--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:35:43 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2562/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -390.23 -393.72
2 -390.21 -394.36
--------------------------------------
TOTAL -390.22 -394.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.887198 0.085958 0.350301 1.470841 0.859625 1493.65 1497.32 1.000
r(A<->C){all} 0.168950 0.020220 0.000030 0.455639 0.130728 253.77 368.49 1.002
r(A<->G){all} 0.165996 0.019209 0.000103 0.444065 0.131829 253.37 286.19 1.000
r(A<->T){all} 0.168380 0.018865 0.000263 0.442971 0.137501 212.19 318.26 1.000
r(C<->G){all} 0.164096 0.020469 0.000149 0.450937 0.122861 279.80 371.01 1.004
r(C<->T){all} 0.159689 0.018492 0.000005 0.432721 0.125397 180.77 226.66 1.001
r(G<->T){all} 0.172889 0.019064 0.000128 0.443622 0.141696 172.29 277.40 1.004
pi(A){all} 0.191937 0.000521 0.148532 0.236752 0.191364 1393.12 1404.61 1.001
pi(C){all} 0.291382 0.000699 0.237026 0.341496 0.290600 1150.93 1292.22 1.000
pi(G){all} 0.338678 0.000782 0.284179 0.392478 0.338526 1262.61 1378.24 1.000
pi(T){all} 0.178003 0.000490 0.135590 0.219906 0.177568 1244.78 1372.89 1.000
alpha{1,2} 0.395936 0.209523 0.000113 1.342600 0.230272 1111.53 1161.94 1.001
alpha{3} 0.469960 0.246913 0.000111 1.462212 0.310389 1290.66 1330.53 1.000
pinvar{all} 0.994220 0.000049 0.980838 0.999998 0.996544 1385.80 1417.96 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -383.873303
Model 2: PositiveSelection -383.873257
Model 0: one-ratio -383.873323
Model 7: beta -383.873257
Model 8: beta&w>1 -383.873257
Model 0 vs 1 4.0000000012696546E-5
Model 2 vs 1 9.1999999995096E-5
Model 8 vs 7 0.0
>C1
LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
>C2
LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
>C3
LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
>C4
LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
>C5
LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
>C6
LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=96
C1 LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
C2 LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
C3 LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
C4 LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
C5 LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
C6 LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
**************************************************
C1 EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
C2 EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
C3 EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
C4 EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
C5 EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
C6 EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
**********************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 96 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 96 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2880]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2880]--->[2880]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.453 Mb, Max= 30.620 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
C2 LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
C3 LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
C4 LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
C5 LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
C6 LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
**************************************************
C1 EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
C2 EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
C3 EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
C4 EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
C5 EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
C6 EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
**********************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG
C2 TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG
C3 TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG
C4 TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG
C5 TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG
C6 TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG
**************************************************
C1 CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC
C2 CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC
C3 CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC
C4 CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC
C5 CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC
C6 CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC
**************************************************
C1 CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC
C2 CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC
C3 CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC
C4 CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC
C5 CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC
C6 CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC
**************************************************
C1 GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG
C2 GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG
C3 GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG
C4 GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG
C5 GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG
C6 GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG
