTAGTGCGTAAGCAGCGTGGGCTCATGGTAGCGC
AACGTGCCCACCACCTCGTCTTTGCTGGCCCACCTGGGACAGGCAAGACC
ACAATCGCCCGTGTGGTCGCCAAAGTTTATTGTGGCCTAGGCCTTTTGAA
GAAAGAGAATATCCGAGAAGTGCATCGCGCCGACCTTATCGGCCAGCACA
TCGGTGAGACCGAGGCCAAAACCAACGCGGTCATCGACAGTGCACTAGAC
GGAGTGTTGTTTCTTGACGAAGCCTACGCCCTAGTGGCTACGGGCGCTAA
AAACGACTTCGGTTTGGTGGCCATCGACACTTTGCTGGCACGGATGGAGA
ACGATCGTGACCGGCTAGTCGTGATCATCGCCGGCTACCGCGCCGATCTG
GATAAGTTCCTGGACACTAACGAAGGCTTGCGGTCGCGGTTCACCCGTAA
TATCGATTTTCCTTCATACGCATCGCATGAGTTGGTCGAGATCGCGCACA
AGATGGCCGAACAGCGAGACAGCGTCTTCGAGCAGGCTGCGCTCGACGAG
TTGGAGGTTCTGTTCGCTAATTTGGCGACATCGTCTACCCCTGACTCCAA
TGGAATCTCTCGGCGCAGCCTCGACATCGCGGGCAACGGGCGGTTTGTCC
GCAACATCGTTGAACGTTCAGAAGAAGAACGTGAATTCCGGTTGGACCAT
TCGAACAATGTCGGTACTGGTGAGTTAAGTGACGAGGAACTCATGACCGT
AACGTCCGAGGATGTACGGAGATCGGTAGAGCCGTTGCTGCGCGGTCTCG
GACTTATGGTACCGCATGAC
>C5
ATGCTAATTTCAGGCAGGTCAGGTTGGGCGATACTAGGTACGGGAGGCAA
AGCGGCCGTGAACCGCGGTGACGCCGGCAAGCTTGGCGGGCAGTCTGTCA
TTGCTCGGGCGCACGTTAAGGTTGATGGCGACGTTGTTAGCCGATTCGCT
ACCTGTTGTCGCGCCCTCGGCCTTGCGGTCTACGACCGTCAACGTCCGGC
CGACCTGGCCGCCGCTCGGTCGGGTTTCACCGCACTTGCCCGCATCGCGC
ATGATCAGTGTGATGTCTGGATCGGGTTAGCCGCTGCTGGTGACGTGTCC
ACCCCTGTACTGGCAGCGATTTCGTGTACCGCTGACACCGCGGGCATGCT
GCAACGTCAGGTGGAACTGGCCCCCGCCGCGTTGGGCTTTCACTACGACA
CCGGACTGTACCTGCAGTTTCGAGCCATCGGTCCGGATGATTTCCATCTC
GCCTATGCGGCGTCACTAGCGTCAACCGGGGGGCCCGGACCCTATGCCGA
GGCCGATCAGATAGTCACCGGTATCATCGACCGCCGGCCAGGTTGGCGGG
ATGCCCGTTGGGTCGCTGCCGTCATCCACTACCGCGCCGGGCGCTGGTCG
GATGTCGTCAAGCTGTTGACTCCGATCGTGAATGACCCTGATATCGACGA
GGCTTACACGCACGCCGCCAAGATTGCATTGGGTACCGCGCTGGCCCGGC
TGGGTATGTTCGCCCCGGCATTGTCGTATCTGGAGGAGCCAGCGGGCCCG
GTCGCGGTGGCGGCTGTCGATGGCGCGTTAGCCAAAGCGCTGGTGCTACG
TGCGCACACGGACGAGGAGTCGGCCAGCGAAGTTCTGCAAGATTTGTACG
CGGCACATCCGGACAACGAGCAAATTGAGCAGGCCCTGTCCGACACTAGT
TTTGGGATCGTTACCACTACCGCGGCCCGGATCGATGCTCGCACCGATCC
ATGGGATCCCGAGACCGAACCTGGTGTGGAAGATTTCATCGACCCCGCAG
CCCACGAACGCAAAGCCGTGCTGCTTCATGAGGCCGAGCGCCAGCTCGCC
GAATTCATCGGCCTGGATGAGGTCAAAAACCAGGTGTCACGGCTGAAGAG
TTCGGTGGCTATGGAGCTAGTGCGTAAGCAGCGTGGGCTCATGGTAGCGC
AACGTGCCCACCACCTCGTCTTTGCTGGCCCACCTGGGACAGGCAAGACC
ACAATCGCCCGTGTGGTCGCCAAAGTTTATTGTGGCCTAGGCCTTTTGAA
GAAAGAGAATATCCGAGAAGTGCATCGCGCCGACCTTATCGGCCAGCACA
TCGGTGAGACCGAGGCCAAAACCAACGCGGTCATCGACAGTGCACTAGAC
GGAGTGTTGTTTCTTGACGAAGCCTACGCCCTAGTGGCTACGGGCGCTAA
AAACGACTTCGGTTTGGTGGCCATCGACACTTTGCTGGCACGGATGGAGA
ACGATCGTGACCGGCTAGTCGTGATCATCGCCGGCTACCGCGCCGATCTG
GATAAGTTCCTGGACACTAACGAAGGCTTGCGGTCGCGGTTCACCCGTAA
TATCGATTTTCCTTCATACGCATCGCATGAGTTGGTCGAGATCGCGCACA
AGATGGCCGAACAGCGAGACAGCGTCTTCGAGCAGGCTGCGCTCGACGAG
TTGGAGGTTCTGTTCGCTAATTTGGCGACATCGTCTACCCCTGACTCCAA
TGGAATCTCTCGGCGCAGCCTCGACATCGCGGGCAACGGGCGGTTTGTCC
GCAACATCGTTGAACGTTCAGAAGAAGAACGTGAATTCCGGTTGGACCAT
TCGAACAATGTCGGTACTGGTGAGTTAAGTGACGAGGAACTCATGACCGT
AACGTCCGAGGATGTACGGAGATCGGTAGAGCCGTTGCTGCGCGGTCTCG
GACTTATGGTACCGCATGAC
>C6
ATGCTAATTTCAGGCAGGTCAGGTTGGGCGATACTAGGTACGGGAGGCAA
AGCGGCCGTGAACCGCGGTGACGCCGGCAAGCTTGGCGGGCAGTCTGTCA
TTGCTCGGGCGCACGTTAAGGTTGATGGCGACGTTGTTAGCCGATTCGCT
ACCTGTTGTCGCGCCCTCGGCCTTGCGGTCTACGACCGTCAACGTCCGGC
CGACCTGGCCGCCGCTCGGTCGGGTTTCACCGCACTTGCCCGCATCGCGC
ATGATCAGTGTGATGTCTGGATCGGGTTAGCCGCTGCTGGTGACGTGTCC
ACCCCTGTACTGGCAGCGATTTCGTGTACCGCTGACACCGCGGGCATGCT
GCAACGTCAGGTGGAACTGGCCCCCGCCGCGTTGGGCTTTCACTACGACA
CCGGACTGTACCTGCAGTTTCGAGCCATCGGTCCGGATGATTTCCATCTC
GCCTATGCGGCGTCACTAGCGTCAACCGGGGGGCCCGGACCCTATGCCGA
GGCCGATCAGATAGTCACCGGTATCATCGACCGCCGGCCAGGTTGGCGGG
ATGCCCGTTGGGTCGCTGCCGTCATCCACTACCGCGCCGGGCGCTGGTCG
GATGTCGTCAAGCTGTTGACTCCGATCGTGAATGACCCTGATATCGACGA
GGCTTACACGCACGCCGCCAAGATTGCATTGGGTACCGCGCTGGCCCGGC
TGGGTATGTTCGCCCCGGCATTGTCGTATCTGGAGGAGCCAGCGGGCCCG
GTCGCGGTGGCGGCTGTCGATGGCGCGTTAGCCAAAGCGCTGGTGCTACG
TGCGCACACGGACGAGGAGTCGGCCAGCGAAGTTCTGCAAGATTTGTACG
CGGCACATCCGGACAACGAGCAAATTGAGCAGGCCCTGTCCGACACTAGT
TTTGGGATCGTTACCACTACCGCGGCCCGGATCGATGCTCGCACCGATCC
ATGGGATCCCGAGACCGAACCTGGTGTGGAAGATTTCATCGACCCCGCAG
CCCACGAACGCAAAGCCGTGCTGCTTCATGAGGCCGAGCGCCAGCTCGCC
GAATTCATCGGCCTGGATGAGGTCAAAAACCAGGTGTCACGGCTGAAGAG
TTCGGTGGCTATGGAGCTAGTGCGTAAGCAGCGTGGGCTCATGGTAGCGC
AACGTGCCCACCACCTCGTCTTTGCTGGCCCACCTGGGACAGGCAAGACC
ACAATCGCCCGTGTGGTCGCCAAAGTTTATTGTGGCCTAGGCCTTTTGAA
GAAAGAGAATATCCGAGAAGTGCATCGCGCCGACCTTATCGGCCAGCACA
TCGGTGAGACCGAGGCCAAAACCAACGCGGTCATCGACAGTGCACTAGAC
GGAGTGTTGTTTCTTGACGAAGCCTACGCCCTAGTGGCTACGGGCGCTAA
AAACGACTTCGGTTTGGTGGCCATCGACACTTTGCTGGCACGGATGGAGA
ACGATCGTGACCGGCTAGTCGTGATCATCGCCGGCTACCGCGCCGATCTG
GATAAGTTCCTGGACACTAACGAAGGCTTGCGGTCGCGGTTCACCCGTAA
TATCGATTTTCCTTCATACGCATCGCATGAGTTGGTCGAGATCGCGCACA
AGATGGCCGAACAGCGAGACAGCGTCTTCGAGCAGGCTGCGCTCGACGAG
TTGGAGGTTCTGTTCGCTAATTTGGCGACATCGTCTACCCTTGACTCCAA
TGGAATCTCTCGGCGCAGCCTCGACATCGCGGGCAACGGGCGGTTTGTCC
GCAACATCGTTGAACGTTCAGAAGAAGAACGTGAATTCCGGTTGGACCAT
TCGAACAATGTCGGTACTGGTGAGTTAAGTGACGAGGAACTCATGACCGT
AACGTCCGAGGATGTACGGAGATCGGTAGAGCCGTTGCTGCGCGGTCTCG
GACTTATGGTACCGCATGAC
>C1
MLISGRSGWAILGTGGKAAVNRGDAGKLGGQSVIARAHVKVDGDVVSRFA
TCCRALGLAVYDRQRPADLAAARSGFTALARIAHDQCDVWIGLAAAGDVS
TPVLAAISCTADTAGMLQRQVELAPAALGFHYDTGLYLQFRAIGPDDFHL
AYAASLASTGGPGPYAEADQIVTGIIDRRPGWRDARWVAAVIHYRAGRWS
DVVKLLTPIVNDPDIDEAYTHAAKIALGTALARLGMFAPALSYLEEPAGP
VAVAAVDGALAKALVLRAHTDEESASEVLQDLYAAHPDNEQIEQALSDTS
FGIVTTTAARIDARTDPWDPETEPGVEDFIDPAAHERKAVLLHEAERQLA
EFIGLDEVKNQVSRLKSSVAMELVRKQRGLMVAQRAHHLVFAGPPGTGKT
TIARVVAKVYCGLGLLKKENIREVHRADLIGQHIGETEAKTNAVIDSALD
GVLFLDEAYALVATGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRADL
DKFLDTNEGLRSRFTRNIDFPSYASHELVEIAHKMAEQRDSVFEQAALDE
LEVLFANLATSSTPDSNGISRRSLDIAGNGRFVRNIVERSEEEREFRLDH
SNNVGTGELSDEELMTVTSEDVRRSVEPLLRGLGLMVPHD
>C2
MLISGRSGWAILGTGGKAAVNRGDAGKLGGQSVIARAHVKVDGDVVSRFA
TCCRALGLAVYDRQRPADLAAARSGFTALARIAHDQCDVWIGLAAAGDVS
TPVLAAISCTADTAGMLQRQVELAPAALGFHYDTGLYLQFRAIGPDDFHL
AYAASLASTGGPGPYAEADQIVTGIIDRRPGWRDARWVAAVIHYRAGRWS
DVVKLLTPIVNDPDIDEAYTHAAKIALGTALARLGMFAPALSYLEEPAGP
VAVAAVDGALAKALVLRAHTDEESASEVLQDLYAAHPDNEQIEQALSDTS
FGIVTTTAARIDARTDPWDPETEPGVEDFIDPAAHERKAVLLHEAERQLA
EFIGLDEVKNQVSRLKSSVAMELVRKQRGLMVAQRAHHLVFAGPPGTGKT
TIARVVAKVYCGLGLLKKENIREVHRADLIGQHIGETEAKTNAVIDSALD
GVLFLDEAYALVATGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRADL
DKFLDTNEGLRSRFTRNIDFPSYASHELVEIAHKMAEQRDSVFEQAALDE
LEVLFANLATSSTPDSNGISRRSLDIAGNGRFVRNIVERSEEEREFRLDH
SNNVGTGELSDEELMTVTSEDVRRSVEPLLRGLGLMVPHD
>C3
MLISGRSGWAILGTGGKAAVNRGDAGKLGGQSVIARAHVKVDGDVVSRFA
TCCRALGLAVYDRQRPADLAAARSGFTALARIAHDQCDVWIGLAAAGDVS
TPVLAAISCTADTAGMLQRQVELAPAALGFHYDTGLYLQFRAIGPDDFHL
AYAASLASTGGPGPYAEADQIVTGIIDRRPGWRDARWVAAVIHYRAGRWS
DVVKLLTPIVNDPDIDEAYTHAAKIALGTALARLGMFAPALSYLEEPAGP
VAVAAVDGALAKALVLRAHTDEESASEVLQDLYAAHPDNEQIEQALSDTS
FGIVTTTAARIDARTDPWDPETEPGVEDFIDPAAHERKAVLLHEAERQLA
EFIGLDEVKNQVSRLKSSVAMELVRKQRGLMVAQRAHHLVFAGPPGTGKT
TIARVVAKVYCGLGLLKKENIREVHRADLIGQHIGETEAKTNAVIDSALD
GVLFLDEAYALVATGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRADL
DKFLDTNEGLRSRFTRNIDFPSYASHELVEIAHKMAEQRDSVFEQAALDE
LEVLFANLATSSTPDSNGISRRSLDIAGNGRFVRNIVERSEEEREFRLDH
SNNVGTGELSDEELMTVTSEDVRRSVEPLLRGLGLMVPHD
>C4
MLISGRSGWAILGTGGKAAVNRGDAGKLGGQSVIARAHVKVDGDVVSRFA
TCCRALGLAVYDRQRPADLAAARSGFTALARIAHDQCDVWIGLAAAGDVS
TPVLAAISCTADTAGMLQRQVELAPAALGFHYDTGLYLQFRAIGPDDFHL
AYAASLASTGGPGPYAEADQIVTGIIDRRPGWRDARWVAAVIHYRAGRWS
DVVKLLTPIVNDPDIDEAYTHAAKIALGTALARLGMFAPALSYLEEPAGP
VAVAAVDGALAKALVLRAHTDEESASEVLQDLYAAHPDNEQIEQALSDTS
FGIVTTTAARIDARTDPWDPETEPGVEDFIDPAAHERKAVLLHEAERQLA
EFIGLDEVKNQVSRLKSSVAMELVRKQRGLMVAQRAHHLVFAGPPGTGKT
TIARVVAKVYCGLGLLKKENIREVHRADLIGQHIGETEAKTNAVIDSALD
GVLFLDEAYALVATGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRADL
DKFLDTNEGLRSRFTRNIDFPSYASHELVEIAHKMAEQRDSVFEQAALDE
LEVLFANLATSSTPDSNGISRRSLDIAGNGRFVRNIVERSEEEREFRLDH
SNNVGTGELSDEELMTVTSEDVRRSVEPLLRGLGLMVPHD
>C5
MLISGRSGWAILGTGGKAAVNRGDAGKLGGQSVIARAHVKVDGDVVSRFA
TCCRALGLAVYDRQRPADLAAARSGFTALARIAHDQCDVWIGLAAAGDVS
TPVLAAISCTADTAGMLQRQVELAPAALGFHYDTGLYLQFRAIGPDDFHL
AYAASLASTGGPGPYAEADQIVTGIIDRRPGWRDARWVAAVIHYRAGRWS
DVVKLLTPIVNDPDIDEAYTHAAKIALGTALARLGMFAPALSYLEEPAGP
VAVAAVDGALAKALVLRAHTDEESASEVLQDLYAAHPDNEQIEQALSDTS
FGIVTTTAARIDARTDPWDPETEPGVEDFIDPAAHERKAVLLHEAERQLA
EFIGLDEVKNQVSRLKSSVAMELVRKQRGLMVAQRAHHLVFAGPPGTGKT
TIARVVAKVYCGLGLLKKENIREVHRADLIGQHIGETEAKTNAVIDSALD
GVLFLDEAYALVATGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRADL
DKFLDTNEGLRSRFTRNIDFPSYASHELVEIAHKMAEQRDSVFEQAALDE
LEVLFANLATSSTPDSNGISRRSLDIAGNGRFVRNIVERSEEEREFRLDH
SNNVGTGELSDEELMTVTSEDVRRSVEPLLRGLGLMVPHD
>C6
MLISGRSGWAILGTGGKAAVNRGDAGKLGGQSVIARAHVKVDGDVVSRFA
TCCRALGLAVYDRQRPADLAAARSGFTALARIAHDQCDVWIGLAAAGDVS
TPVLAAISCTADTAGMLQRQVELAPAALGFHYDTGLYLQFRAIGPDDFHL
AYAASLASTGGPGPYAEADQIVTGIIDRRPGWRDARWVAAVIHYRAGRWS
DVVKLLTPIVNDPDIDEAYTHAAKIALGTALARLGMFAPALSYLEEPAGP
VAVAAVDGALAKALVLRAHTDEESASEVLQDLYAAHPDNEQIEQALSDTS
FGIVTTTAARIDARTDPWDPETEPGVEDFIDPAAHERKAVLLHEAERQLA
EFIGLDEVKNQVSRLKSSVAMELVRKQRGLMVAQRAHHLVFAGPPGTGKT
TIARVVAKVYCGLGLLKKENIREVHRADLIGQHIGETEAKTNAVIDSALD
GVLFLDEAYALVATGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRADL
DKFLDTNEGLRSRFTRNIDFPSYASHELVEIAHKMAEQRDSVFEQAALDE
LEVLFANLATSSTLDSNGISRRSLDIAGNGRFVRNIVERSEEEREFRLDH
SNNVGTGELSDEELMTVTSEDVRRSVEPLLRGLGLMVPHD