**************************************************
C1 CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC
C2 CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC
C3 CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC
C4 CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC
C5 CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC
C6 CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC
**************************************************
C1 CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG
C2 CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG
C3 CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG
C4 CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG
C5 CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG
C6 CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG
**************************************
>C1
TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG
CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC
CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC
GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG
CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC
CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG
>C2
TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG
CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC
CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC
GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG
CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC
CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG
>C3
TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG
CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC
CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC
GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG
CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC
CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG
>C4
TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG
CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC
CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC
GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG
CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC
CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG
>C5
TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG
CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC
CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC
GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG
CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC
CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG
>C6
TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG
CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC
CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC
GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG
CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC
CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG
>C1
LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
>C2
LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
>C3
LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
>C4
LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
>C5
LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
>C6
LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 288 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579858440
Setting output file names to "/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 171295077
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5759559504
Seed = 1770209811
Swapseed = 1579858440
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -644.557807 -- -24.965149
Chain 2 -- -644.557807 -- -24.965149
Chain 3 -- -644.557807 -- -24.965149
Chain 4 -- -644.557807 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -644.557807 -- -24.965149
Chain 2 -- -644.557807 -- -24.965149
Chain 3 -- -644.557807 -- -24.965149
Chain 4 -- -644.557807 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-644.558] (-644.558) (-644.558) (-644.558) * [-644.558] (-644.558) (-644.558) (-644.558)
500 -- (-406.856) (-402.007) (-404.974) [-404.982] * (-402.356) [-399.688] (-401.450) (-414.381) -- 0:00:00
1000 -- [-402.226] (-399.970) (-402.807) (-404.260) * (-397.258) (-400.653) (-401.786) [-399.682] -- 0:00:00
1500 -- [-395.825] (-400.727) (-409.600) (-397.924) * (-397.670) [-395.251] (-402.329) (-393.619) -- 0:00:00
2000 -- [-398.209] (-400.276) (-400.581) (-399.211) * (-395.355) (-399.660) [-399.151] (-401.075) -- 0:00:00
2500 -- (-393.428) (-406.853) [-396.784] (-400.756) * (-397.459) [-406.148] (-401.871) (-400.689) -- 0:00:00
3000 -- (-396.717) (-398.193) [-396.960] (-395.700) * (-400.440) [-402.787] (-400.406) (-405.321) -- 0:00:00
3500 -- [-397.343] (-401.524) (-397.886) (-394.516) * [-408.936] (-399.514) (-397.797) (-402.298) -- 0:00:00
4000 -- (-407.553) (-402.532) (-401.293) [-399.213] * [-396.032] (-399.064) (-401.529) (-401.225) -- 0:00:00
4500 -- (-404.301) [-396.877] (-412.714) (-403.017) * (-399.953) (-414.820) (-403.911) [-399.377] -- 0:00:00
5000 -- (-395.690) [-397.460] (-402.750) (-402.922) * (-411.509) (-399.433) [-393.665] (-399.489) -- 0:00:00
Average standard deviation of split frequencies: 0.071425
5500 -- (-401.860) [-400.027] (-399.280) (-396.566) * [-396.336] (-399.122) (-404.998) (-410.361) -- 0:00:00
6000 -- (-397.225) (-405.613) [-389.518] (-399.791) * (-405.563) (-410.240) [-399.168] (-404.681) -- 0:00:00
6500 -- (-403.333) [-403.760] (-392.566) (-413.909) * [-399.426] (-392.991) (-406.503) (-399.721) -- 0:00:00
7000 -- (-399.119) (-401.926) (-390.051) [-397.342] * (-404.735) (-389.984) (-396.362) [-404.990] -- 0:00:00
7500 -- (-395.981) (-412.207) [-392.989] (-395.388) * [-400.046] (-396.732) (-404.356) (-393.904) -- 0:00:00
8000 -- (-396.176) (-391.923) [-389.629] (-404.428) * (-402.253) [-392.309] (-402.570) (-400.708) -- 0:00:00
8500 -- (-402.877) [-389.194] (-390.617) (-408.072) * [-401.362] (-392.825) (-408.923) (-398.974) -- 0:00:00
9000 -- (-394.705) (-390.343) [-388.876] (-403.366) * [-390.647] (-391.519) (-401.718) (-396.240) -- 0:00:00
9500 -- (-404.834) (-389.898) [-390.575] (-396.311) * (-392.102) (-393.839) [-401.643] (-401.917) -- 0:00:00
10000 -- (-402.554) (-391.627) [-392.911] (-393.267) * (-390.612) (-391.612) [-397.593] (-394.593) -- 0:00:00
Average standard deviation of split frequencies: 0.077340
10500 -- (-397.241) (-395.750) [-391.368] (-391.396) * (-389.861) [-390.972] (-394.775) (-410.840) -- 0:00:00
11000 -- (-398.326) [-389.822] (-393.749) (-391.655) * (-390.390) (-390.027) [-399.476] (-396.996) -- 0:00:00
11500 -- (-396.370) (-389.004) [-395.237] (-391.127) * (-392.801) (-390.223) (-395.337) [-395.122] -- 0:00:00
12000 -- (-405.536) (-389.264) (-392.185) [-389.371] * (-392.079) [-390.306] (-396.038) (-402.425) -- 0:00:00
12500 -- (-400.832) (-392.012) (-393.233) [-390.948] * (-390.457) [-389.589] (-401.829) (-401.899) -- 0:00:00
13000 -- (-398.810) (-392.977) [-392.390] (-389.809) * [-390.072] (-390.050) (-394.102) (-403.422) -- 0:01:15
13500 -- [-400.088] (-392.614) (-393.267) (-389.129) * (-389.632) (-390.346) [-395.888] (-400.338) -- 0:01:13
14000 -- (-400.938) (-394.553) [-392.036] (-389.810) * (-391.251) [-390.555] (-402.201) (-402.757) -- 0:01:10
14500 -- (-403.728) [-392.994] (-389.065) (-389.090) * (-392.222) (-389.484) (-391.108) [-398.321] -- 0:01:07
15000 -- [-398.584] (-392.832) (-391.815) (-389.569) * (-390.458) (-393.206) (-390.269) [-398.115] -- 0:01:05
Average standard deviation of split frequencies: 0.056120
15500 -- (-399.232) [-393.170] (-390.149) (-390.201) * (-390.740) (-392.704) [-389.860] (-407.662) -- 0:01:03
16000 -- (-403.588) (-392.105) (-389.224) [-393.619] * [-391.849] (-392.255) (-392.822) (-410.856) -- 0:01:01
16500 -- [-400.200] (-389.972) (-391.772) (-389.833) * (-389.056) (-389.654) [-390.188] (-399.755) -- 0:00:59
17000 -- [-397.943] (-390.049) (-390.011) (-391.659) * (-388.577) (-390.464) (-393.807) [-395.832] -- 0:00:57
17500 -- (-397.977) (-391.637) (-391.295) [-390.323] * [-389.199] (-391.276) (-395.962) (-399.354) -- 0:00:56
18000 -- (-396.854) (-391.400) (-389.491) [-393.747] * [-390.708] (-391.054) (-391.414) (-402.067) -- 0:00:54
18500 -- [-399.231] (-397.612) (-391.302) (-391.125) * (-390.635) [-389.606] (-389.243) (-392.273) -- 0:00:53
19000 -- (-410.617) [-389.739] (-390.316) (-389.761) * (-392.977) (-393.648) [-389.887] (-390.654) -- 0:00:51
19500 -- [-395.813] (-391.195) (-389.858) (-394.485) * (-393.562) (-393.906) [-390.498] (-391.106) -- 0:00:50
20000 -- [-399.105] (-391.270) (-390.176) (-389.765) * (-401.565) [-389.567] (-391.296) (-390.475) -- 0:00:49
Average standard deviation of split frequencies: 0.044479
20500 -- (-394.774) (-389.200) (-391.763) [-390.514] * (-396.261) [-391.150] (-394.672) (-396.083) -- 0:00:47
21000 -- (-403.864) (-390.612) (-390.030) [-391.935] * [-393.226] (-389.249) (-396.277) (-389.078) -- 0:00:46
21500 -- (-400.555) (-390.788) (-391.405) [-392.384] * (-390.805) [-389.905] (-395.509) (-389.785) -- 0:00:45
22000 -- (-400.420) (-391.842) (-392.142) [-391.449] * (-391.845) [-391.130] (-391.502) (-391.064) -- 0:00:44
22500 -- (-410.984) [-389.818] (-398.507) (-390.431) * (-389.222) [-393.083] (-392.292) (-389.905) -- 0:00:43
23000 -- (-400.999) (-392.131) (-390.915) [-389.214] * (-391.173) [-389.717] (-390.528) (-390.265) -- 0:00:42
23500 -- (-402.574) [-394.761] (-389.935) (-389.772) * (-395.955) [-389.901] (-390.541) (-390.138) -- 0:00:41
24000 -- (-409.862) (-389.510) [-391.162] (-389.736) * (-391.129) (-390.098) (-391.828) [-392.587] -- 0:00:40
24500 -- (-396.212) (-390.050) [-390.194] (-393.432) * (-389.828) [-389.091] (-390.821) (-390.838) -- 0:00:39
25000 -- [-397.801] (-391.034) (-391.553) (-390.199) * (-391.833) [-390.506] (-391.777) (-392.190) -- 0:00:39
Average standard deviation of split frequencies: 0.039558
25500 -- [-403.461] (-389.867) (-396.068) (-390.907) * [-390.360] (-393.072) (-390.650) (-390.059) -- 0:00:38
26000 -- [-393.440] (-391.479) (-390.714) (-391.796) * (-391.205) (-392.916) [-391.204] (-391.855) -- 0:00:37
26500 -- [-401.628] (-390.384) (-390.807) (-390.488) * [-389.664] (-390.398) (-392.602) (-393.081) -- 0:00:36
27000 -- (-396.329) [-389.157] (-391.583) (-393.765) * (-390.706) (-391.851) (-393.334) [-389.670] -- 0:01:12
27500 -- [-399.225] (-390.006) (-390.819) (-392.645) * (-389.794) [-397.383] (-395.695) (-390.577) -- 0:01:10
28000 -- [-396.979] (-389.834) (-390.839) (-390.291) * (-390.100) [-390.773] (-390.589) (-392.697) -- 0:01:09
28500 -- (-402.081) (-389.164) (-392.841) [-391.605] * (-389.741) [-391.751] (-391.427) (-390.463) -- 0:01:08
29000 -- (-411.114) [-391.779] (-389.458) (-389.686) * [-392.213] (-393.075) (-390.129) (-389.184) -- 0:01:06
29500 -- (-399.475) [-390.141] (-390.293) (-389.799) * (-393.982) (-390.841) [-390.116] (-390.104) -- 0:01:05
30000 -- (-407.368) [-394.374] (-391.723) (-389.878) * (-396.604) (-395.171) [-390.315] (-389.179) -- 0:01:04
Average standard deviation of split frequencies: 0.040992
30500 -- (-401.420) [-392.256] (-392.564) (-390.953) * (-389.602) [-394.651] (-390.688) (-391.493) -- 0:01:03