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/9res/ML2537/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1920 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579858105
      Setting output file names to "/data/9res/ML2537/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 823645346
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5742112143
      Seed = 903007302
      Swapseed = 1579858105
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 5 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -4300.454906 -- -24.965149
         Chain 2 -- -4300.453357 -- -24.965149
         Chain 3 -- -4300.454186 -- -24.965149
         Chain 4 -- -4300.454659 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -4300.454659 -- -24.965149
         Chain 2 -- -4300.453357 -- -24.965149
         Chain 3 -- -4300.453109 -- -24.965149
         Chain 4 -- -4300.454186 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-4300.455] (-4300.453) (-4300.454) (-4300.455) * [-4300.455] (-4300.453) (-4300.453) (-4300.454) 
        500 -- (-2651.108) (-2666.351) [-2659.330] (-2681.727) * [-2647.468] (-2669.398) (-2649.421) (-2644.753) -- 0:00:00
       1000 -- [-2641.911] (-2651.490) (-2649.254) (-2653.428) * (-2644.218) (-2650.817) [-2648.834] (-2654.064) -- 0:00:00
       1500 -- (-2644.001) (-2645.792) [-2644.715] (-2654.704) * [-2642.657] (-2652.569) (-2638.635) (-2639.724) -- 0:00:00
       2000 -- [-2642.982] (-2647.025) (-2646.725) (-2645.800) * (-2643.634) (-2640.423) [-2639.587] (-2647.773) -- 0:00:00
       2500 -- [-2644.786] (-2654.555) (-2652.208) (-2644.947) * (-2640.933) (-2651.133) [-2645.183] (-2648.095) -- 0:00:00
       3000 -- (-2645.587) [-2641.789] (-2641.215) (-2647.454) * [-2643.537] (-2642.051) (-2652.321) (-2647.745) -- 0:00:00
       3500 -- [-2643.548] (-2645.078) (-2645.034) (-2643.052) * (-2643.023) [-2645.756] (-2645.595) (-2647.519) -- 0:00:00
       4000 -- (-2646.386) (-2648.361) [-2642.355] (-2649.237) * (-2644.256) (-2652.416) (-2645.389) [-2643.588] -- 0:00:00
       4500 -- [-2642.405] (-2644.735) (-2646.007) (-2642.557) * (-2640.475) (-2644.382) (-2657.512) [-2649.937] -- 0:00:00
       5000 -- (-2639.855) (-2648.527) (-2647.906) [-2641.746] * (-2642.621) [-2637.929] (-2649.271) (-2650.199) -- 0:00:00

      Average standard deviation of split frequencies: 0.107137

       5500 -- (-2642.994) [-2642.371] (-2646.102) (-2648.080) * [-2642.798] (-2646.340) (-2640.922) (-2641.696) -- 0:00:00
       6000 -- (-2645.664) (-2643.627) (-2645.173) [-2643.329] * (-2642.841) (-2644.597) [-2642.017] (-2645.471) -- 0:00:00
       6500 -- [-2643.049] (-2647.439) (-2642.563) (-2653.556) * [-2644.991] (-2642.125) (-2649.531) (-2647.878) -- 0:00:00
       7000 -- (-2648.589) [-2639.538] (-2651.828) (-2641.296) * (-2642.083) [-2641.214] (-2647.548) (-2658.820) -- 0:00:00
       7500 -- [-2642.776] (-2645.186) (-2645.921) (-2650.028) * (-2641.230) (-2640.027) (-2645.016) [-2644.027] -- 0:00:00
       8000 -- (-2646.801) (-2644.652) [-2643.707] (-2648.773) * (-2663.491) (-2641.602) [-2642.460] (-2643.444) -- 0:00:00
       8500 -- (-2641.165) (-2644.180) (-2645.531) [-2644.664] * [-2645.230] (-2640.616) (-2646.777) (-2652.121) -- 0:00:00
       9000 -- (-2646.524) (-2647.578) (-2647.946) [-2645.899] * (-2640.967) (-2640.265) (-2643.608) [-2643.366] -- 0:00:00
       9500 -- [-2643.487] (-2646.931) (-2645.635) (-2643.587) * (-2647.842) (-2640.934) (-2642.664) [-2645.770] -- 0:00:00
      10000 -- (-2653.863) (-2649.888) (-2648.649) [-2641.405] * (-2642.310) (-2640.438) [-2639.503] (-2647.291) -- 0:00:00

      Average standard deviation of split frequencies: 0.074327

      10500 -- (-2645.828) (-2646.943) (-2648.298) [-2645.653] * (-2644.635) (-2640.085) (-2650.542) [-2640.757] -- 0:00:00
      11000 -- (-2638.698) (-2645.493) (-2646.245) [-2641.213] * (-2642.948) (-2641.029) (-2647.239) [-2640.923] -- 0:00:00
      11500 -- (-2640.373) [-2641.524] (-2644.862) (-2646.020) * (-2651.357) (-2642.408) [-2641.292] (-2646.864) -- 0:01:25
      12000 -- [-2642.247] (-2642.340) (-2644.677) (-2641.150) * [-2642.918] (-2642.408) (-2637.841) (-2649.692) -- 0:01:22
      12500 -- (-2648.788) [-2642.266] (-2650.358) (-2643.916) * (-2642.831) (-2641.190) [-2642.867] (-2642.065) -- 0:01:19
      13000 -- [-2649.472] (-2650.554) (-2649.950) (-2638.831) * (-2644.411) (-2640.820) (-2642.557) [-2651.009] -- 0:01:15
      13500 -- (-2643.829) (-2645.302) (-2640.459) [-2639.344] * [-2640.025] (-2640.807) (-2645.471) (-2642.072) -- 0:01:13
      14000 -- (-2649.245) (-2641.680) (-2643.241) [-2642.774] * (-2640.288) (-2642.095) [-2640.928] (-2641.930) -- 0:01:10
      14500 -- (-2647.010) [-2644.591] (-2649.578) (-2642.386) * [-2640.240] (-2643.354) (-2643.049) (-2644.962) -- 0:01:07
      15000 -- [-2643.332] (-2644.395) (-2644.277) (-2645.526) * [-2639.242] (-2641.570) (-2642.011) (-2643.603) -- 0:01:05

      Average standard deviation of split frequencies: 0.056247

      15500 -- (-2644.566) (-2644.463) (-2645.847) [-2644.213] * (-2641.739) (-2642.870) (-2645.406) [-2642.035] -- 0:01:03
      16000 -- (-2649.917) (-2642.432) [-2644.600] (-2648.910) * (-2655.795) (-2640.980) (-2640.720) [-2641.699] -- 0:01:01
      16500 -- (-2643.796) [-2641.779] (-2648.794) (-2645.466) * (-2647.149) (-2640.529) [-2644.622] (-2641.507) -- 0:00:59
      17000 -- (-2644.444) (-2643.017) (-2640.357) [-2639.687] * (-2651.507) (-2640.428) (-2650.305) [-2641.426] -- 0:00:57
      17500 -- (-2645.281) [-2642.991] (-2640.773) (-2641.335) * (-2647.550) (-2642.232) (-2641.837) [-2640.798] -- 0:00:56
      18000 -- (-2649.813) (-2639.675) (-2644.564) [-2645.570] * (-2644.616) (-2641.201) (-2647.910) [-2644.090] -- 0:00:54
      18500 -- (-2656.248) [-2644.276] (-2647.507) (-2649.884) * (-2647.465) (-2641.189) (-2641.790) [-2645.046] -- 0:00:53
      19000 -- [-2645.614] (-2649.297) (-2647.244) (-2647.687) * [-2640.104] (-2643.026) (-2646.966) (-2646.444) -- 0:00:51
      19500 -- (-2645.512) (-2645.053) (-2642.697) [-2642.528] * (-2640.519) (-2641.616) [-2644.811] (-2644.981) -- 0:00:50
      20000 -- (-2646.669) (-2646.136) (-2643.120) [-2642.127] * (-2638.961) (-2641.337) [-2645.197] (-2643.372) -- 0:00:49

      Average standard deviation of split frequencies: 0.044419

      20500 -- (-2647.254) (-2648.387) [-2643.209] (-2643.345) * (-2639.767) (-2644.813) [-2640.175] (-2645.846) -- 0:00:47
      21000 -- [-2639.470] (-2647.394) (-2645.923) (-2641.164) * (-2642.046) (-2646.372) (-2651.974) [-2645.843] -- 0:00:46
      21500 -- (-2644.391) (-2650.161) (-2641.633) [-2638.852] * (-2639.390) [-2641.215] (-2649.362) (-2639.936) -- 0:00:45
      22000 -- (-2643.527) (-2645.662) (-2640.650) [-2641.356] * (-2647.435) (-2642.801) (-2649.829) [-2644.144] -- 0:00:44
      22500 -- [-2642.852] (-2646.020) (-2645.534) (-2640.039) * [-2643.512] (-2641.946) (-2643.428) (-2657.507) -- 0:00:43
      23000 -- (-2643.711) (-2642.741) [-2642.494] (-2644.467) * (-2640.154) (-2641.223) [-2645.084] (-2646.798) -- 0:00:42
      23500 -- (-2645.057) (-2639.698) [-2638.796] (-2648.352) * [-2641.409] (-2640.947) (-2646.253) (-2645.931) -- 0:00:41
      24000 -- (-2643.961) [-2641.828] (-2648.424) (-2644.805) * (-2638.949) (-2641.838) [-2642.310] (-2643.649) -- 0:00:40
      24500 -- [-2647.912] (-2652.845) (-2641.837) (-2644.244) * (-2638.309) (-2642.649) [-2639.475] (-2653.215) -- 0:00:39
      25000 -- (-2650.534) (-2646.432) [-2642.966] (-2655.851) * (-2640.348) (-2640.794) [-2641.490] (-2645.464) -- 0:01:18

      Average standard deviation of split frequencies: 0.042031

      25500 -- (-2655.710) [-2646.638] (-2646.331) (-2637.563) * (-2639.951) (-2645.614) (-2641.143) [-2640.633] -- 0:01:16
      26000 -- (-2645.130) [-2650.898] (-2639.921) (-2643.067) * (-2638.693) [-2644.910] (-2650.552) (-2643.981) -- 0:01:14
      26500 -- (-2650.345) [-2645.999] (-2642.487) (-2640.640) * (-2640.531) (-2640.144) (-2645.058) [-2638.439] -- 0:01:13
      27000 -- [-2648.196] (-2640.989) (-2643.611) (-2651.678) * (-2641.627) (-2646.087) [-2645.105] (-2645.867) -- 0:01:12
      27500 -- (-2647.128) [-2641.216] (-2638.645) (-2652.846) * (-2640.311) (-2641.045) (-2646.295) [-2640.740] -- 0:01:10
      28000 -- (-2652.762) (-2639.219) (-2653.380) [-2644.625] * (-2643.252) (-2642.538) (-2646.206) [-2641.552] -- 0:01:09
      28500 -- (-2647.614) [-2638.301] (-2647.589) (-2647.341) * (-2644.480) (-2641.806) (-2639.641) [-2642.230] -- 0:01:08
      29000 -- (-2638.210) (-2643.672) [-2650.117] (-2652.588) * (-2644.581) (-2639.725) (-2646.965) [-2638.044] -- 0:01:06
      29500 -- (-2642.213) (-2647.284) [-2645.740] (-2648.900) * (-2642.109) (-2640.512) [-2638.634] (-2645.838) -- 0:01:05
      30000 -- [-2646.457] (-2649.906) (-2651.647) (-2644.975) * (-2644.167) (-2640.341) (-2644.500) [-2643.011] -- 0:01:04