31000 -- (-409.823) [-389.480] (-392.268) (-395.135) * (-391.995) (-391.792) (-390.518) [-394.531] -- 0:01:02
31500 -- (-415.628) [-390.199] (-390.225) (-389.405) * (-394.695) (-389.753) [-392.245] (-392.759) -- 0:01:01
32000 -- (-390.931) (-390.448) (-391.766) [-390.681] * (-390.960) [-391.450] (-391.973) (-389.989) -- 0:01:00
32500 -- [-390.251] (-389.170) (-389.671) (-393.947) * (-391.521) (-392.233) (-392.048) [-390.556] -- 0:00:59
33000 -- (-390.132) (-388.876) [-390.003] (-392.692) * (-392.047) (-392.694) [-392.992] (-393.965) -- 0:00:58
33500 -- [-390.152] (-398.830) (-390.367) (-390.736) * (-393.510) (-393.562) [-392.714] (-396.820) -- 0:00:57
34000 -- (-393.427) (-391.447) [-393.133] (-392.529) * (-392.825) (-393.137) (-391.117) [-393.822] -- 0:00:56
34500 -- (-389.987) (-389.927) [-389.736] (-389.647) * (-392.447) (-395.197) (-391.600) [-394.268] -- 0:00:55
35000 -- (-389.888) (-390.736) (-392.409) [-389.594] * (-390.375) (-393.353) [-394.405] (-391.151) -- 0:00:55
Average standard deviation of split frequencies: 0.036374
35500 -- (-393.148) (-389.565) (-390.973) [-389.259] * [-390.631] (-395.421) (-390.458) (-395.563) -- 0:00:54
36000 -- [-393.582] (-393.425) (-391.355) (-389.934) * [-390.923] (-390.454) (-391.090) (-392.282) -- 0:00:53
36500 -- [-390.884] (-394.241) (-393.971) (-394.129) * (-391.480) (-389.436) [-392.345] (-394.821) -- 0:00:52
37000 -- (-392.334) (-395.864) [-393.661] (-392.103) * (-391.658) (-391.776) [-389.729] (-398.486) -- 0:00:52
37500 -- (-391.311) (-391.389) [-390.319] (-390.773) * (-392.180) (-395.905) [-389.355] (-396.562) -- 0:00:51
38000 -- (-389.617) (-391.429) [-389.945] (-398.774) * [-389.436] (-394.925) (-392.571) (-394.497) -- 0:00:50
38500 -- [-389.483] (-394.066) (-392.092) (-391.627) * (-395.471) [-394.378] (-390.765) (-392.046) -- 0:00:49
39000 -- [-390.441] (-393.045) (-393.728) (-394.147) * [-389.750] (-391.575) (-391.270) (-389.500) -- 0:00:49
39500 -- (-391.735) [-389.074] (-391.580) (-390.456) * (-392.797) (-393.660) (-388.796) [-390.452] -- 0:00:48
40000 -- (-391.854) (-394.956) [-390.948] (-389.264) * (-391.477) (-392.020) (-392.375) [-389.965] -- 0:00:48
Average standard deviation of split frequencies: 0.033037
40500 -- [-392.404] (-394.657) (-391.835) (-391.682) * [-390.434] (-393.079) (-389.394) (-390.107) -- 0:00:47
41000 -- (-389.824) [-389.735] (-391.325) (-397.894) * [-391.222] (-389.999) (-391.250) (-389.887) -- 0:00:46
41500 -- (-391.118) [-388.955] (-389.589) (-391.220) * (-394.280) (-390.743) [-391.373] (-394.418) -- 0:00:46
42000 -- [-390.565] (-389.289) (-397.002) (-393.017) * (-391.780) (-390.150) (-390.569) [-391.125] -- 0:01:08
42500 -- (-389.802) (-390.271) (-393.852) [-389.092] * (-389.835) [-392.263] (-390.631) (-391.654) -- 0:01:07
43000 -- (-389.989) (-389.509) [-390.056] (-390.614) * [-391.351] (-391.113) (-391.770) (-392.561) -- 0:01:06
43500 -- (-391.174) [-393.659] (-392.164) (-389.360) * (-389.800) (-389.068) (-389.990) [-392.993] -- 0:01:05
44000 -- [-390.179] (-391.353) (-395.151) (-389.350) * (-389.330) (-390.316) [-395.080] (-389.937) -- 0:01:05
44500 -- (-390.275) (-390.350) [-395.401] (-390.084) * (-388.839) (-394.765) [-391.779] (-391.555) -- 0:01:04
45000 -- (-390.178) (-391.552) [-390.837] (-391.736) * [-391.634] (-391.279) (-391.726) (-392.914) -- 0:01:03
Average standard deviation of split frequencies: 0.031720
45500 -- (-392.325) (-395.664) [-391.577] (-390.403) * (-392.445) (-390.302) (-392.673) [-390.613] -- 0:01:02
46000 -- (-389.264) (-392.590) [-394.366] (-389.954) * [-389.401] (-389.360) (-389.195) (-390.474) -- 0:01:02
46500 -- (-389.757) (-389.271) (-393.850) [-391.419] * (-389.738) (-389.495) (-389.234) [-392.684] -- 0:01:01
47000 -- (-392.567) (-393.413) [-392.643] (-390.364) * [-391.074] (-392.706) (-393.336) (-391.503) -- 0:01:00
47500 -- [-388.824] (-391.266) (-391.064) (-392.334) * [-391.897] (-392.068) (-389.926) (-393.318) -- 0:01:00
48000 -- (-390.242) [-393.086] (-392.840) (-388.981) * (-393.062) (-390.714) (-390.088) [-394.717] -- 0:00:59
48500 -- (-389.968) (-391.383) [-392.578] (-394.100) * [-397.245] (-393.205) (-389.064) (-391.538) -- 0:00:58
49000 -- (-390.954) [-391.504] (-396.467) (-399.166) * (-391.409) (-393.761) (-388.650) [-393.014] -- 0:00:58
49500 -- (-390.545) [-392.531] (-394.946) (-390.939) * (-392.790) (-392.273) [-390.928] (-393.531) -- 0:00:57
50000 -- (-390.753) (-394.924) (-392.916) [-390.731] * [-392.261] (-394.769) (-392.356) (-394.334) -- 0:00:57
Average standard deviation of split frequencies: 0.022526
50500 -- (-390.645) (-390.348) [-390.548] (-393.580) * (-392.939) (-390.331) (-389.168) [-390.043] -- 0:00:56
51000 -- (-389.966) (-390.028) [-391.494] (-391.870) * (-392.665) (-390.284) [-389.399] (-395.456) -- 0:00:55
51500 -- (-391.353) [-391.248] (-389.952) (-391.761) * (-393.446) (-391.521) (-389.614) [-396.758] -- 0:00:55
52000 -- [-389.973] (-390.034) (-391.497) (-390.144) * [-390.414] (-394.161) (-389.960) (-392.619) -- 0:00:54
52500 -- [-389.134] (-392.243) (-391.542) (-392.757) * [-392.755] (-394.295) (-388.529) (-390.693) -- 0:00:54
53000 -- (-394.917) (-391.418) [-393.876] (-394.726) * (-391.039) (-390.412) (-389.409) [-389.898] -- 0:00:53
53500 -- (-392.067) (-391.420) [-393.038] (-391.014) * [-389.686] (-390.134) (-389.294) (-390.059) -- 0:00:53
54000 -- (-393.873) [-393.608] (-391.208) (-389.451) * (-390.726) (-391.023) (-389.918) [-390.333] -- 0:00:52
54500 -- (-392.046) (-390.037) (-393.035) [-392.817] * (-390.028) [-391.999] (-395.623) (-392.979) -- 0:00:52
55000 -- [-388.906] (-390.421) (-395.505) (-393.221) * (-394.153) [-391.784] (-392.167) (-393.194) -- 0:00:51
Average standard deviation of split frequencies: 0.021466
55500 -- (-388.872) [-391.045] (-390.479) (-389.900) * (-394.515) (-393.390) (-389.550) [-391.506] -- 0:00:51
56000 -- (-389.221) (-391.501) (-393.201) [-390.762] * (-389.657) (-390.377) (-391.939) [-390.962] -- 0:00:50
56500 -- [-389.473] (-391.802) (-392.256) (-390.452) * (-390.263) (-390.584) [-389.167] (-389.992) -- 0:00:50
57000 -- [-391.147] (-390.084) (-389.636) (-392.792) * [-391.627] (-390.040) (-393.607) (-389.953) -- 0:00:49
57500 -- [-391.143] (-390.748) (-390.117) (-390.134) * (-393.524) (-391.278) (-392.654) [-389.157] -- 0:00:49
58000 -- (-391.264) (-395.205) (-394.384) [-390.477] * [-390.301] (-393.709) (-391.161) (-389.910) -- 0:00:48
58500 -- [-389.132] (-398.726) (-390.566) (-391.417) * (-390.575) (-390.080) [-390.729] (-391.977) -- 0:00:48
59000 -- (-392.756) (-388.922) (-393.266) [-392.197] * [-390.949] (-389.054) (-391.785) (-390.946) -- 0:00:47
59500 -- (-394.302) (-389.036) (-393.342) [-392.772] * (-392.013) [-393.862] (-390.521) (-389.660) -- 0:01:03
60000 -- (-389.166) [-391.297] (-390.874) (-394.050) * (-389.964) (-396.803) (-392.616) [-390.362] -- 0:01:02
Average standard deviation of split frequencies: 0.023311
60500 -- (-392.057) (-392.451) [-390.645] (-392.076) * (-391.511) (-393.327) [-392.895] (-391.027) -- 0:01:02
61000 -- (-401.030) (-390.615) (-391.896) [-390.508] * [-389.617] (-397.063) (-389.950) (-392.129) -- 0:01:01
61500 -- [-390.602] (-393.532) (-388.929) (-394.769) * [-390.834] (-392.992) (-390.787) (-390.674) -- 0:01:01
62000 -- [-388.927] (-391.953) (-388.620) (-392.002) * (-390.522) (-393.809) [-392.178] (-390.365) -- 0:01:00
62500 -- (-392.812) [-389.893] (-390.550) (-391.320) * (-391.502) (-392.918) (-391.769) [-392.821] -- 0:01:00
63000 -- (-390.062) (-392.730) [-390.344] (-389.202) * [-390.654] (-391.176) (-391.618) (-391.199) -- 0:00:59
63500 -- (-391.688) [-395.432] (-389.926) (-393.805) * [-389.311] (-390.921) (-394.110) (-390.612) -- 0:00:58
64000 -- (-393.596) (-390.644) (-391.739) [-394.576] * [-389.896] (-392.337) (-390.981) (-390.456) -- 0:00:58
64500 -- (-393.974) (-390.610) (-392.386) [-391.462] * (-391.526) [-389.043] (-391.840) (-390.960) -- 0:00:58
65000 -- (-391.077) (-391.386) (-394.679) [-389.214] * (-392.499) [-389.803] (-392.791) (-390.261) -- 0:00:57
Average standard deviation of split frequencies: 0.018181
65500 -- (-392.933) [-390.619] (-391.850) (-394.939) * (-391.385) (-391.271) (-393.141) [-389.867] -- 0:00:57
66000 -- (-390.171) (-389.307) (-390.943) [-390.266] * (-390.983) (-391.246) [-391.957] (-393.096) -- 0:00:56
66500 -- (-390.681) (-389.879) (-390.456) [-391.230] * [-389.488] (-389.666) (-394.507) (-391.179) -- 0:00:56
67000 -- (-393.437) (-389.483) (-391.403) [-389.087] * [-390.677] (-390.756) (-393.188) (-391.167) -- 0:00:55
67500 -- (-391.061) [-391.687] (-390.809) (-391.395) * [-389.649] (-392.066) (-390.408) (-391.437) -- 0:00:55
68000 -- [-390.530] (-395.341) (-389.585) (-390.406) * [-389.104] (-392.665) (-391.825) (-390.754) -- 0:00:54
68500 -- (-393.519) [-393.031] (-393.561) (-391.881) * (-389.600) (-389.371) (-389.993) [-390.413] -- 0:00:54
69000 -- (-390.102) [-389.241] (-391.946) (-390.260) * [-391.188] (-391.464) (-391.448) (-390.876) -- 0:00:53
69500 -- (-391.793) (-388.956) (-390.646) [-389.521] * (-391.007) [-391.571] (-391.864) (-395.768) -- 0:00:53
70000 -- (-390.036) (-389.820) (-389.379) [-392.317] * (-388.966) (-392.519) (-391.104) [-392.082] -- 0:00:53
Average standard deviation of split frequencies: 0.021347
70500 -- (-389.690) (-393.278) [-390.858] (-394.028) * [-391.957] (-391.328) (-392.309) (-391.985) -- 0:00:52
71000 -- (-389.254) (-389.632) (-397.302) [-390.866] * (-389.594) (-389.559) [-391.845] (-391.977) -- 0:00:52
71500 -- (-390.452) (-388.825) (-391.515) [-390.208] * (-390.257) [-393.069] (-390.912) (-390.227) -- 0:00:51
72000 -- (-394.025) [-389.512] (-391.408) (-391.573) * (-391.549) (-391.018) (-390.826) [-390.538] -- 0:00:51
72500 -- (-389.714) [-389.125] (-393.862) (-391.799) * (-392.440) (-390.732) (-392.857) [-390.499] -- 0:00:51
73000 -- [-392.548] (-391.129) (-397.638) (-390.007) * [-389.462] (-389.398) (-389.980) (-391.621) -- 0:00:50
73500 -- (-392.792) (-392.463) [-390.859] (-391.104) * (-395.135) [-389.525] (-391.708) (-394.627) -- 0:00:50
74000 -- (-395.597) [-388.892] (-390.702) (-389.680) * [-390.710] (-394.381) (-393.447) (-391.293) -- 0:00:50
74500 -- (-395.011) [-389.907] (-392.920) (-393.079) * (-394.048) (-395.406) [-389.116] (-391.531) -- 0:00:49
75000 -- [-393.361] (-393.047) (-390.798) (-392.608) * [-389.338] (-394.378) (-393.070) (-395.760) -- 0:00:49
Average standard deviation of split frequencies: 0.019790
75500 -- (-391.225) [-389.133] (-394.055) (-390.037) * (-393.310) (-389.007) [-390.752] (-393.967) -- 0:00:48
76000 -- (-394.482) (-389.321) (-391.602) [-391.392] * (-391.464) [-391.878] (-393.797) (-392.244) -- 0:01:00
76500 -- [-390.007] (-389.735) (-391.442) (-389.409) * (-389.483) (-389.993) (-388.977) [-390.020] -- 0:01:00
77000 -- (-393.241) (-389.073) (-394.296) [-389.894] * (-392.966) [-389.956] (-391.676) (-388.713) -- 0:00:59
77500 -- (-394.421) (-390.496) (-391.771) [-389.993] * (-391.488) (-391.642) (-389.040) [-389.272] -- 0:00:59