      Average standard deviation of split frequencies: 0.048543

      30500 -- (-2645.651) (-2649.781) [-2649.955] (-2648.127) * (-2643.722) (-2639.529) (-2641.296) [-2645.580] -- 0:01:03
      31000 -- (-2646.215) [-2644.430] (-2648.339) (-2648.606) * [-2640.334] (-2642.890) (-2645.358) (-2647.627) -- 0:01:02
      31500 -- [-2639.130] (-2652.617) (-2640.431) (-2644.353) * [-2639.254] (-2642.370) (-2653.118) (-2642.539) -- 0:01:01
      32000 -- [-2646.441] (-2642.003) (-2642.332) (-2646.277) * (-2643.837) (-2642.775) (-2649.381) [-2644.240] -- 0:01:00
      32500 -- [-2641.472] (-2648.419) (-2643.441) (-2642.929) * (-2643.008) (-2645.469) [-2647.098] (-2648.956) -- 0:00:59
      33000 -- (-2647.350) (-2649.819) (-2642.602) [-2642.308] * (-2644.104) (-2644.020) [-2639.567] (-2643.444) -- 0:00:58
      33500 -- [-2638.576] (-2639.754) (-2642.610) (-2648.135) * (-2643.228) (-2644.069) (-2644.636) [-2642.129] -- 0:00:57
      34000 -- [-2638.647] (-2654.978) (-2640.811) (-2647.183) * (-2640.701) (-2643.944) (-2652.679) [-2640.714] -- 0:00:56
      34500 -- [-2643.192] (-2650.776) (-2641.964) (-2640.802) * (-2642.068) [-2640.745] (-2643.559) (-2649.284) -- 0:00:55
      35000 -- (-2644.842) (-2641.459) [-2639.027] (-2642.842) * (-2643.501) (-2640.574) (-2640.554) [-2639.685] -- 0:00:55

      Average standard deviation of split frequencies: 0.037320

      35500 -- (-2641.743) (-2641.774) (-2640.001) [-2652.297] * (-2644.067) (-2639.788) (-2640.151) [-2644.653] -- 0:00:54
      36000 -- (-2651.433) [-2637.691] (-2643.697) (-2641.620) * (-2639.002) (-2642.605) (-2638.709) [-2639.129] -- 0:00:53
      36500 -- (-2645.024) (-2638.881) (-2643.114) [-2639.995] * (-2638.012) (-2642.453) (-2638.566) [-2639.784] -- 0:00:52
      37000 -- (-2652.098) [-2637.380] (-2642.470) (-2647.148) * (-2638.899) (-2647.350) (-2638.867) [-2640.798] -- 0:00:52
      37500 -- (-2640.372) (-2638.299) [-2642.780] (-2646.908) * (-2639.527) (-2638.287) [-2640.159] (-2640.291) -- 0:00:51
      38000 -- (-2644.403) [-2640.847] (-2637.972) (-2649.719) * [-2637.525] (-2645.074) (-2639.011) (-2648.141) -- 0:01:15
      38500 -- (-2643.620) [-2640.987] (-2637.518) (-2648.674) * (-2639.639) [-2641.159] (-2639.805) (-2643.756) -- 0:01:14
      39000 -- (-2653.352) [-2638.817] (-2640.238) (-2646.110) * (-2639.639) (-2639.899) [-2639.815] (-2640.728) -- 0:01:13
      39500 -- (-2649.493) (-2640.040) (-2640.011) [-2639.196] * (-2640.837) (-2640.527) (-2638.879) [-2646.221] -- 0:01:12
      40000 -- (-2653.518) [-2639.422] (-2638.373) (-2646.219) * (-2638.589) (-2640.397) (-2637.904) [-2643.042] -- 0:01:12

      Average standard deviation of split frequencies: 0.038833

      40500 -- (-2641.854) (-2640.701) (-2638.758) [-2643.978] * (-2638.835) (-2642.261) (-2638.359) [-2637.670] -- 0:01:11
      41000 -- (-2645.692) (-2638.615) (-2641.884) [-2638.278] * (-2639.353) (-2641.557) [-2640.768] (-2638.180) -- 0:01:10
      41500 -- (-2646.301) (-2639.430) (-2643.764) [-2643.399] * (-2639.267) (-2639.078) [-2638.127] (-2643.008) -- 0:01:09
      42000 -- (-2645.746) (-2637.209) [-2639.623] (-2648.973) * (-2637.357) (-2639.417) [-2637.956] (-2640.349) -- 0:01:08
      42500 -- (-2642.441) (-2637.938) [-2639.988] (-2641.510) * (-2639.614) (-2642.365) (-2644.083) [-2642.162] -- 0:01:07
      43000 -- [-2642.766] (-2638.493) (-2639.555) (-2641.056) * [-2639.590] (-2642.491) (-2641.693) (-2643.137) -- 0:01:06
      43500 -- (-2648.946) [-2639.143] (-2637.855) (-2644.236) * (-2641.110) [-2640.989] (-2640.521) (-2644.536) -- 0:01:05
      44000 -- (-2645.085) (-2640.167) (-2639.697) [-2640.053] * (-2642.757) (-2643.115) [-2637.224] (-2653.938) -- 0:01:05
      44500 -- (-2649.510) [-2641.462] (-2639.267) (-2641.815) * (-2643.886) [-2640.680] (-2637.518) (-2643.264) -- 0:01:04
      45000 -- [-2638.902] (-2643.728) (-2639.254) (-2639.850) * (-2645.743) [-2640.526] (-2639.333) (-2640.415) -- 0:01:03

      Average standard deviation of split frequencies: 0.040992

      45500 -- (-2646.140) (-2641.549) (-2640.497) [-2639.629] * [-2641.988] (-2638.939) (-2645.334) (-2639.759) -- 0:01:02
      46000 -- [-2644.722] (-2641.451) (-2642.355) (-2641.461) * (-2641.617) (-2640.210) (-2640.760) [-2644.359] -- 0:01:02
      46500 -- (-2651.007) [-2640.715] (-2642.130) (-2642.486) * (-2641.440) [-2640.257] (-2638.250) (-2648.524) -- 0:01:01
      47000 -- (-2649.840) (-2638.094) [-2638.264] (-2637.679) * [-2643.034] (-2639.760) (-2636.086) (-2643.590) -- 0:01:00
      47500 -- [-2646.254] (-2640.892) (-2639.898) (-2640.862) * (-2641.157) (-2640.087) [-2639.799] (-2641.321) -- 0:01:00
      48000 -- [-2653.900] (-2637.923) (-2642.273) (-2638.827) * (-2640.090) (-2642.640) (-2640.029) [-2642.390] -- 0:00:59
      48500 -- [-2648.923] (-2638.817) (-2641.241) (-2642.565) * (-2640.545) (-2643.224) (-2638.414) [-2639.240] -- 0:00:58
      49000 -- (-2651.084) [-2637.625] (-2641.171) (-2641.990) * (-2639.076) (-2641.499) [-2637.823] (-2644.534) -- 0:00:58
      49500 -- (-2646.754) [-2639.132] (-2641.876) (-2641.521) * (-2639.240) (-2641.498) (-2638.766) [-2639.869] -- 0:00:57
      50000 -- (-2644.805) (-2640.777) (-2642.637) [-2642.105] * (-2640.038) [-2643.467] (-2638.869) (-2641.193) -- 0:00:57

      Average standard deviation of split frequencies: 0.036773

      50500 -- (-2650.170) (-2639.693) (-2641.414) [-2642.937] * [-2638.432] (-2641.254) (-2638.801) (-2649.172) -- 0:00:56
      51000 -- (-2643.146) (-2637.148) [-2638.053] (-2640.403) * (-2638.163) (-2641.253) (-2638.676) [-2641.678] -- 0:01:14
      51500 -- (-2644.792) (-2636.757) [-2636.208] (-2640.050) * (-2643.469) (-2642.061) (-2638.581) [-2638.372] -- 0:01:13
      52000 -- [-2646.760] (-2637.276) (-2637.077) (-2641.389) * (-2639.596) (-2642.156) [-2643.928] (-2647.640) -- 0:01:12
      52500 -- [-2645.710] (-2638.892) (-2641.775) (-2641.451) * (-2640.304) (-2643.347) (-2644.915) [-2640.583] -- 0:01:12
      53000 -- (-2649.176) [-2638.275] (-2643.339) (-2639.681) * (-2640.531) (-2643.347) (-2640.727) [-2640.541] -- 0:01:11
      53500 -- (-2648.898) [-2637.037] (-2642.436) (-2639.452) * [-2641.555] (-2642.832) (-2637.692) (-2645.139) -- 0:01:10
      54000 -- (-2648.797) [-2638.443] (-2640.524) (-2637.880) * [-2641.435] (-2643.530) (-2638.730) (-2652.351) -- 0:01:10
      54500 -- (-2642.891) [-2640.058] (-2642.528) (-2638.557) * [-2642.631] (-2643.531) (-2637.400) (-2652.405) -- 0:01:09
      55000 -- (-2644.176) (-2638.480) [-2636.761] (-2638.979) * (-2642.489) (-2646.158) (-2638.520) [-2644.258] -- 0:01:08

      Average standard deviation of split frequencies: 0.030465

      55500 -- (-2643.019) (-2642.122) [-2637.063] (-2639.067) * [-2642.993] (-2644.001) (-2638.485) (-2645.628) -- 0:01:08
      56000 -- [-2645.159] (-2644.376) (-2637.132) (-2640.811) * (-2641.137) (-2643.644) (-2638.892) [-2646.051] -- 0:01:07
      56500 -- [-2642.783] (-2642.596) (-2640.403) (-2644.602) * (-2644.501) [-2641.473] (-2639.864) (-2643.808) -- 0:01:06
      57000 -- (-2641.429) (-2642.505) (-2642.529) [-2639.196] * (-2641.404) (-2642.359) [-2638.989] (-2641.484) -- 0:01:06
      57500 -- (-2644.842) (-2641.573) (-2643.369) [-2638.093] * (-2643.864) (-2641.382) (-2638.369) [-2643.418] -- 0:01:05
      58000 -- [-2641.261] (-2643.485) (-2643.182) (-2644.559) * (-2642.714) (-2641.009) (-2640.992) [-2642.318] -- 0:01:04
      58500 -- (-2650.665) [-2643.204] (-2645.525) (-2643.181) * (-2641.804) (-2641.326) [-2642.425] (-2641.965) -- 0:01:04
      59000 -- [-2643.732] (-2640.681) (-2641.348) (-2641.986) * (-2643.329) (-2641.046) [-2642.274] (-2641.204) -- 0:01:03
      59500 -- (-2645.742) (-2639.259) [-2642.486] (-2643.547) * (-2644.654) [-2641.546] (-2641.369) (-2639.403) -- 0:01:03
      60000 -- (-2641.180) (-2642.142) (-2640.728) [-2640.791] * (-2646.320) (-2641.779) (-2646.547) [-2639.060] -- 0:01:02

      Average standard deviation of split frequencies: 0.029446

      60500 -- (-2657.592) (-2640.757) [-2642.344] (-2638.888) * (-2644.892) [-2640.958] (-2644.946) (-2643.770) -- 0:01:02
      61000 -- [-2648.025] (-2640.692) (-2640.269) (-2641.029) * (-2640.689) [-2642.047] (-2643.650) (-2645.122) -- 0:01:01
      61500 -- (-2646.689) [-2641.094] (-2639.163) (-2639.536) * (-2639.673) (-2641.060) [-2639.416] (-2646.110) -- 0:01:01
      62000 -- (-2646.018) (-2640.719) [-2638.778] (-2642.204) * [-2639.853] (-2640.097) (-2641.824) (-2643.368) -- 0:01:00
      62500 -- [-2644.356] (-2642.618) (-2640.573) (-2641.276) * [-2639.872] (-2640.774) (-2639.417) (-2644.259) -- 0:01:00
      63000 -- [-2651.342] (-2642.636) (-2641.142) (-2641.310) * [-2639.447] (-2641.734) (-2640.773) (-2642.831) -- 0:00:59
      63500 -- (-2648.283) [-2641.957] (-2640.998) (-2641.511) * (-2642.637) (-2640.489) (-2642.956) [-2638.723] -- 0:00:58
      64000 -- [-2649.643] (-2640.347) (-2641.092) (-2638.783) * [-2644.954] (-2639.686) (-2643.905) (-2643.780) -- 0:00:58
      64500 -- [-2645.342] (-2637.542) (-2640.351) (-2638.332) * [-2640.162] (-2640.602) (-2641.079) (-2640.865) -- 0:01:12
      65000 -- [-2639.017] (-2638.993) (-2639.943) (-2640.084) * (-2640.300) [-2642.420] (-2642.831) (-2641.871) -- 0:01:11

      Average standard deviation of split frequencies: 0.030951

      65500 -- [-2645.035] (-2639.288) (-2640.855) (-2641.047) * (-2647.001) (-2645.414) (-2640.153) [-2639.637] -- 0:01:11
      66000 -- (-2640.736) [-2639.859] (-2640.749) (-2640.824) * [-2644.991] (-2640.629) (-2640.084) (-2640.494) -- 0:01:10
      66500 -- [-2641.707] (-2640.084) (-2640.653) (-2641.109) * (-2644.951) (-2639.401) [-2640.030] (-2643.096) -- 0:01:10
      67000 -- [-2642.622] (-2639.716) (-2641.362) (-2640.186) * (-2640.555) [-2639.621] (-2642.738) (-2638.990) -- 0:01:09
      67500 -- (-2640.589) [-2641.017] (-2643.944) (-2639.499) * (-2642.565) (-2639.095) (-2640.790) [-2638.076] -- 0:01:09
      68000 -- [-2639.809] (-2640.985) (-2638.364) (-2639.003) * (-2645.710) [-2642.866] (-2641.301) (-2640.109) -- 0:01:08
      68500 -- [-2642.444] (-2644.885) (-2640.239) (-2639.357) * (-2640.255) (-2642.914) (-2642.500) [-2640.874] -- 0:01:07
      69000 -- [-2642.459] (-2639.479) (-2639.227) (-2639.435) * (-2642.016) [-2642.188] (-2641.000) (-2641.741) -- 0:01:07
      69500 -- (-2643.501) (-2640.351) (-2638.721) [-2641.273] * (-2638.961) (-2642.655) [-2639.407] (-2638.163) -- 0:01:06
      70000 -- [-2642.188] (-2640.449) (-2640.846) (-2643.484) * [-2640.660] (-2641.041) (-2643.306) (-2639.106) -- 0:01:06

      Average standard deviation of split frequencies: 0.034021

      70500 -- (-2640.813) [-2640.608] (-2640.415) (-2640.401) * (-2643.077) (-2641.344) [-2642.417] (-2642.828) -- 0:01:05
      71000 -- [-2643.069] (-2640.608) (-2642.608) (-2639.957) * [-2640.069] (-2643.675) (-2642.183) (-2640.634) -- 0:01:05
      71500 -- (-2646.746) (-2639.770) [-2647.614] (-2640.924) * (-2644.904) [-2642.731] (-2641.250) (-2640.275) -- 0:01:04
      72000 -- (-2642.753) [-2640.532] (-2647.412) (-2641.167) * (-2639.451) (-2641.662) (-2642.221) [-2638.635] -- 0:01:04
      72500 -- [-2641.684] (-2640.453) (-2646.695) (-2640.977) * (-2642.701) (-2641.084) (-2641.771) [-2637.980] -- 0:01:03
      73000 -- [-2643.398] (-2641.611) (-2643.713) (-2639.869) * (-2640.727) (-2641.346) (-2644.163) [-2639.127] -- 0:01:03
      73500 -- (-2644.696) [-2642.346] (-2641.256) (-2641.392) * (-2642.442) [-2643.774] (-2643.211) (-2642.999) -- 0:01:03
      74000 -- [-2645.936] (-2646.086) (-2642.014) (-2642.938) * (-2640.968) (-2641.123) (-2642.447) [-2642.909] -- 0:01:02
      74500 -- [-2648.945] (-2643.733) (-2645.729) (-2640.802) * (-2640.132) (-2640.133) [-2640.962] (-2641.343) -- 0:01:02
      75000 -- (-2640.303) (-2646.411) (-2643.670) [-2644.751] * (-2640.718) (-2642.493) [-2642.008] (-2643.408) -- 0:01:01