78000 -- [-391.865] (-391.007) (-392.145) (-391.733) * (-391.823) [-392.720] (-391.966) (-388.853) -- 0:00:59
78500 -- (-391.045) [-391.790] (-390.083) (-394.255) * [-390.596] (-390.342) (-395.670) (-391.128) -- 0:00:58
79000 -- (-389.711) (-389.961) [-392.822] (-388.951) * (-391.632) [-390.033] (-389.829) (-391.500) -- 0:00:58
79500 -- [-389.346] (-391.330) (-390.791) (-394.156) * (-392.809) [-392.145] (-390.453) (-390.428) -- 0:00:57
80000 -- (-391.657) (-393.943) (-390.625) [-393.792] * [-390.596] (-390.019) (-389.586) (-391.031) -- 0:00:57
Average standard deviation of split frequencies: 0.021038
80500 -- (-394.704) (-388.976) (-396.198) [-392.188] * (-391.925) (-389.154) (-389.917) [-389.184] -- 0:00:57
81000 -- (-391.758) (-390.663) (-395.835) [-391.176] * (-391.220) (-390.127) (-390.786) [-391.230] -- 0:00:56
81500 -- (-394.013) [-390.049] (-392.997) (-390.202) * [-389.711] (-389.204) (-388.832) (-390.764) -- 0:00:56
82000 -- (-391.110) [-390.160] (-391.057) (-394.174) * (-389.240) (-390.627) [-392.447] (-390.019) -- 0:00:55
82500 -- (-391.323) [-393.250] (-391.567) (-393.847) * (-390.372) (-390.609) [-391.012] (-389.789) -- 0:00:55
83000 -- (-395.859) (-391.367) (-394.984) [-393.189] * (-391.615) (-391.018) (-391.512) [-390.735] -- 0:00:55
83500 -- (-391.756) [-391.571] (-393.619) (-391.192) * [-390.532] (-390.543) (-393.948) (-389.704) -- 0:00:54
84000 -- (-390.161) [-389.271] (-392.198) (-393.395) * (-390.737) [-389.255] (-393.981) (-389.774) -- 0:00:54
84500 -- (-389.205) (-393.834) (-393.180) [-390.433] * (-396.453) [-390.732] (-391.028) (-391.536) -- 0:00:54
85000 -- [-388.931] (-390.574) (-389.842) (-389.778) * (-392.917) (-389.365) [-391.677] (-391.985) -- 0:00:53
Average standard deviation of split frequencies: 0.016705
85500 -- [-393.271] (-389.466) (-391.853) (-390.029) * (-389.423) (-391.228) [-389.591] (-389.567) -- 0:00:53
86000 -- (-392.378) [-394.201] (-389.264) (-392.170) * (-390.946) (-389.588) [-389.351] (-390.181) -- 0:00:53
86500 -- (-390.972) [-392.535] (-389.825) (-393.254) * (-392.057) (-391.313) [-391.720] (-390.811) -- 0:00:52
87000 -- (-390.429) (-395.414) [-389.747] (-390.828) * [-390.079] (-390.702) (-388.874) (-390.506) -- 0:00:52
87500 -- (-389.029) (-392.995) [-391.225] (-393.010) * (-391.272) [-390.979] (-392.357) (-390.037) -- 0:00:52
88000 -- (-389.874) (-397.395) (-391.417) [-390.012] * (-392.737) (-391.294) [-390.216] (-390.017) -- 0:00:51
88500 -- (-390.992) (-398.208) (-390.775) [-390.740] * (-395.101) [-393.256] (-391.962) (-389.717) -- 0:00:51
89000 -- [-393.369] (-391.087) (-391.584) (-392.015) * (-396.031) [-393.049] (-390.452) (-390.780) -- 0:00:51
89500 -- (-391.058) (-389.787) [-389.190] (-394.857) * [-390.577] (-392.165) (-391.498) (-389.601) -- 0:00:50
90000 -- (-392.396) (-391.601) (-391.178) [-393.904] * (-389.959) [-393.104] (-392.156) (-390.565) -- 0:00:50
Average standard deviation of split frequencies: 0.016780
90500 -- [-389.642] (-393.121) (-392.379) (-390.456) * [-390.506] (-390.217) (-391.074) (-394.120) -- 0:00:50
91000 -- (-390.070) [-394.861] (-392.558) (-391.636) * (-391.604) (-390.601) (-390.159) [-392.817] -- 0:00:49
91500 -- [-390.318] (-390.729) (-389.322) (-393.758) * (-389.607) (-392.326) [-389.600] (-392.834) -- 0:00:49
92000 -- [-391.997] (-390.454) (-390.837) (-392.997) * [-389.920] (-389.993) (-394.726) (-391.307) -- 0:00:59
92500 -- [-393.861] (-389.659) (-389.857) (-390.635) * [-389.183] (-388.946) (-390.654) (-389.986) -- 0:00:58
93000 -- (-390.128) [-391.266] (-389.857) (-392.549) * (-388.903) [-389.243] (-389.786) (-391.640) -- 0:00:58
93500 -- (-388.870) (-390.557) (-390.936) [-390.973] * [-390.213] (-392.499) (-391.689) (-390.170) -- 0:00:58
94000 -- (-394.061) (-390.870) [-394.405] (-391.651) * (-389.124) (-390.011) [-391.968] (-391.890) -- 0:00:57
94500 -- (-390.008) [-392.930] (-390.662) (-389.316) * (-393.852) (-392.370) (-392.653) [-391.844] -- 0:00:57
95000 -- (-390.295) [-389.900] (-390.632) (-390.864) * (-393.900) [-392.336] (-389.618) (-394.973) -- 0:00:57
Average standard deviation of split frequencies: 0.016282
95500 -- [-389.262] (-393.098) (-392.120) (-392.159) * (-390.327) [-393.107] (-391.736) (-391.135) -- 0:00:56
96000 -- (-392.429) (-399.712) (-394.981) [-391.299] * (-389.887) [-390.242] (-393.927) (-391.485) -- 0:00:56
96500 -- (-396.506) [-394.771] (-389.742) (-391.770) * (-389.037) [-390.444] (-393.296) (-392.661) -- 0:00:56
97000 -- (-391.003) [-391.332] (-390.319) (-394.132) * [-390.126] (-392.097) (-390.698) (-390.777) -- 0:00:55
97500 -- (-393.472) (-391.046) (-389.958) [-392.381] * (-392.076) [-389.847] (-390.944) (-393.007) -- 0:00:55
98000 -- [-390.515] (-391.935) (-391.648) (-390.556) * (-389.086) [-390.459] (-393.420) (-391.636) -- 0:00:55
98500 -- (-391.022) [-390.254] (-393.093) (-390.564) * (-390.109) (-390.585) (-389.650) [-395.754] -- 0:00:54
99000 -- (-391.724) [-390.307] (-390.727) (-390.868) * (-391.710) [-389.306] (-389.281) (-391.904) -- 0:00:54
99500 -- (-392.592) (-390.148) (-391.057) [-389.823] * (-392.473) [-392.257] (-394.645) (-390.335) -- 0:00:54
100000 -- (-390.971) [-389.056] (-394.808) (-393.452) * (-390.480) (-392.390) (-394.759) [-391.513] -- 0:00:54
Average standard deviation of split frequencies: 0.018238
100500 -- (-392.904) (-390.410) [-391.806] (-390.277) * (-390.668) (-389.607) [-389.081] (-391.888) -- 0:00:53
101000 -- (-395.248) (-391.277) [-392.987] (-390.092) * (-390.599) [-391.699] (-393.618) (-393.396) -- 0:00:53