      Average standard deviation of split frequencies: 0.031634

      75500 -- [-2645.158] (-2642.038) (-2643.638) (-2641.606) * [-2640.120] (-2641.820) (-2641.574) (-2642.643) -- 0:01:01
      76000 -- (-2637.584) (-2640.371) (-2642.489) [-2639.183] * [-2643.877] (-2640.487) (-2646.461) (-2640.783) -- 0:01:00
      76500 -- (-2641.456) [-2640.610] (-2644.635) (-2642.124) * (-2641.976) (-2646.667) (-2640.544) [-2641.354] -- 0:01:00
      77000 -- (-2650.100) (-2640.849) [-2643.328] (-2641.836) * (-2641.997) [-2640.045] (-2642.964) (-2641.200) -- 0:00:59
      77500 -- (-2652.590) (-2639.933) (-2643.383) [-2639.001] * (-2642.888) [-2639.207] (-2642.780) (-2640.104) -- 0:00:59
      78000 -- (-2647.896) (-2639.727) [-2639.833] (-2643.591) * (-2641.664) (-2641.249) [-2642.049] (-2638.604) -- 0:01:10
      78500 -- [-2649.644] (-2639.754) (-2638.663) (-2639.052) * (-2639.792) [-2640.977] (-2642.433) (-2640.022) -- 0:01:10
      79000 -- [-2641.575] (-2639.710) (-2642.706) (-2639.365) * (-2639.443) (-2641.059) (-2643.252) [-2641.038] -- 0:01:09
      79500 -- [-2637.527] (-2640.522) (-2640.740) (-2639.211) * (-2642.303) (-2641.076) (-2640.772) [-2638.721] -- 0:01:09
      80000 -- [-2644.829] (-2640.635) (-2639.667) (-2641.030) * (-2639.830) (-2640.933) [-2639.858] (-2640.377) -- 0:01:09

      Average standard deviation of split frequencies: 0.032726

      80500 -- [-2647.052] (-2641.875) (-2640.388) (-2640.389) * (-2639.433) (-2640.724) [-2640.928] (-2640.394) -- 0:01:08
      81000 -- [-2641.150] (-2640.863) (-2639.167) (-2640.751) * (-2639.561) (-2640.477) (-2641.347) [-2637.944] -- 0:01:08
      81500 -- (-2646.181) (-2642.009) [-2640.306] (-2640.371) * [-2639.564] (-2641.252) (-2639.748) (-2639.394) -- 0:01:07
      82000 -- [-2640.211] (-2642.384) (-2639.448) (-2640.716) * (-2639.710) [-2641.455] (-2641.172) (-2638.747) -- 0:01:07
      82500 -- (-2645.145) [-2640.686] (-2639.272) (-2639.363) * (-2640.771) [-2640.889] (-2643.060) (-2638.603) -- 0:01:06
      83000 -- [-2641.889] (-2640.790) (-2638.498) (-2638.715) * [-2641.045] (-2640.013) (-2640.368) (-2639.273) -- 0:01:06
      83500 -- (-2641.948) (-2640.330) [-2641.014] (-2639.844) * [-2639.119] (-2638.962) (-2640.755) (-2640.767) -- 0:01:05
      84000 -- (-2646.256) (-2640.791) [-2639.853] (-2639.729) * [-2639.636] (-2640.058) (-2647.731) (-2639.302) -- 0:01:05
      84500 -- (-2650.578) (-2641.757) [-2638.578] (-2639.747) * (-2639.659) [-2637.881] (-2643.561) (-2640.021) -- 0:01:05
      85000 -- (-2647.465) [-2640.018] (-2640.069) (-2641.289) * [-2638.800] (-2639.029) (-2639.888) (-2640.800) -- 0:01:04

      Average standard deviation of split frequencies: 0.028712

      85500 -- [-2643.757] (-2640.432) (-2641.190) (-2642.027) * [-2638.494] (-2639.462) (-2641.957) (-2641.050) -- 0:01:04
      86000 -- (-2643.409) (-2639.529) (-2641.564) [-2640.483] * (-2644.444) (-2640.291) (-2645.146) [-2640.678] -- 0:01:03
      86500 -- (-2645.012) (-2640.627) [-2639.297] (-2640.011) * (-2647.761) [-2641.279] (-2648.952) (-2639.213) -- 0:01:03
      87000 -- [-2645.670] (-2642.298) (-2640.271) (-2638.314) * (-2638.484) (-2638.465) (-2641.657) [-2638.607] -- 0:01:02
      87500 -- (-2643.555) (-2639.022) [-2639.015] (-2640.502) * (-2639.753) (-2638.936) (-2641.059) [-2638.367] -- 0:01:02
      88000 -- [-2642.707] (-2639.521) (-2640.022) (-2645.424) * (-2642.902) [-2640.287] (-2640.207) (-2640.069) -- 0:01:02
      88500 -- (-2644.950) [-2640.342] (-2640.343) (-2643.985) * [-2639.955] (-2640.732) (-2641.244) (-2638.336) -- 0:01:01
      89000 -- [-2640.575] (-2643.029) (-2639.466) (-2648.234) * (-2640.151) (-2639.742) (-2642.873) [-2638.893] -- 0:01:01
      89500 -- (-2642.024) (-2639.593) [-2640.744] (-2638.528) * (-2640.600) (-2639.341) [-2639.224] (-2638.025) -- 0:01:01
      90000 -- (-2653.428) (-2638.746) (-2641.746) [-2639.732] * [-2641.337] (-2643.411) (-2638.665) (-2640.081) -- 0:01:00

      Average standard deviation of split frequencies: 0.028968

      90500 -- (-2642.152) [-2640.863] (-2640.472) (-2641.730) * (-2639.528) (-2641.796) (-2639.913) [-2640.321] -- 0:01:00
      91000 -- (-2644.733) (-2644.122) [-2639.767] (-2643.254) * (-2640.080) [-2641.485] (-2640.688) (-2642.672) -- 0:01:09
      91500 -- (-2647.787) (-2642.320) (-2644.445) [-2639.539] * (-2640.750) [-2642.787] (-2639.016) (-2641.945) -- 0:01:09
      92000 -- (-2643.139) (-2642.557) (-2641.638) [-2640.033] * [-2639.764] (-2642.648) (-2644.052) (-2639.796) -- 0:01:09
      92500 -- [-2647.251] (-2640.529) (-2639.480) (-2640.527) * (-2640.158) (-2640.972) [-2641.263] (-2641.958) -- 0:01:08
      93000 -- (-2650.787) (-2640.101) [-2645.779] (-2640.585) * (-2639.716) (-2641.839) (-2641.350) [-2642.230] -- 0:01:08
      93500 -- [-2642.026] (-2640.663) (-2645.987) (-2640.322) * [-2642.613] (-2642.299) (-2642.272) (-2646.554) -- 0:01:07
      94000 -- (-2643.476) (-2640.172) [-2645.440] (-2640.201) * [-2640.429] (-2641.655) (-2645.699) (-2646.684) -- 0:01:07
      94500 -- (-2646.118) [-2640.472] (-2639.091) (-2638.787) * (-2642.274) (-2639.920) (-2642.437) [-2643.072] -- 0:01:07
      95000 -- (-2643.207) (-2640.206) [-2637.530] (-2639.404) * (-2639.478) (-2641.656) [-2639.052] (-2641.287) -- 0:01:06

      Average standard deviation of split frequencies: 0.023570

      95500 -- (-2649.902) (-2639.224) (-2640.947) [-2640.127] * (-2638.374) (-2640.155) (-2640.399) [-2638.957] -- 0:01:06
      96000 -- (-2645.451) [-2640.473] (-2639.967) (-2641.143) * (-2639.333) (-2639.510) [-2640.981] (-2638.378) -- 0:01:05
      96500 -- (-2653.170) (-2641.955) (-2641.929) [-2641.783] * [-2640.610] (-2640.066) (-2640.207) (-2638.536) -- 0:01:05
      97000 -- (-2650.515) (-2643.207) [-2642.059] (-2641.087) * (-2642.100) (-2643.050) [-2639.680] (-2638.749) -- 0:01:05
      97500 -- [-2647.389] (-2640.754) (-2639.014) (-2641.405) * (-2639.909) [-2640.651] (-2637.618) (-2637.917) -- 0:01:04
      98000 -- (-2648.462) [-2639.761] (-2638.683) (-2642.835) * (-2641.335) (-2640.562) [-2639.543] (-2638.215) -- 0:01:04
      98500 -- [-2642.178] (-2641.960) (-2639.030) (-2643.745) * (-2642.730) [-2639.988] (-2639.432) (-2639.548) -- 0:01:04
      99000 -- [-2648.275] (-2639.727) (-2638.934) (-2642.535) * [-2640.634] (-2639.033) (-2642.625) (-2639.079) -- 0:01:03
      99500 -- (-2645.939) (-2641.652) (-2638.048) [-2641.322] * (-2643.928) (-2643.951) (-2638.789) [-2638.765] -- 0:01:03
      100000 -- (-2645.075) [-2639.445] (-2640.052) (-2639.838) * (-2643.061) [-2641.475] (-2640.643) (-2638.463) -- 0:01:02

      Average standard deviation of split frequencies: 0.021775

      100500 -- (-2648.513) [-2641.620] (-2640.621) (-2639.955) * (-2645.888) [-2642.045] (-2639.926) (-2640.139) -- 0:01:02
      101000 -- [-2643.715] (-2642.832) (-2640.625) (-2640.115) * (-2642.529) (-2642.616) [-2638.572] (-2642.562) -- 0:01:02
      101500 -- (-2647.040) (-2641.222) (-2640.479) [-2640.562] * (-2640.371) (-2645.454) (-2638.486) [-2639.686] -- 0:01:01
      102000 -- [-2643.762] (-2640.456) (-2640.133) (-2645.745) * (-2640.489) [-2640.080] (-2640.350) (-2642.686) -- 0:01:01
      102500 -- (-2651.068) [-2640.038] (-2640.405) (-2643.040) * (-2640.549) [-2640.813] (-2640.877) (-2639.763) -- 0:01:01
      103000 -- (-2646.660) (-2640.925) [-2639.516] (-2640.846) * (-2640.824) [-2641.437] (-2644.005) (-2638.247) -- 0:01:00
      103500 -- (-2656.060) (-2643.821) (-2638.804) [-2641.458] * (-2642.240) (-2640.371) (-2641.399) [-2638.882] -- 0:01:00
      104000 -- (-2639.183) (-2640.021) [-2641.281] (-2642.953) * (-2644.185) [-2638.167] (-2640.707) (-2647.561) -- 0:01:08
      104500 -- (-2640.548) [-2639.628] (-2638.814) (-2640.080) * [-2640.350] (-2639.663) (-2638.954) (-2644.993) -- 0:01:08
      105000 -- (-2641.210) [-2641.383] (-2641.650) (-2641.109) * [-2640.774] (-2640.116) (-2640.148) (-2639.971) -- 0:01:08

      Average standard deviation of split frequencies: 0.020457

      105500 -- [-2642.251] (-2642.035) (-2641.149) (-2642.610) * (-2642.166) (-2638.757) (-2641.532) [-2638.211] -- 0:01:07
      106000 -- (-2639.018) [-2640.438] (-2641.862) (-2640.651) * (-2641.360) (-2640.067) (-2643.404) [-2638.201] -- 0:01:07
      106500 -- (-2638.334) (-2638.184) (-2644.184) [-2638.242] * [-2639.700] (-2638.481) (-2642.446) (-2638.911) -- 0:01:07
      107000 -- [-2641.301] (-2639.921) (-2644.184) (-2642.084) * (-2642.187) (-2638.083) (-2641.580) [-2638.576] -- 0:01:06
      107500 -- (-2640.844) [-2642.301] (-2640.833) (-2641.531) * (-2638.601) [-2639.616] (-2641.441) (-2637.925) -- 0:01:06
      108000 -- (-2638.419) (-2643.243) (-2639.363) [-2640.686] * [-2637.840] (-2637.907) (-2643.659) (-2639.860) -- 0:01:06
      108500 -- [-2640.325] (-2641.450) (-2640.430) (-2642.263) * (-2639.149) (-2639.919) (-2640.656) [-2637.775] -- 0:01:05
      109000 -- (-2642.097) (-2640.550) (-2639.064) [-2641.062] * (-2639.696) (-2644.646) (-2645.071) [-2639.725] -- 0:01:05
      109500 -- (-2642.522) [-2640.549] (-2641.119) (-2640.358) * (-2639.860) (-2642.845) (-2641.235) [-2641.544] -- 0:01:05
      110000 -- (-2642.188) (-2641.810) (-2645.477) [-2641.049] * (-2639.844) [-2639.715] (-2641.274) (-2642.204) -- 0:01:04

      Average standard deviation of split frequencies: 0.018160

      110500 -- (-2640.213) (-2646.866) (-2641.893) [-2644.243] * (-2638.813) [-2639.699] (-2640.630) (-2641.365) -- 0:01:04
      111000 -- (-2643.617) (-2643.781) [-2643.623] (-2644.000) * (-2639.767) [-2639.746] (-2646.009) (-2643.147) -- 0:01:04
      111500 -- [-2644.748] (-2644.106) (-2640.426) (-2642.318) * [-2639.432] (-2638.887) (-2642.405) (-2639.763) -- 0:01:03
      112000 -- [-2639.625] (-2645.597) (-2640.048) (-2641.113) * (-2640.249) (-2638.922) (-2643.952) [-2639.650] -- 0:01:03
      112500 -- (-2639.327) (-2641.828) (-2639.350) [-2638.598] * (-2639.654) [-2639.805] (-2645.280) (-2640.892) -- 0:01:03
      113000 -- (-2641.248) (-2641.783) [-2639.514] (-2641.573) * [-2640.401] (-2640.129) (-2641.903) (-2640.616) -- 0:01:02
      113500 -- (-2643.388) [-2640.413] (-2641.664) (-2640.536) * (-2641.640) (-2639.944) (-2640.895) [-2642.495] -- 0:01:02
      114000 -- (-2641.714) (-2640.338) (-2641.710) [-2639.399] * (-2638.954) (-2639.575) [-2642.307] (-2642.645) -- 0:01:02
      114500 -- [-2639.608] (-2639.845) (-2641.753) (-2639.844) * (-2640.391) [-2641.043] (-2640.470) (-2643.526) -- 0:01:01
      115000 -- [-2640.405] (-2641.881) (-2641.884) (-2640.707) * (-2638.426) (-2643.025) (-2640.585) [-2640.751] -- 0:01:01

      Average standard deviation of split frequencies: 0.018822

      115500 -- (-2641.904) (-2640.135) [-2639.034] (-2639.922) * (-2641.425) (-2639.289) [-2640.925] (-2641.193) -- 0:01:01
      116000 -- (-2642.520) (-2640.116) [-2637.039] (-2641.928) * (-2638.507) (-2638.864) [-2640.816] (-2640.384) -- 0:01:00
      116500 -- (-2642.162) (-2640.621) (-2638.636) [-2640.736] * (-2640.592) (-2637.731) (-2654.228) [-2640.278] -- 0:01:00
      117000 -- [-2639.833] (-2640.264) (-2637.682) (-2640.736) * (-2640.074) (-2639.611) [-2639.776] (-2641.443) -- 0:01:00
      117500 -- (-2639.157) (-2640.273) [-2639.585] (-2640.870) * [-2640.921] (-2641.180) (-2642.553) (-2638.030) -- 0:01:07
      118000 -- (-2640.232) [-2639.886] (-2639.685) (-2640.425) * [-2639.780] (-2641.427) (-2642.783) (-2638.967) -- 0:01:07
      118500 -- [-2640.694] (-2642.332) (-2638.550) (-2641.873) * (-2645.128) [-2638.282] (-2642.641) (-2640.557) -- 0:01:06
      119000 -- [-2639.491] (-2640.282) (-2639.489) (-2638.835) * (-2639.373) [-2641.626] (-2643.349) (-2644.144) -- 0:01:06
      119500 -- (-2640.384) (-2641.547) [-2640.758] (-2640.215) * (-2638.780) [-2638.519] (-2647.061) (-2641.837) -- 0:01:06
      120000 -- (-2636.583) (-2641.662) (-2638.153) [-2639.618] * [-2640.388] (-2637.417) (-2640.249) (-2644.802) -- 0:01:06

      Average standard deviation of split frequencies: 0.018505

      120500 -- (-2637.539) [-2641.101] (-2639.271) (-2640.746) * [-2639.026] (-2643.277) (-2640.615) (-2644.399) -- 0:01:05
      121000 -- (-2638.126) [-2640.178] (-2639.985) (-2641.046) * [-2637.712] (-2640.271) (-2641.160) (-2640.232) -- 0:01:05
      121500 -- (-2640.099) (-2638.482) (-2638.761) [-2641.149] * (-2641.893) (-2639.890) [-2642.496] (-2639.561) -- 0:01:05
      122000 -- (-2641.896) (-2641.202) (-2639.668) [-2641.197] * [-2640.728] (-2637.635) (-2642.577) (-2641.045) -- 0:01:04
      122500 -- (-2642.763) [-2640.356] (-2640.675) (-2641.434) * [-2643.215] (-2640.351) (-2639.971) (-2640.227) -- 0:01:04
      123000 -- (-2640.397) [-2639.539] (-2639.154) (-2640.135) * (-2638.657) (-2637.279) [-2641.661] (-2641.502) -- 0:01:04
      123500 -- (-2640.391) (-2637.448) (-2642.008) [-2640.961] * (-2641.020) [-2640.331] (-2643.237) (-2638.603) -- 0:01:03
      124000 -- (-2644.759) (-2639.315) [-2637.461] (-2640.263) * (-2638.494) (-2641.513) (-2639.487) [-2639.113] -- 0:01:03
      124500 -- (-2643.852) (-2638.609) (-2643.430) [-2640.712] * (-2640.134) (-2641.848) (-2638.634) [-2639.772] -- 0:01:03
      125000 -- (-2639.739) [-2638.659] (-2640.325) (-2638.623) * (-2641.274) [-2640.282] (-2641.543) (-2637.763) -- 0:01:03

      Average standard deviation of split frequencies: 0.017210

      125500 -- [-2640.241] (-2640.893) (-2642.466) (-2640.984) * (-2640.253) [-2640.618] (-2639.935) (-2643.589) -- 0:01:02
      126000 -- [-2640.963] (-2638.526) (-2640.560) (-2641.014) * (-2640.340) (-2641.103) (-2641.329) [-2642.611] -- 0:01:02
      126500 -- (-2641.075) [-2641.589] (-2640.860) (-2641.273) * [-2637.404] (-2640.521) (-2642.608) (-2640.791) -- 0:01:02
      127000 -- [-2640.569] (-2641.197) (-2639.673) (-2640.822) * (-2637.378) (-2640.311) [-2640.950] (-2639.230) -- 0:01:01
      127500 -- (-2640.317) [-2642.910] (-2641.286) (-2642.548) * (-2639.824) (-2643.354) (-2640.742) [-2639.837] -- 0:01:01
      128000 -- [-2640.220] (-2640.921) (-2640.898) (-2641.421) * [-2639.792] (-2640.789) (-2640.390) (-2644.604) -- 0:01:01
      128500 -- [-2642.414] (-2643.828) (-2639.966) (-2640.343) * (-2637.982) [-2641.184] (-2640.963) (-2643.536) -- 0:01:01
      129000 -- (-2642.678) (-2637.910) (-2640.224) [-2640.321] * (-2638.410) [-2641.184] (-2644.732) (-2640.314) -- 0:01:00
      129500 -- (-2644.696) (-2641.428) (-2642.381) [-2640.303] * [-2638.614] (-2641.754) (-2643.081) (-2639.777) -- 0:01:00
      130000 -- [-2640.668] (-2639.208) (-2644.170) (-2640.046) * (-2640.419) (-2641.719) [-2639.813] (-2640.181) -- 0:01:00

      Average standard deviation of split frequencies: 0.019441

      130500 -- [-2640.727] (-2636.542) (-2642.426) (-2638.051) * (-2640.515) (-2644.840) (-2639.759) [-2640.103] -- 0:00:59
      131000 -- (-2642.955) [-2641.305] (-2644.231) (-2638.387) * (-2640.859) (-2646.556) (-2641.819) [-2639.593] -- 0:00:59
      131500 -- [-2644.359] (-2640.666) (-2637.904) (-2646.510) * (-2639.030) (-2642.009) [-2641.818] (-2640.264) -- 0:01:06
      132000 -- (-2640.892) [-2639.448] (-2639.319) (-2640.015) * [-2639.475] (-2640.926) (-2642.116) (-2641.837) -- 0:01:05
      132500 -- [-2640.569] (-2640.493) (-2638.001) (-2638.851) * (-2640.311) (-2641.716) [-2643.271] (-2640.570) -- 0:01:05
      133000 -- (-2639.428) (-2641.845) (-2639.865) [-2640.661] * (-2640.490) [-2640.002] (-2638.854) (-2640.046) -- 0:01:05
      133500 -- [-2637.987] (-2641.561) (-2641.067) (-2640.781) * (-2638.868) (-2640.310) (-2642.529) [-2637.952] -- 0:01:04
      134000 -- [-2638.173] (-2647.357) (-2642.754) (-2641.751) * [-2638.348] (-2640.075) (-2644.511) (-2638.461) -- 0:01:04
      134500 -- [-2641.963] (-2643.960) (-2641.038) (-2641.285) * (-2637.148) (-2640.354) [-2641.025] (-2639.040) -- 0:01:04
      135000 -- [-2642.033] (-2644.148) (-2641.366) (-2638.699) * (-2641.115) (-2638.638) (-2643.091) [-2638.578] -- 0:01:04

      Average standard deviation of split frequencies: 0.017149

      135500 -- (-2640.989) (-2641.173) [-2642.056] (-2640.175) * (-2640.508) (-2645.346) [-2644.106] (-2643.998) -- 0:01:03
      136000 -- (-2639.576) [-2642.240] (-2637.973) (-2640.562) * (-2643.804) (-2640.470) [-2641.640] (-2641.762) -- 0:01:03
      136500 -- (-2640.086) (-2639.337) [-2637.463] (-2641.113) * (-2639.771) [-2639.507] (-2640.951) (-2642.590) -- 0:01:03
      137000 -- [-2638.632] (-2642.248) (-2638.239) (-2639.497) * (-2639.816) (-2640.858) (-2643.264) [-2637.757] -- 0:01:02
      137500 -- (-2642.830) [-2639.782] (-2641.478) (-2642.335) * (-2641.609) (-2641.931) (-2643.832) [-2640.601] -- 0:01:02
      138000 -- (-2640.616) (-2639.546) (-2637.743) [-2637.361] * (-2639.468) [-2640.931] (-2642.479) (-2646.738) -- 0:01:02
      138500 -- (-2639.153) [-2641.448] (-2637.647) (-2639.591) * (-2643.403) [-2641.421] (-2639.722) (-2646.407) -- 0:01:02
      139000 -- (-2641.162) (-2640.030) [-2641.002] (-2640.191) * (-2639.305) (-2642.095) [-2640.344] (-2645.075) -- 0:01:01
      139500 -- (-2640.579) (-2640.536) [-2638.808] (-2640.119) * [-2640.417] (-2641.834) (-2640.743) (-2637.330) -- 0:01:01
      140000 -- (-2640.864) (-2640.957) [-2641.567] (-2640.759) * [-2640.636] (-2648.114) (-2643.246) (-2639.620) -- 0:01:01

      Average standard deviation of split frequencies: 0.018432

      140500 -- (-2641.283) (-2640.160) (-2639.879) [-2642.221] * (-2639.853) (-2644.183) (-2641.838) [-2640.717] -- 0:01:01
      141000 -- (-2643.610) (-2642.386) (-2641.176) [-2641.907] * [-2640.390] (-2641.954) (-2641.146) (-2642.611) -- 0:01:00
      141500 -- (-2640.908) [-2640.578] (-2641.287) (-2639.913) * (-2638.015) (-2640.908) (-2640.818) [-2640.572] -- 0:01:00
      142000 -- [-2642.966] (-2638.842) (-2640.027) (-2638.654) * (-2637.439) (-2639.375) [-2642.535] (-2638.295) -- 0:01:00
      142500 -- (-2638.578) [-2638.099] (-2640.340) (-2640.184) * (-2638.232) [-2639.169] (-2641.432) (-2638.992) -- 0:01:00
      143000 -- (-2642.018) (-2639.362) [-2642.886] (-2639.266) * (-2642.331) [-2638.411] (-2643.636) (-2641.530) -- 0:00:59
      143500 -- (-2642.735) [-2642.969] (-2641.996) (-2638.442) * (-2644.825) (-2641.056) [-2643.247] (-2640.122) -- 0:00:59
      144000 -- (-2639.819) [-2640.931] (-2646.075) (-2640.409) * (-2641.214) (-2642.593) (-2640.026) [-2639.987] -- 0:00:59
      144500 -- [-2637.826] (-2643.750) (-2642.449) (-2639.900) * (-2639.262) (-2639.052) (-2639.409) [-2639.829] -- 0:00:59
      145000 -- (-2642.495) [-2640.403] (-2640.678) (-2639.275) * (-2639.621) (-2638.175) (-2638.164) [-2640.859] -- 0:01:04

      Average standard deviation of split frequencies: 0.019696

      145500 -- (-2641.312) [-2640.661] (-2641.380) (-2637.473) * (-2640.075) (-2640.800) (-2641.823) [-2639.889] -- 0:01:04
      146000 -- (-2640.330) (-2641.947) [-2640.581] (-2638.752) * [-2640.805] (-2639.430) (-2639.717) (-2639.829) -- 0:01:04
      146500 -- (-2638.712) (-2640.778) (-2639.778) [-2639.447] * (-2642.038) [-2638.892] (-2638.733) (-2644.400) -- 0:01:04
      147000 -- [-2640.613] (-2640.953) (-2643.786) (-2639.959) * (-2642.041) (-2639.294) (-2639.637) [-2641.827] -- 0:01:03
      147500 -- (-2640.697) [-2642.360] (-2643.763) (-2638.526) * (-2641.575) (-2641.068) (-2638.849) [-2637.275] -- 0:01:03
      148000 -- [-2638.895] (-2639.830) (-2643.509) (-2637.389) * (-2640.036) (-2641.142) [-2638.950] (-2639.578) -- 0:01:03
      148500 -- [-2638.144] (-2643.181) (-2643.541) (-2640.082) * (-2640.278) (-2640.646) (-2638.082) [-2639.515] -- 0:01:03
      149000 -- (-2639.232) (-2641.497) [-2642.510] (-2638.563) * (-2647.011) (-2640.334) (-2639.492) [-2636.871] -- 0:01:02
      149500 -- [-2640.074] (-2648.670) (-2638.362) (-2638.186) * (-2643.779) (-2641.634) [-2639.953] (-2638.639) -- 0:01:02
      150000 -- [-2641.566] (-2645.490) (-2640.191) (-2643.161) * (-2642.886) (-2642.806) (-2640.206) [-2640.472] -- 0:01:02

      Average standard deviation of split frequencies: 0.019868

      150500 -- [-2638.410] (-2640.950) (-2640.174) (-2642.128) * (-2640.088) (-2639.662) (-2641.024) [-2644.408] -- 0:01:02
      151000 -- [-2639.641] (-2640.749) (-2645.614) (-2640.413) * (-2642.030) (-2640.612) [-2641.155] (-2642.673) -- 0:01:01
      151500 -- (-2639.584) (-2641.349) [-2641.227] (-2640.375) * (-2642.139) (-2641.849) (-2640.898) [-2645.540] -- 0:01:01
      152000 -- [-2637.473] (-2640.960) (-2641.162) (-2640.761) * (-2640.336) (-2643.290) [-2639.641] (-2643.433) -- 0:01:01
      152500 -- (-2638.232) (-2640.788) (-2643.132) [-2640.447] * (-2640.307) (-2647.167) (-2641.813) [-2639.858] -- 0:01:01
      153000 -- [-2638.990] (-2640.856) (-2641.252) (-2642.214) * (-2640.432) (-2645.633) [-2642.861] (-2640.662) -- 0:01:00
      153500 -- (-2640.609) [-2640.845] (-2641.537) (-2641.380) * [-2640.430] (-2647.668) (-2639.037) (-2639.531) -- 0:01:00
      154000 -- [-2641.202] (-2643.141) (-2638.757) (-2641.420) * (-2643.036) [-2642.879] (-2640.659) (-2638.460) -- 0:01:00
      154500 -- [-2642.959] (-2640.822) (-2640.731) (-2641.317) * [-2641.271] (-2643.032) (-2641.047) (-2639.871) -- 0:01:00
      155000 -- (-2641.383) (-2639.892) (-2642.528) [-2639.149] * (-2641.692) (-2644.142) (-2641.915) [-2637.925] -- 0:00:59