101500 -- (-395.613) [-390.049] (-389.854) (-393.062) * (-391.898) (-390.283) (-395.088) [-389.251] -- 0:00:53
102000 -- (-394.725) (-390.561) [-390.516] (-392.812) * (-391.699) (-389.999) [-390.558] (-389.181) -- 0:00:52
102500 -- [-392.205] (-389.619) (-391.511) (-393.027) * (-391.851) [-391.484] (-391.245) (-388.893) -- 0:00:52
103000 -- (-390.598) [-391.899] (-391.154) (-390.545) * (-391.312) (-392.009) (-389.905) [-390.598] -- 0:00:52
103500 -- (-394.748) (-394.568) (-392.326) [-391.390] * [-388.809] (-389.736) (-391.135) (-392.567) -- 0:00:51
104000 -- (-392.617) [-391.172] (-392.157) (-389.610) * (-396.557) (-391.399) [-389.469] (-390.835) -- 0:00:51
104500 -- (-391.056) (-390.581) (-391.102) [-390.225] * (-391.208) (-395.250) (-390.520) [-390.037] -- 0:00:51
105000 -- (-389.675) (-391.321) [-390.639] (-391.957) * (-389.260) (-393.481) [-390.270] (-390.491) -- 0:00:51
Average standard deviation of split frequencies: 0.017122
105500 -- (-389.266) (-393.814) [-391.540] (-392.845) * (-391.312) (-391.759) [-390.167] (-388.842) -- 0:00:50
106000 -- [-390.572] (-395.133) (-390.453) (-394.622) * (-393.106) (-391.060) [-393.362] (-389.305) -- 0:00:50
106500 -- (-391.325) (-393.025) [-389.507] (-390.343) * [-391.203] (-392.315) (-395.855) (-388.775) -- 0:00:50
107000 -- [-390.888] (-390.369) (-395.429) (-390.976) * (-392.016) [-389.693] (-391.238) (-389.312) -- 0:00:50
107500 -- [-391.549] (-392.746) (-394.289) (-391.619) * (-392.100) (-388.800) [-391.447] (-389.377) -- 0:00:58
108000 -- (-392.988) [-389.078] (-391.447) (-391.161) * (-391.227) (-388.954) (-390.661) [-393.700] -- 0:00:57
108500 -- (-391.639) (-390.765) (-389.720) [-394.496] * (-392.201) [-391.787] (-388.717) (-399.040) -- 0:00:57
109000 -- (-389.424) (-393.094) [-390.741] (-392.324) * (-389.601) (-391.095) [-389.074] (-391.625) -- 0:00:57
109500 -- (-390.461) (-391.044) (-391.060) [-390.764] * (-391.234) (-389.029) (-393.910) [-388.894] -- 0:00:56
110000 -- (-390.374) [-390.120] (-390.698) (-391.445) * (-392.395) (-393.707) (-396.726) [-393.273] -- 0:00:56
Average standard deviation of split frequencies: 0.016815
110500 -- (-391.744) (-389.640) [-390.402] (-392.253) * (-391.829) (-392.585) [-393.246] (-390.853) -- 0:00:56
111000 -- (-390.339) [-392.377] (-393.994) (-391.258) * (-396.589) [-389.885] (-393.488) (-388.887) -- 0:00:56
111500 -- (-393.743) (-391.296) [-398.343] (-390.845) * (-390.392) [-389.245] (-389.753) (-389.631) -- 0:00:55
112000 -- (-395.164) (-392.495) (-390.800) [-390.220] * (-390.053) [-392.710] (-390.505) (-389.150) -- 0:00:55
112500 -- (-393.582) (-388.690) [-390.068] (-388.934) * (-391.290) (-390.116) (-389.413) [-390.065] -- 0:00:55
113000 -- [-390.312] (-390.972) (-390.517) (-391.081) * (-390.785) (-390.277) (-389.656) [-391.030] -- 0:00:54
113500 -- [-390.852] (-391.292) (-396.606) (-389.711) * [-391.775] (-388.984) (-391.734) (-389.446) -- 0:00:54
114000 -- (-390.954) (-389.416) [-392.120] (-389.183) * [-389.312] (-390.172) (-390.307) (-391.474) -- 0:00:54
114500 -- (-390.446) (-390.400) [-391.978] (-389.123) * (-392.578) [-391.316] (-392.515) (-393.354) -- 0:00:54
115000 -- (-393.536) (-389.128) (-389.725) [-389.476] * [-390.909] (-390.103) (-392.444) (-393.653) -- 0:00:53
Average standard deviation of split frequencies: 0.016897
115500 -- (-390.735) (-390.406) (-391.525) [-389.625] * [-389.033] (-392.438) (-388.741) (-396.267) -- 0:00:53
116000 -- [-391.103] (-394.438) (-389.331) (-393.444) * (-393.446) [-391.851] (-388.668) (-390.209) -- 0:00:53
116500 -- (-392.978) (-392.975) (-390.826) [-391.610] * [-389.392] (-391.177) (-390.751) (-391.277) -- 0:00:53
117000 -- (-390.568) (-394.177) (-392.121) [-391.139] * (-389.139) [-389.367] (-389.976) (-391.015) -- 0:00:52
117500 -- (-390.432) (-396.314) (-389.062) [-389.907] * (-391.212) (-393.746) (-389.291) [-391.640] -- 0:00:52
118000 -- (-388.937) [-392.260] (-393.002) (-391.105) * [-391.130] (-398.686) (-389.504) (-391.127) -- 0:00:52
118500 -- (-392.245) [-389.987] (-391.270) (-391.521) * (-391.297) (-391.015) [-388.793] (-390.607) -- 0:00:52
119000 -- (-388.675) [-389.973] (-390.032) (-391.770) * [-391.249] (-389.711) (-390.530) (-389.725) -- 0:00:51
119500 -- [-392.690] (-392.065) (-393.716) (-390.603) * (-390.863) (-391.555) [-391.546] (-389.902) -- 0:00:51
120000 -- (-391.048) (-393.193) [-390.887] (-389.490) * [-389.617] (-391.921) (-393.065) (-389.742) -- 0:00:51
Average standard deviation of split frequencies: 0.016278
120500 -- (-389.501) [-392.120] (-394.616) (-389.751) * (-390.373) (-393.167) [-391.862] (-391.590) -- 0:00:51
121000 -- (-389.023) (-392.002) [-390.963] (-397.807) * [-390.753] (-391.677) (-390.767) (-391.200) -- 0:00:50
121500 -- [-397.184] (-391.361) (-395.939) (-395.228) * (-390.246) [-390.384] (-392.444) (-389.948) -- 0:00:50
122000 -- (-393.252) (-391.719) [-393.065] (-391.438) * (-393.644) [-390.225] (-389.559) (-389.584) -- 0:00:50
122500 -- (-390.566) [-390.994] (-390.892) (-390.314) * (-391.289) (-390.812) (-390.947) [-391.298] -- 0:00:57
123000 -- (-391.016) (-388.676) (-391.765) [-389.018] * (-394.340) [-390.620] (-392.044) (-391.649) -- 0:00:57
123500 -- (-390.077) (-389.301) [-389.684] (-390.027) * (-394.414) [-389.105] (-391.952) (-391.832) -- 0:00:56
124000 -- (-389.868) (-390.439) [-391.562] (-391.222) * [-392.897] (-393.565) (-391.656) (-391.071) -- 0:00:56
124500 -- (-389.465) (-391.925) (-390.365) [-390.534] * (-392.584) (-396.891) (-399.509) [-392.922] -- 0:00:56
125000 -- (-389.895) (-392.745) [-390.977] (-391.693) * (-391.360) (-395.071) (-395.324) [-390.257] -- 0:00:56