      Average standard deviation of split frequencies: 0.021297

      155500 -- [-2641.371] (-2640.320) (-2639.762) (-2639.893) * [-2642.311] (-2643.001) (-2642.443) (-2645.417) -- 0:00:59
      156000 -- (-2641.875) (-2645.466) (-2639.703) [-2641.278] * (-2640.743) [-2640.319] (-2641.929) (-2640.653) -- 0:00:59
      156500 -- (-2641.916) (-2644.657) [-2641.492] (-2643.254) * [-2639.524] (-2641.278) (-2644.867) (-2638.059) -- 0:00:59
      157000 -- (-2640.383) (-2643.003) (-2641.861) [-2641.969] * [-2638.848] (-2639.281) (-2643.411) (-2638.801) -- 0:00:59
      157500 -- (-2643.458) (-2643.294) (-2640.630) [-2643.659] * (-2640.315) (-2641.904) (-2642.505) [-2640.657] -- 0:00:58
      158000 -- [-2639.656] (-2641.934) (-2643.875) (-2645.536) * [-2639.688] (-2641.729) (-2647.926) (-2638.101) -- 0:00:58
      158500 -- (-2640.865) (-2642.406) [-2641.730] (-2638.752) * [-2640.626] (-2645.339) (-2643.305) (-2636.922) -- 0:01:03
      159000 -- (-2638.537) (-2642.128) [-2646.145] (-2640.432) * (-2642.246) (-2641.284) [-2642.473] (-2637.828) -- 0:01:03
      159500 -- (-2640.854) (-2642.974) (-2643.542) [-2641.366] * (-2642.223) (-2640.813) (-2641.513) [-2640.342] -- 0:01:03
      160000 -- (-2641.038) (-2641.978) (-2648.968) [-2642.674] * (-2641.379) (-2648.471) (-2640.662) [-2638.154] -- 0:01:02

      Average standard deviation of split frequencies: 0.021310

      160500 -- (-2641.151) (-2642.659) [-2642.449] (-2644.433) * (-2644.557) (-2638.716) [-2642.042] (-2638.468) -- 0:01:02
      161000 -- [-2639.808] (-2640.221) (-2641.824) (-2643.157) * (-2643.012) (-2640.794) [-2638.831] (-2638.761) -- 0:01:02
      161500 -- (-2639.102) (-2638.149) [-2642.722] (-2640.556) * (-2641.606) [-2643.071] (-2639.651) (-2637.586) -- 0:01:02
      162000 -- (-2637.814) (-2639.606) (-2639.838) [-2639.559] * (-2642.372) (-2646.190) [-2643.574] (-2639.339) -- 0:01:02
      162500 -- (-2638.032) (-2637.989) (-2639.968) [-2643.045] * (-2641.171) (-2645.386) [-2643.559] (-2639.683) -- 0:01:01
      163000 -- (-2645.222) [-2639.499] (-2638.884) (-2642.605) * (-2642.276) (-2641.860) [-2643.341] (-2636.885) -- 0:01:01
      163500 -- (-2641.227) [-2642.356] (-2639.278) (-2641.024) * (-2641.127) [-2638.629] (-2648.513) (-2638.527) -- 0:01:01
      164000 -- [-2640.178] (-2647.580) (-2641.137) (-2639.138) * (-2640.906) (-2638.203) (-2640.166) [-2637.946] -- 0:01:01
      164500 -- [-2640.311] (-2638.746) (-2643.619) (-2638.900) * (-2644.197) [-2637.762] (-2639.766) (-2639.682) -- 0:01:00
      165000 -- (-2640.221) [-2641.646] (-2640.483) (-2641.911) * (-2641.388) (-2641.577) [-2641.043] (-2639.367) -- 0:01:00

      Average standard deviation of split frequencies: 0.021907

      165500 -- (-2643.345) (-2642.302) [-2643.641] (-2641.748) * (-2639.241) [-2639.607] (-2642.318) (-2638.713) -- 0:01:00
      166000 -- [-2639.997] (-2643.228) (-2641.275) (-2639.553) * [-2639.567] (-2640.922) (-2641.501) (-2638.299) -- 0:01:00
      166500 -- [-2638.466] (-2639.505) (-2639.665) (-2640.945) * (-2638.553) (-2641.201) (-2641.401) [-2639.882] -- 0:01:00
      167000 -- (-2640.811) [-2639.597] (-2640.913) (-2639.863) * (-2638.990) (-2642.007) (-2640.914) [-2640.227] -- 0:00:59
      167500 -- [-2641.521] (-2638.301) (-2641.303) (-2641.916) * (-2640.203) (-2642.910) (-2640.711) [-2640.164] -- 0:00:59
      168000 -- (-2641.545) (-2639.854) (-2642.290) [-2645.841] * (-2640.086) (-2638.404) [-2640.596] (-2640.173) -- 0:00:59
      168500 -- (-2641.202) [-2637.253] (-2640.944) (-2647.053) * (-2638.943) (-2640.721) (-2640.622) [-2640.334] -- 0:00:59
      169000 -- (-2636.794) (-2642.038) [-2639.858] (-2642.150) * (-2638.438) [-2640.502] (-2640.494) (-2637.164) -- 0:00:59
      169500 -- (-2637.120) [-2642.478] (-2639.071) (-2641.677) * [-2639.434] (-2638.577) (-2641.263) (-2639.592) -- 0:00:58
      170000 -- (-2639.690) (-2642.656) (-2637.290) [-2639.971] * [-2645.154] (-2643.144) (-2641.314) (-2641.110) -- 0:00:58

      Average standard deviation of split frequencies: 0.019887

      170500 -- (-2637.159) (-2639.549) [-2639.753] (-2640.657) * [-2643.906] (-2643.976) (-2641.773) (-2643.446) -- 0:00:58
      171000 -- [-2637.305] (-2638.869) (-2640.196) (-2642.820) * (-2638.493) (-2644.013) (-2641.147) [-2644.074] -- 0:00:58
      171500 -- (-2639.806) (-2640.291) [-2639.741] (-2642.911) * [-2636.617] (-2644.574) (-2642.287) (-2642.716) -- 0:00:57
      172000 -- (-2640.811) [-2639.852] (-2640.785) (-2641.060) * (-2637.743) [-2645.657] (-2640.778) (-2644.553) -- 0:01:02
      172500 -- (-2640.970) (-2641.806) [-2639.077] (-2640.963) * (-2639.747) [-2644.234] (-2648.998) (-2641.120) -- 0:01:02
      173000 -- (-2641.594) (-2640.910) (-2638.511) [-2643.011] * (-2643.868) (-2643.909) (-2640.913) [-2643.889] -- 0:01:02
      173500 -- (-2639.160) (-2640.524) (-2640.159) [-2640.886] * [-2638.453] (-2642.219) (-2641.511) (-2640.742) -- 0:01:01
      174000 -- [-2638.723] (-2640.157) (-2638.576) (-2641.193) * (-2641.064) (-2641.460) [-2639.510] (-2639.236) -- 0:01:01
      174500 -- (-2638.076) [-2638.277] (-2641.046) (-2640.351) * [-2639.984] (-2639.848) (-2640.752) (-2640.153) -- 0:01:01
      175000 -- (-2639.183) (-2639.328) (-2639.368) [-2639.414] * (-2641.396) [-2642.080] (-2643.999) (-2640.014) -- 0:01:01

      Average standard deviation of split frequencies: 0.020490

      175500 -- [-2637.883] (-2646.322) (-2642.320) (-2643.842) * (-2639.655) (-2641.574) [-2641.417] (-2639.914) -- 0:01:01
      176000 -- [-2639.229] (-2639.096) (-2642.203) (-2641.549) * (-2638.966) (-2643.402) [-2641.200] (-2641.573) -- 0:01:00
      176500 -- (-2640.898) [-2639.770] (-2643.009) (-2641.859) * (-2642.131) (-2638.123) [-2640.683] (-2638.803) -- 0:01:00
      177000 -- [-2640.171] (-2639.973) (-2645.745) (-2644.017) * (-2643.929) [-2638.957] (-2640.103) (-2638.596) -- 0:01:00
      177500 -- (-2639.333) (-2639.729) [-2641.804] (-2644.939) * (-2639.966) (-2640.120) [-2641.025] (-2639.121) -- 0:01:00
      178000 -- (-2638.777) (-2639.087) [-2640.504] (-2642.988) * [-2638.947] (-2642.779) (-2639.673) (-2640.229) -- 0:01:00
      178500 -- (-2639.669) (-2640.130) [-2641.521] (-2643.180) * [-2637.537] (-2641.931) (-2639.734) (-2638.247) -- 0:00:59
      179000 -- (-2644.987) [-2640.874] (-2642.806) (-2639.569) * [-2637.505] (-2639.630) (-2640.190) (-2638.479) -- 0:00:59
      179500 -- (-2638.434) (-2642.062) [-2642.160] (-2640.642) * [-2639.750] (-2642.283) (-2640.983) (-2638.080) -- 0:00:59
      180000 -- (-2640.300) (-2644.775) [-2639.344] (-2641.988) * (-2639.444) (-2641.523) [-2639.353] (-2638.403) -- 0:00:59

      Average standard deviation of split frequencies: 0.021561

      180500 -- (-2639.538) (-2645.301) (-2639.717) [-2639.687] * (-2641.371) (-2638.157) [-2641.170] (-2638.347) -- 0:00:59
      181000 -- (-2642.059) (-2641.693) [-2639.453] (-2640.488) * [-2639.973] (-2646.069) (-2642.347) (-2637.098) -- 0:00:58
      181500 -- (-2639.758) (-2642.491) (-2640.422) [-2639.923] * (-2640.265) (-2643.397) [-2640.922] (-2638.406) -- 0:00:58
      182000 -- (-2638.796) [-2640.898] (-2639.668) (-2641.714) * [-2637.596] (-2641.041) (-2641.704) (-2638.414) -- 0:00:58
      182500 -- [-2639.046] (-2639.718) (-2638.402) (-2643.699) * (-2640.461) (-2641.804) [-2639.115] (-2638.359) -- 0:00:58
      183000 -- (-2637.654) (-2639.927) (-2640.955) [-2639.425] * (-2640.923) (-2642.466) (-2638.623) [-2639.206] -- 0:00:58
      183500 -- (-2640.237) [-2638.110] (-2639.245) (-2640.326) * (-2644.223) [-2640.521] (-2639.673) (-2640.392) -- 0:00:57
      184000 -- (-2639.476) [-2639.190] (-2642.046) (-2639.562) * [-2641.780] (-2640.924) (-2643.046) (-2640.759) -- 0:00:57
      184500 -- (-2640.014) (-2641.240) (-2644.016) [-2640.378] * (-2638.720) (-2639.056) [-2641.062] (-2640.621) -- 0:00:57
      185000 -- [-2641.159] (-2642.030) (-2643.754) (-2642.650) * [-2636.397] (-2637.697) (-2640.962) (-2642.046) -- 0:00:57

      Average standard deviation of split frequencies: 0.019672

      185500 -- [-2640.480] (-2645.408) (-2641.545) (-2642.649) * (-2638.406) [-2640.641] (-2640.825) (-2641.149) -- 0:01:01
      186000 -- [-2640.804] (-2643.353) (-2640.403) (-2641.878) * (-2644.480) (-2639.889) (-2640.825) [-2641.009] -- 0:01:01
      186500 -- (-2641.669) (-2645.818) [-2642.864] (-2642.079) * (-2643.725) [-2639.607] (-2641.460) (-2642.146) -- 0:01:01
      187000 -- (-2641.109) (-2642.692) (-2640.515) [-2640.702] * (-2642.496) (-2641.002) (-2640.213) [-2641.503] -- 0:01:00
      187500 -- (-2645.176) (-2642.668) [-2640.620] (-2640.692) * (-2639.513) (-2642.311) (-2652.679) [-2641.879] -- 0:01:00
      188000 -- [-2638.333] (-2640.028) (-2640.545) (-2641.799) * (-2641.574) (-2643.240) [-2644.249] (-2641.344) -- 0:01:00
      188500 -- [-2638.967] (-2638.346) (-2644.210) (-2639.827) * [-2638.975] (-2638.969) (-2641.395) (-2643.488) -- 0:01:00
      189000 -- (-2641.571) (-2640.937) (-2642.481) [-2638.250] * [-2639.896] (-2639.608) (-2640.332) (-2643.030) -- 0:01:00
      189500 -- (-2641.805) (-2640.172) (-2641.827) [-2642.075] * (-2636.586) [-2640.038] (-2640.095) (-2640.461) -- 0:00:59
      190000 -- (-2641.672) (-2640.472) [-2639.480] (-2642.159) * [-2637.189] (-2642.119) (-2640.141) (-2641.154) -- 0:00:59

      Average standard deviation of split frequencies: 0.019532

      190500 -- (-2643.686) (-2642.938) [-2640.272] (-2641.564) * [-2637.708] (-2641.007) (-2640.034) (-2642.750) -- 0:00:59
      191000 -- (-2641.436) (-2640.046) [-2639.563] (-2641.671) * (-2637.753) (-2639.813) (-2640.385) [-2641.188] -- 0:00:59
      191500 -- [-2639.502] (-2637.486) (-2639.319) (-2644.156) * (-2638.218) [-2641.800] (-2638.861) (-2641.595) -- 0:00:59
      192000 -- (-2640.057) [-2639.993] (-2641.503) (-2642.548) * (-2640.196) (-2639.005) [-2638.278] (-2640.465) -- 0:00:58
      192500 -- (-2639.169) [-2638.491] (-2641.667) (-2641.928) * [-2641.087] (-2642.227) (-2639.334) (-2641.083) -- 0:00:58
      193000 -- [-2640.022] (-2640.351) (-2641.677) (-2642.173) * (-2639.412) (-2642.218) [-2641.475] (-2640.191) -- 0:00:58
      193500 -- [-2640.478] (-2638.014) (-2642.411) (-2646.876) * (-2639.488) (-2642.726) (-2643.896) [-2638.892] -- 0:00:58
      194000 -- [-2639.340] (-2638.397) (-2645.188) (-2642.192) * (-2639.669) (-2639.134) (-2643.044) [-2639.817] -- 0:00:58
      194500 -- (-2641.465) (-2640.103) (-2642.654) [-2641.130] * [-2639.564] (-2640.596) (-2643.233) (-2642.108) -- 0:00:57
      195000 -- [-2640.796] (-2641.571) (-2644.917) (-2639.930) * [-2637.906] (-2640.769) (-2643.522) (-2641.848) -- 0:00:57

      Average standard deviation of split frequencies: 0.018783

      195500 -- (-2640.572) (-2643.925) [-2640.685] (-2639.475) * (-2638.877) [-2638.666] (-2642.022) (-2642.983) -- 0:00:57
      196000 -- (-2642.421) (-2643.435) (-2640.094) [-2639.717] * (-2638.515) (-2642.075) [-2637.666] (-2637.400) -- 0:00:57
      196500 -- (-2639.971) (-2640.825) [-2640.113] (-2639.631) * (-2640.911) [-2641.437] (-2639.902) (-2643.156) -- 0:00:57
      197000 -- (-2644.845) (-2641.100) [-2640.946] (-2639.092) * [-2640.968] (-2640.344) (-2641.334) (-2640.298) -- 0:00:57
      197500 -- (-2643.216) [-2641.456] (-2642.846) (-2639.652) * (-2640.023) (-2641.700) [-2639.990] (-2641.388) -- 0:00:56
      198000 -- (-2643.780) (-2641.095) (-2641.395) [-2638.968] * (-2639.911) [-2641.053] (-2638.365) (-2640.729) -- 0:00:56
      198500 -- (-2641.403) (-2643.442) [-2639.012] (-2639.023) * (-2640.247) (-2644.787) [-2640.022] (-2641.297) -- 0:00:56
      199000 -- (-2641.644) (-2640.161) (-2644.011) [-2639.665] * [-2639.816] (-2644.482) (-2638.471) (-2639.623) -- 0:00:56
      199500 -- (-2640.833) (-2640.251) (-2640.249) [-2638.480] * [-2639.921] (-2640.400) (-2640.518) (-2637.892) -- 0:01:00
      200000 -- [-2639.258] (-2642.429) (-2643.881) (-2638.657) * [-2639.727] (-2644.802) (-2637.178) (-2640.773) -- 0:00:59

      Average standard deviation of split frequencies: 0.018794

      200500 -- [-2638.002] (-2642.853) (-2641.704) (-2639.688) * (-2642.483) (-2643.146) [-2638.791] (-2640.538) -- 0:00:59
      201000 -- (-2639.444) (-2640.510) (-2640.148) [-2641.741] * (-2641.543) [-2640.837] (-2639.756) (-2640.700) -- 0:00:59
      201500 -- (-2639.571) (-2644.408) (-2637.397) [-2641.390] * (-2638.823) [-2640.988] (-2643.888) (-2641.472) -- 0:00:59
      202000 -- (-2639.503) (-2644.489) [-2637.739] (-2648.341) * (-2645.164) (-2640.642) [-2637.812] (-2643.222) -- 0:00:59
      202500 -- [-2639.852] (-2643.891) (-2637.331) (-2641.538) * (-2644.520) [-2639.323] (-2638.470) (-2641.692) -- 0:00:59
      203000 -- (-2640.330) [-2640.045] (-2637.351) (-2643.722) * (-2645.735) [-2637.594] (-2638.004) (-2640.192) -- 0:00:58
      203500 -- [-2640.420] (-2644.662) (-2642.226) (-2642.543) * (-2641.647) [-2641.184] (-2638.434) (-2640.034) -- 0:00:58
      204000 -- (-2640.126) (-2642.480) [-2636.879] (-2642.292) * (-2641.262) (-2645.311) (-2640.078) [-2640.834] -- 0:00:58
      204500 -- (-2640.511) (-2643.341) (-2639.814) [-2639.100] * (-2643.744) (-2643.119) [-2638.551] (-2641.125) -- 0:00:58
      205000 -- (-2640.706) [-2638.823] (-2639.108) (-2640.093) * (-2640.438) (-2641.240) [-2639.446] (-2640.077) -- 0:00:58

      Average standard deviation of split frequencies: 0.019150

      205500 -- [-2640.637] (-2642.138) (-2639.627) (-2640.243) * (-2643.243) (-2640.276) (-2639.920) [-2642.968] -- 0:00:57
      206000 -- [-2640.311] (-2638.800) (-2639.931) (-2639.802) * [-2641.735] (-2644.098) (-2641.843) (-2642.714) -- 0:00:57
      206500 -- (-2642.193) [-2637.893] (-2638.140) (-2643.262) * (-2642.121) (-2643.679) [-2639.659] (-2640.511) -- 0:00:57
      207000 -- (-2640.446) (-2638.934) [-2638.425] (-2645.297) * (-2644.919) (-2644.898) [-2639.201] (-2641.697) -- 0:00:57
      207500 -- (-2641.930) (-2641.211) [-2637.914] (-2645.364) * (-2647.514) (-2642.082) (-2640.044) [-2639.986] -- 0:00:57
      208000 -- (-2640.668) [-2640.908] (-2638.205) (-2638.008) * (-2649.237) (-2643.888) (-2642.960) [-2640.137] -- 0:00:57
      208500 -- [-2640.610] (-2641.745) (-2638.263) (-2636.923) * [-2649.295] (-2641.977) (-2642.805) (-2643.263) -- 0:00:56
      209000 -- (-2640.636) [-2640.419] (-2638.729) (-2639.509) * (-2640.677) (-2643.673) [-2639.040] (-2641.185) -- 0:00:56
      209500 -- [-2640.121] (-2644.594) (-2639.831) (-2637.947) * (-2641.981) (-2644.494) [-2640.932] (-2642.167) -- 0:00:56
      210000 -- (-2639.185) [-2640.322] (-2644.506) (-2636.870) * [-2642.082] (-2641.761) (-2640.635) (-2642.203) -- 0:00:56

      Average standard deviation of split frequencies: 0.018434

      210500 -- (-2640.931) [-2639.316] (-2639.928) (-2640.930) * (-2642.893) [-2641.304] (-2639.787) (-2642.611) -- 0:00:56
      211000 -- (-2641.280) (-2639.581) (-2640.565) [-2643.618] * (-2644.904) (-2641.877) [-2639.445] (-2642.314) -- 0:00:56
      211500 -- (-2641.173) [-2639.784] (-2641.677) (-2644.510) * (-2644.306) [-2641.629] (-2637.842) (-2641.483) -- 0:00:59
      212000 -- (-2642.820) [-2639.873] (-2639.938) (-2640.379) * (-2644.613) (-2642.781) (-2640.082) [-2641.427] -- 0:00:59
      212500 -- (-2641.334) (-2643.204) (-2637.706) [-2638.180] * (-2642.731) (-2639.261) (-2641.559) [-2638.672] -- 0:00:59
      213000 -- (-2641.570) (-2643.204) (-2637.530) [-2639.477] * (-2639.791) [-2638.263] (-2642.093) (-2638.467) -- 0:00:59
      213500 -- (-2645.354) (-2642.047) (-2640.361) [-2639.421] * [-2640.617] (-2639.189) (-2641.560) (-2638.408) -- 0:00:58
      214000 -- [-2642.264] (-2643.035) (-2639.960) (-2641.521) * (-2640.289) (-2640.515) [-2640.016] (-2639.097) -- 0:00:58
      214500 -- [-2643.424] (-2642.038) (-2642.032) (-2641.798) * (-2640.603) (-2639.858) (-2639.681) [-2637.718] -- 0:00:58
      215000 -- (-2640.899) (-2641.651) (-2643.324) [-2641.114] * (-2639.910) (-2639.897) [-2639.018] (-2638.388) -- 0:00:58

      Average standard deviation of split frequencies: 0.019424

      215500 -- (-2641.928) (-2641.117) [-2639.891] (-2640.556) * [-2640.353] (-2640.066) (-2637.655) (-2640.400) -- 0:00:58
      216000 -- (-2641.052) [-2639.942] (-2641.007) (-2642.102) * (-2639.872) [-2639.925] (-2638.763) (-2640.775) -- 0:00:58
      216500 -- [-2645.821] (-2640.148) (-2641.799) (-2642.074) * (-2639.901) (-2641.191) (-2639.074) [-2639.817] -- 0:00:57
      217000 -- (-2641.249) (-2639.591) (-2639.162) [-2642.224] * (-2641.621) (-2640.091) (-2639.009) [-2642.287] -- 0:00:57
      217500 -- (-2640.275) (-2637.359) [-2638.621] (-2640.391) * (-2641.914) (-2641.657) [-2639.233] (-2638.939) -- 0:00:57
      218000 -- [-2640.766] (-2640.128) (-2641.375) (-2639.428) * (-2642.624) (-2642.134) [-2641.947] (-2640.715) -- 0:00:57
      218500 -- (-2643.369) (-2640.035) [-2638.549] (-2639.149) * (-2644.284) (-2642.119) [-2644.248] (-2641.245) -- 0:00:57
      219000 -- (-2647.336) [-2640.262] (-2639.699) (-2642.026) * (-2648.380) (-2638.826) (-2638.965) [-2642.093] -- 0:00:57
      219500 -- (-2646.400) [-2639.410] (-2639.538) (-2639.195) * (-2639.961) (-2644.765) (-2639.392) [-2643.617] -- 0:00:56
      220000 -- (-2645.783) [-2642.344] (-2637.810) (-2641.150) * (-2639.919) (-2640.096) [-2638.156] (-2639.123) -- 0:00:56

      Average standard deviation of split frequencies: 0.018327

      220500 -- (-2641.374) (-2642.168) (-2640.095) [-2638.411] * (-2639.945) (-2641.249) [-2641.834] (-2649.287) -- 0:00:56
      221000 -- (-2640.435) (-2641.997) [-2638.461] (-2639.103) * [-2642.295] (-2639.495) (-2640.684) (-2646.197) -- 0:00:56
      221500 -- (-2639.790) [-2640.377] (-2640.305) (-2643.530) * (-2643.897) (-2641.305) [-2641.281] (-2643.057) -- 0:00:56
      222000 -- (-2640.721) [-2641.475] (-2636.803) (-2642.235) * (-2644.543) (-2639.917) (-2640.562) [-2641.615] -- 0:00:56
      222500 -- (-2643.739) [-2642.103] (-2637.396) (-2641.488) * (-2646.383) (-2645.053) [-2635.929] (-2642.464) -- 0:00:55
      223000 -- (-2642.770) [-2641.741] (-2641.662) (-2639.653) * (-2643.643) (-2643.653) (-2638.201) [-2641.570] -- 0:00:55
      223500 -- [-2642.637] (-2638.681) (-2641.666) (-2640.154) * (-2642.820) (-2641.803) (-2637.122) [-2643.821] -- 0:00:55
      224000 -- (-2641.254) (-2638.992) [-2643.065] (-2638.442) * (-2644.207) (-2640.658) [-2639.450] (-2640.593) -- 0:00:55
      224500 -- [-2640.696] (-2640.820) (-2643.553) (-2638.256) * [-2641.521] (-2643.661) (-2640.601) (-2639.291) -- 0:00:55
      225000 -- (-2640.365) (-2637.974) (-2639.676) [-2639.931] * (-2645.213) (-2642.503) [-2637.433] (-2640.791) -- 0:00:58

      Average standard deviation of split frequencies: 0.018877

      225500 -- (-2639.453) [-2638.349] (-2640.375) (-2641.773) * (-2648.332) (-2640.172) (-2637.642) [-2638.256] -- 0:00:58
      226000 -- [-2639.337] (-2641.890) (-2641.824) (-2639.343) * [-2641.343] (-2641.996) (-2644.819) (-2637.212) -- 0:00:58
      226500 -- (-2643.520) [-2639.875] (-2640.343) (-2638.596) * (-2642.821) (-2643.006) (-2639.308) [-2638.399] -- 0:00:58
      227000 -- (-2640.536) (-2639.787) (-2642.347) [-2642.198] * (-2639.406) (-2642.061) [-2641.166] (-2638.279) -- 0:00:57
      227500 -- (-2639.069) (-2639.676) [-2643.928] (-2640.334) * (-2641.110) (-2641.874) (-2637.584) [-2638.950] -- 0:00:57
      228000 -- (-2642.246) (-2639.832) [-2640.669] (-2641.256) * [-2639.483] (-2640.092) (-2639.758) (-2642.431) -- 0:00:57
      228500 -- [-2638.228] (-2640.421) (-2639.252) (-2637.511) * [-2639.334] (-2640.180) (-2641.450) (-2643.071) -- 0:00:57
      229000 -- [-2640.116] (-2640.706) (-2640.047) (-2639.545) * (-2637.947) [-2640.554] (-2641.092) (-2640.148) -- 0:00:57
      229500 -- (-2639.405) (-2640.335) [-2639.730] (-2640.878) * (-2639.342) (-2643.662) [-2642.265] (-2641.331) -- 0:00:57
      230000 -- (-2640.858) (-2640.390) (-2639.730) [-2641.031] * (-2638.715) (-2640.960) (-2642.260) [-2638.728] -- 0:00:56

      Average standard deviation of split frequencies: 0.019463

      230500 -- (-2641.293) (-2642.007) [-2644.254] (-2641.883) * [-2639.360] (-2644.183) (-2639.639) (-2639.747) -- 0:00:56
      231000 -- (-2640.334) [-2638.921] (-2641.624) (-2641.975) * (-2639.127) (-2641.669) (-2639.781) [-2639.243] -- 0:00:56
      231500 -- (-2640.344) (-2639.397) [-2641.313] (-2643.355) * (-2638.550) [-2639.690] (-2641.585) (-2639.777) -- 0:00:56
      232000 -- (-2640.137) (-2640.618) [-2640.320] (-2642.557) * [-2641.030] (-2642.418) (-2640.305) (-2639.244) -- 0:00:56
      232500 -- (-2641.287) (-2638.676) [-2641.427] (-2641.416) * (-2642.952) (-2641.039) [-2638.328] (-2639.022) -- 0:00:56
      233000 -- [-2640.618] (-2639.842) (-2643.191) (-2640.954) * [-2642.611] (-2642.937) (-2642.538) (-2640.962) -- 0:00:55
      233500 -- (-2641.821) (-2641.811) [-2641.848] (-2640.084) * [-2642.089] (-2644.892) (-2638.109) (-2639.828) -- 0:00:55
      234000 -- (-2640.665) (-2643.308) (-2640.139) [-2642.646] * (-2641.786) (-2642.111) (-2639.547) [-2639.762] -- 0:00:55
      234500 -- [-2640.052] (-2644.409) (-2641.656) (-2639.572) * (-2639.906) (-2645.935) [-2640.118] (-2638.912) -- 0:00:55
      235000 -- (-2640.781) (-2643.389) (-2641.382) [-2639.603] * (-2641.454) (-2641.031) [-2642.446] (-2640.449) -- 0:00:55

      Average standard deviation of split frequencies: 0.017557

      235500 -- (-2640.270) (-2641.512) (-2641.910) [-2638.815] * (-2641.166) (-2643.540) (-2640.819) [-2639.718] -- 0:00:55
      236000 -- [-2641.238] (-2641.926) (-2640.361) (-2639.137) * (-2641.271) (-2642.090) [-2638.136] (-2641.069) -- 0:00:55
      236500 -- (-2642.389) (-2641.454) [-2640.775] (-2641.060) * (-2639.078) (-2637.732) (-2637.519) [-2637.579] -- 0:00:54
      237000 -- (-2643.132) (-2639.569) (-2641.643) [-2640.398] * (-2639.789) [-2639.697] (-2640.443) (-2637.544) -- 0:00:57
      237500 -- [-2641.244] (-2640.174) (-2645.821) (-2640.578) * [-2638.781] (-2644.031) (-2640.116) (-2639.349) -- 0:00:57
      238000 -- (-2642.416) [-2639.306] (-2642.318) (-2640.695) * (-2638.373) [-2641.023] (-2641.888) (-2640.430) -- 0:00:57
      238500 -- (-2644.891) [-2640.011] (-2640.062) (-2638.317) * (-2639.746) (-2640.141) (-2641.295) [-2641.612] -- 0:00:57
      239000 -- (-2642.358) (-2639.400) [-2639.555] (-2637.190) * [-2639.777] (-2640.736) (-2645.311) (-2641.909) -- 0:00:57
      239500 -- (-2638.654) (-2642.067) (-2638.908) [-2641.131] * [-2639.364] (-2641.145) (-2644.149) (-2643.279) -- 0:00:57
      240000 -- (-2639.240) (-2642.035) (-2642.202) [-2637.658] * (-2643.370) (-2641.890) (-2641.295) [-2642.809] -- 0:00:56

      Average standard deviation of split frequencies: 0.016541

      240500 -- [-2640.173] (-2640.255) (-2640.036) (-2639.163) * (-2641.576) (-2643.451) (-2640.876) [-2642.965] -- 0:00:56
      241000 -- (-2642.029) (-2638.968) (-2637.842) [-2644.293] * (-2639.670) (-2637.425) (-2639.619) [-2638.764] -- 0:00:56
      241500 -- (-2641.803) (-2639.753) [-2641.031] (-2642.719) * (-2639.217) (-2638.752) [-2638.447] (-2641.318) -- 0:00:56
      242000 -- (-2643.279) (-2640.048) (-2638.426) [-2641.112] * (-2642.887) (-2640.258) (-2637.768) [-2643.086] -- 0:00:56
      242500 -- [-2640.076] (-2642.924) (-2638.766) (-2641.541) * [-2644.352] (-2646.416) (-2638.788) (-2642.631) -- 0:00:56
      243000 -- [-2641.239] (-2640.623) (-2639.977) (-2640.672) * (-2643.040) (-2641.135) (-2638.836) [-2642.452] -- 0:00:56
      243500 -- (-2641.294) (-2640.883) [-2641.441] (-2642.270) * [-2642.156] (-2640.680) (-2639.897) (-2640.883) -- 0:00:55
      244000 -- [-2639.843] (-2640.292) (-2642.856) (-2642.401) * (-2638.850) (-2637.387) (-2639.629) [-2641.779] -- 0:00:55
      244500 -- [-2645.062] (-2643.828) (-2640.139) (-2643.444) * (-2640.051) [-2637.972] (-2639.585) (-2643.414) -- 0:00:55
      245000 -- (-2641.947) [-2643.176] (-2642.571) (-2641.931) * [-2641.818] (-2641.387) (-2641.508) (-2641.836) -- 0:00:55

      Average standard deviation of split frequencies: 0.014624

      245500 -- [-2639.321] (-2639.426) (-2639.970) (-2639.975) * [-2641.229] (-2641.836) (-2641.355) (-2638.695) -- 0:00:55
      246000 -- [-2640.297] (-2643.871) (-2645.494) (-2644.080) * [-2641.113] (-2640.458) (-2640.647) (-2638.788) -- 0:00:55
      246500 -- (-2645.015) (-2640.452) (-2643.627) [-2641.927] * (-2641.542) (-2642.433) [-2640.178] (-2643.160) -- 0:00:55
      247000 -- [-2639.466] (-2640.530) (-2641.591) (-2638.219) * (-2639.989) [-2642.043] (-2639.519) (-2642.704) -- 0:00:54
      247500 -- [-2641.467] (-2638.541) (-2638.428) (-2640.933) * [-2640.327] (-2640.548) (-2641.242) (-2641.412) -- 0:00:54
      248000 -- (-2640.723) (-2638.633) [-2641.211] (-2642.095) * [-2641.343] (-2643.627) (-2640.251) (-2641.883) -- 0:00:54
      248500 -- (-2640.163) (-2641.069) (-2641.589) [-2638.530] * (-2639.828) (-2643.308) [-2640.098] (-2641.095) -- 0:00:54
      249000 -- (-2645.648) (-2643.645) (-2638.278) [-2638.424] * (-2639.828) (-2641.868) [-2640.133] (-2639.836) -- 0:00:57
      249500 -- [-2641.494] (-2641.010) (-2640.298) (-2640.519) * (-2640.018) (-2639.917) (-2639.512) [-2642.476] -- 0:00:57
      250000 -- (-2641.262) [-2637.727] (-2640.609) (-2640.834) * (-2642.352) (-2641.038) (-2638.430) [-2640.508] -- 0:00:57

      Average standard deviation of split frequencies: 0.014669

      250500 -- (-2638.572) [-2637.762] (-2642.918) (-2640.802) * [-2643.088] (-2639.980) (-2639.383) (-2641.250) -- 0:00:56
      251000 -- (-2638.771) [-2640.249] (-2639.120) (-2641.841) * [-2640.622] (-2641.799) (-2639.142) (-2640.074) -- 0:00:56
      251500 -- (-2637.461) (-2640.070) [-2638.186] (-2640.620) * (-2640.902) (-2640.555) (-2639.231) [-2639.072] -- 0:00:56
      252000 -- [-2636.939] (-2641.384) (-2643.396) (-2639.273) * [-2639.156] (-2642.912) (-2640.973) (-2641.464) -- 0:00:56
      252500 -- (-2640.398) (-2643.758) [-2643.937] (-2640.064) * (-2639.142) (-2640.967) [-2639.799] (-2642.098) -- 0:00:56
      253000 -- (-2639.248) [-2641.619] (-2640.368) (-2641.729) * [-2639.744] (-2640.500) (-2643.000) (-2643.157) -- 0:00:56
      253500 -- [-2639.206] (-2642.945) (-2640.440) (-2639.361) * (-2642.143) (-2641.581) (-2643.533) [-2641.656] -- 0:00:55
      254000 -- (-2639.582) (-2643.155) (-2641.075) [-2639.318] * [-2640.049] (-2640.544) (-2645.383) (-2640.703) -- 0:00:55
      254500 -- [-2640.210] (-2639.828) (-2639.808) (-2639.891) * (-2641.885) [-2644.095] (-2643.758) (-2641.112) -- 0:00:55
      255000 -- [-2638.487] (-2641.192) (-2640.175) (-2643.380) * [-2637.971] (-2642.711) (-2643.855) (-2641.192) -- 0:00:55

      Average standard deviation of split frequencies: 0.015507

      255500 -- [-2641.560] (-2641.089) (-2639.599) (-2644.105) * (-2640.459) (-2642.429) (-2638.426) [-2641.268] -- 0:00:55
      256000 -- [-2640.576] (-2646.581) (-2642.650) (-2643.265) * [-2642.317] (-2642.098) (-2640.335) (-2640.773) -- 0:00:55
      256500 -- (-2641.589) (-2638.896) [-2642.561] (-2642.159) * (-2640.546) (-2642.254) [-2642.031] (-2641.149) -- 0:00:55
      257000 -- (-2639.524) (-2641.461) (-2644.203) [-2637.977] * [-2638.367] (-2640.348) (-2641.098) (-2641.119) -- 0:00:54
      257500 -- (-2639.931) (-2642.023) (-2645.178) [-2643.307] * (-2639.176) [-2641.791] (-2639.992) (-2640.384) -- 0:00:54
      258000 -- [-2639.409] (-2641.596) (-2643.204) (-2640.308) * (-2638.680) (-2645.303) (-2642.487) [-2640.482] -- 0:00:54
      258500 -- (-2639.835) (-2640.713) (-2642.707) [-2639.984] * (-2640.861) [-2643.758] (-2639.995) (-2642.726) -- 0:00:54
      259000 -- (-2643.440) (-2640.830) (-2641.487) [-2639.046] * (-2640.758) (-2643.316) [-2639.910] (-2641.774) -- 0:00:54
      259500 -- [-2641.146] (-2640.567) (-2640.393) (-2638.318) * [-2640.936] (-2643.058) (-2640.146) (-2641.177) -- 0:00:54
      260000 -- [-2642.996] (-2645.816) (-2643.246) (-2638.449) * [-2639.125] (-2641.066) (-2638.301) (-2641.626) -- 0:00:54

      Average standard deviation of split frequencies: 0.016276

      260500 -- (-2640.375) (-2640.579) [-2639.971] (-2638.715) * [-2638.689] (-2641.047) (-2641.418) (-2640.399) -- 0:00:53
      261000 -- (-2640.375) [-2641.502] (-2640.407) (-2638.494) * (-2641.200) (-2640.566) (-2639.622) [-2639.192] -- 0:00:56
      261500 -- (-2640.832) (-2644.912) [-2640.988] (-2636.844) * (-2642.146) (-2640.787) [-2640.937] (-2638.867) -- 0:00:56
      262000 -- (-2637.593) [-2639.126] (-2641.538) (-2640.024) * (-2644.187) [-2639.935] (-2638.980) (-2639.663) -- 0:00:56
      262500 -- (-2638.178) (-2639.655) (-2641.883) [-2642.279] * [-2642.311] (-2638.599) (-2638.474) (-2641.966) -- 0:00:56
      263000 -- (-2642.327) (-2639.886) (-2640.009) [-2644.939] * [-2640.157] (-2637.526) (-2641.794) (-2640.868) -- 0:00:56
      263500 -- [-2640.689] (-2640.956) (-2638.608) (-2641.239) * (-2640.552) [-2642.069] (-2638.803) (-2640.117) -- 0:00:55
      264000 -- [-2639.321] (-2639.162) (-2643.490) (-2641.612) * (-2637.879) (-2641.340) [-2640.110] (-2644.017) -- 0:00:55
      264500 -- (-2638.102) (-2640.266) [-2641.014] (-2640.168) * [-2639.439] (-2645.040) (-2642.216) (-2644.632) -- 0:00:55
      265000 -- (-2638.491) [-2636.945] (-2643.115) (-2640.824) * (-2640.622) (-2639.673) (-2639.451) [-2641.209] -- 0:00:55

      Average standard deviation of split frequencies: 0.016287

      265500 -- [-2640.352] (-2637.064) (-2642.125) (-2644.686) * [-2640.044] (-2636.359) (-2639.717) (-2640.214) -- 0:00:55
      266000 -- [-2638.873] (-2637.180) (-2641.403) (-2645.281) * (-2639.054) (-2638.633) (-2639.512) [-2643.491] -- 0:00:55
      266500 -- (-2638.744) [-2639.686] (-2639.530) (-2641.106) * (-2640.687) [-2638.600] (-2639.375) (-2642.764) -- 0:00:55
      267000 -- (-2638.705) (-2641.924) [-2639.604] (-2640.242) * [-2643.483] (-2639.400) (-2640.102) (-2642.492) -- 0:00:54
      267500 -- (-2644.286) [-2640.326] (-2640.445) (-2639.247) * (-2647.313) (-2640.546) [-2639.833] (-2644.658) -- 0:00:54
      268000 -- (-2642.085) (-2639.707) (-2643.445) [-2641.215] * (-2643.318) (-2639.373) [-2641.263] (-2641.059) -- 0:00:54
      268500 -- (-2640.609) (-2639.468) [-2642.369] (-2644.673) * [-2637.916] (-2642.624) (-2639.787) (-2640.801) -- 0:00:54
      269000 -- [-2639.263] (-2642.350) (-2644.429) (-2641.024) * (-2642.071) (-2640.403) [-2640.635] (-2642.798) -- 0:00:54
      269500 -- (-2640.773) (-2640.844) (-2644.313) [-2638.770] * (-2637.642) [-2641.348] (-2638.752) (-2643.905) -- 0:00:54
      270000 -- (-2640.886) (-2639.996) (-2639.819) [-2640.408] * [-2638.071] (-2641.975) (-2638.069) (-2640.686) -- 0:00:54

      Average standard deviation of split frequencies: 0.016225

      270500 -- (-2641.350) (-2639.807) [-2638.887] (-2643.764) * (-2640.092) (-2643.064) [-2641.596] (-2640.630) -- 0:00:53
      271000 -- (-2640.297) (-2642.492) [-2638.370] (-2640.590) * (-2639.366) (-2641.741) [-2640.166] (-2639.890) -- 0:00:53
      271500 -- (-2639.829) [-2644.651] (-2643.615) (-2639.973) * (-2640.922) [-2641.459] (-2638.608) (-2639.643) -- 0:00:53
      272000 -- (-2640.303) (-2644.914) (-2642.543) [-2640.146] * [-2641.044] (-2641.741) (-2638.012) (-2640.354) -- 0:00:53
      272500 -- [-2640.741] (-2639.800) (-2642.329) (-2639.319) * (-2641.381) (-2642.379) (-2638.175) [-2640.727] -- 0:00:53
      273000 -- (-2644.050) [-2639.148] (-2641.219) (-2642.104) * (-2642.740) (-2642.041) (-2639.907) [-2640.527] -- 0:00:55
      273500 -- (-2642.197) [-2645.112] (-2642.933) (-2638.717) * (-2640.080) [-2642.445] (-2643.697) (-2641.518) -- 0:00:55
      274000 -- (-2643.804) [-2640.645] (-2640.182) (-2640.407) * (-2638.811) (-2641.374) [-2639.545] (-2640.413) -- 0:00:55
      274500 -- (-2637.903) (-2642.968) (-2640.634) [-2640.163] * (-2639.623) (-2641.326) (-2640.192) [-2640.787] -- 0:00:55
      275000 -- (-2636.819) (-2643.141) (-2640.614) [-2640.278] * [-2638.185] (-2639.545) (-2641.766) (-2639.987) -- 0:00:55

      Average standard deviation of split frequencies: 0.016720

      275500 -- [-2638.080] (-2641.943) (-2639.981) (-2641.907) * (-2640.511) (-2640.453) (-2646.690) [-2640.122] -- 0:00:55
      276000 -- (-2638.297) [-2639.938] (-2642.135) (-2640.520) * [-2639.422] (-2640.456) (-2642.435) (-2640.600) -- 0:00:55
      276500 -- [-2641.430] (-2641.085) (-2642.349) (-2639.810) * [-2639.414] (-2642.389) (-2640.228) (-2638.684) -- 0:00:54
      277000 -- [-2641.354] (-2641.370) (-2639.781) (-2641.969) * (-2643.603) (-2641.311) [-2638.903] (-2642.583) -- 0:00:54
      277500 -- (-2637.359) (-2638.571) (-2637.984) [-2640.861] * (-2650.250) (-2640.663) [-2640.175] (-2640.353) -- 0:00:54
      278000 -- [-2638.715] (-2641.417) (-2639.955) (-2642.629) * (-2644.409) (-2639.026) [-2639.608] (-2640.330) -- 0:00:54
      278500 -- (-2642.670) (-2639.977) [-2640.412] (-2641.365) * (-2642.425) (-2640.773) (-2642.503) [-2643.295] -- 0:00:54
      279000 -- (-2644.321) [-2640.006] (-2643.494) (-2640.638) * (-2638.850) [-2641.792] (-2640.051) (-2640.657) -- 0:00:54
      279500 -- (-2649.323) [-2640.754] (-2641.014) (-2641.162) * (-2640.486) [-2640.673] (-2639.659) (-2638.494) -- 0:00:54
      280000 -- [-2640.041] (-2639.222) (-2639.357) (-2639.373) * (-2641.794) (-2640.101) [-2639.768] (-2637.405) -- 0:00:53

      Average standard deviation of split frequencies: 0.014360

      280500 -- [-2641.379] (-2644.137) (-2638.025) (-2640.759) * (-2641.473) [-2638.677] (-2639.861) (-2637.088) -- 0:00:53
      281000 -- (-2643.586) [-2640.226] (-2641.138) (-2641.163) * [-2642.710] (-2638.090) (-2640.576) (-2639.546) -- 0:00:53
      281500 -- (-2644.241) (-2642.348) [-2641.048] (-2641.836) * (-2642.157) (-2640.993) [-2640.236] (-2641.570) -- 0:00:53
      282000 -- (-2642.589) [-2640.292] (-2639.681) (-2641.107) * (-2640.577) [-2641.030] (-2639.507) (-2645.397) -- 0:00:53
      282500 -- (-2639.772) [-2639.761] (-2640.683) (-2640.891) * (-2640.008) (-2640.439) [-2640.103] (-2637.498) -- 0:00:53
      283000 -- (-2640.400) (-2638.494) (-2640.732) [-2644.188] * (-2643.084) (-2640.004) [-2640.020] (-2639.735) -- 0:00:53
      283500 -- (-2637.494) [-2643.747] (-2639.922) (-2640.273) * [-2641.934] (-2641.223) (-2638.891) (-2639.249) -- 0:00:53
      284000 -- [-2638.692] (-2644.155) (-2639.741) (-2641.092) * (-2645.438) (-2640.226) (-2640.339) [-2639.275] -- 0:00:52
      284500 -- (-2639.319) (-2642.832) [-2641.315] (-2642.379) * (-2643.8