Average standard deviation of split frequencies: 0.014571
125500 -- (-389.937) (-390.818) [-391.660] (-394.737) * (-390.252) (-389.939) (-392.093) [-390.297] -- 0:00:55
126000 -- (-394.970) [-388.750] (-390.197) (-390.077) * (-395.415) (-392.051) (-395.670) [-392.717] -- 0:00:55
126500 -- [-391.298] (-395.916) (-389.688) (-389.894) * (-396.534) (-390.357) [-389.450] (-392.374) -- 0:00:55
127000 -- [-391.174] (-392.353) (-393.943) (-391.314) * [-392.780] (-389.255) (-390.255) (-389.890) -- 0:00:54
127500 -- (-389.067) (-394.352) [-393.357] (-394.090) * (-392.714) (-392.991) [-389.636] (-390.206) -- 0:00:54
128000 -- [-390.163] (-389.441) (-393.462) (-395.338) * [-391.519] (-390.905) (-390.488) (-391.849) -- 0:00:54
128500 -- (-394.100) (-396.399) [-391.300] (-395.073) * (-392.413) (-397.421) [-391.844] (-390.759) -- 0:00:54
129000 -- [-390.111] (-389.393) (-388.694) (-392.445) * [-390.202] (-389.290) (-392.189) (-393.053) -- 0:00:54
129500 -- (-390.193) (-390.899) [-389.857] (-391.027) * (-392.419) [-388.998] (-390.582) (-393.159) -- 0:00:53
130000 -- (-393.639) (-390.298) [-390.325] (-392.095) * (-391.445) (-389.910) [-390.236] (-391.362) -- 0:00:53
Average standard deviation of split frequencies: 0.015950
130500 -- (-392.801) [-390.310] (-389.692) (-389.713) * [-390.121] (-391.635) (-390.685) (-394.269) -- 0:00:53
131000 -- (-391.385) (-390.596) (-391.553) [-390.386] * [-391.187] (-392.981) (-395.513) (-393.249) -- 0:00:53
131500 -- (-390.996) (-390.723) (-389.266) [-390.375] * (-390.594) [-391.295] (-393.602) (-393.315) -- 0:00:52
132000 -- (-392.455) (-390.507) [-389.428] (-392.859) * (-392.458) (-389.644) [-391.977] (-391.212) -- 0:00:52
132500 -- (-389.909) (-394.678) (-390.301) [-390.515] * (-392.769) [-395.382] (-389.933) (-389.949) -- 0:00:52
133000 -- (-391.427) (-391.514) [-389.438] (-391.129) * (-391.702) [-390.836] (-388.711) (-392.224) -- 0:00:52
133500 -- [-392.614] (-390.695) (-389.188) (-391.733) * (-391.319) (-391.196) [-389.508] (-390.870) -- 0:00:51
134000 -- [-390.387] (-389.178) (-392.218) (-392.337) * (-394.819) [-389.964] (-389.710) (-393.157) -- 0:00:51
134500 -- (-391.489) (-389.135) (-390.354) [-391.468] * (-390.009) (-394.286) [-392.555] (-389.085) -- 0:00:51
135000 -- (-393.344) (-390.654) [-390.346] (-390.218) * (-389.546) [-391.354] (-390.516) (-390.013) -- 0:00:51
Average standard deviation of split frequencies: 0.014057
135500 -- (-388.807) (-391.071) [-394.976] (-390.190) * (-388.949) (-389.526) [-389.628] (-389.430) -- 0:00:51
136000 -- (-390.773) (-391.842) (-394.289) [-389.797] * (-390.865) (-389.980) [-394.660] (-389.359) -- 0:00:50
136500 -- (-392.421) (-390.989) (-389.349) [-392.742] * (-390.106) (-390.846) [-390.800] (-392.612) -- 0:00:50
137000 -- [-392.414] (-391.814) (-390.469) (-391.077) * (-392.507) (-392.218) [-390.712] (-393.719) -- 0:00:50
137500 -- [-392.547] (-394.238) (-394.170) (-389.251) * (-391.871) (-391.543) (-389.231) [-389.995] -- 0:00:50
138000 -- [-395.927] (-391.486) (-391.815) (-389.621) * [-389.545] (-391.453) (-390.168) (-389.838) -- 0:00:56
138500 -- (-390.178) (-395.433) [-390.071] (-389.844) * (-393.030) (-391.972) [-391.769] (-391.897) -- 0:00:55
139000 -- (-391.199) [-389.411] (-392.145) (-390.360) * [-391.386] (-394.880) (-393.624) (-392.391) -- 0:00:55
139500 -- [-389.938] (-389.263) (-390.198) (-389.074) * (-391.799) (-396.058) [-393.080] (-391.715) -- 0:00:55
140000 -- (-390.944) (-392.123) (-394.335) [-390.152] * (-391.309) (-390.460) (-392.595) [-390.243] -- 0:00:55
Average standard deviation of split frequencies: 0.015573
140500 -- (-389.456) (-390.803) [-390.569] (-392.810) * [-390.603] (-390.268) (-389.828) (-395.074) -- 0:00:55
141000 -- (-390.108) (-389.560) [-390.682] (-393.052) * (-391.999) (-390.064) (-389.945) [-393.489] -- 0:00:54
141500 -- (-396.339) (-393.925) (-400.525) [-389.338] * (-389.514) (-389.731) (-393.039) [-389.824] -- 0:00:54
142000 -- (-395.652) [-391.487] (-393.067) (-389.768) * (-391.181) (-391.978) [-390.420] (-389.860) -- 0:00:54
142500 -- (-393.822) (-393.132) [-391.862] (-390.451) * (-391.354) (-392.213) [-391.818] (-390.016) -- 0:00:54
143000 -- (-391.041) (-394.026) (-391.187) [-389.795] * (-391.187) [-389.522] (-390.912) (-390.939) -- 0:00:53
143500 -- (-389.517) [-392.560] (-392.726) (-390.249) * (-398.282) (-390.197) [-389.600] (-390.059) -- 0:00:53
144000 -- (-390.445) (-392.804) (-391.867) [-390.636] * (-396.327) [-390.351] (-389.293) (-390.446) -- 0:00:53
144500 -- (-390.763) [-390.134] (-389.233) (-389.669) * [-391.466] (-390.858) (-389.524) (-390.178) -- 0:00:53
145000 -- [-389.952] (-390.961) (-389.553) (-389.575) * (-390.380) [-390.767] (-392.148) (-391.153) -- 0:00:53
Average standard deviation of split frequencies: 0.016994
145500 -- (-391.520) (-390.559) (-391.134) [-389.296] * (-390.323) [-388.678] (-392.411) (-392.728) -- 0:00:52
146000 -- (-389.900) [-390.074] (-389.526) (-391.799) * (-389.268) [-390.177] (-394.181) (-390.008) -- 0:00:52
146500 -- [-391.325] (-389.997) (-390.833) (-390.212) * (-393.175) (-391.841) (-394.399) [-389.708] -- 0:00:52
147000 -- (-391.672) (-392.483) [-390.387] (-393.703) * (-388.972) [-389.968] (-394.867) (-390.437) -- 0:00:52
147500 -- (-393.492) (-391.374) (-390.464) [-390.119] * [-391.570] (-389.916) (-394.966) (-390.738) -- 0:00:52
148000 -- [-393.338] (-392.262) (-389.281) (-393.347) * [-389.257] (-390.753) (-389.801) (-391.563) -- 0:00:51
148500 -- (-394.145) (-388.738) (-390.528) [-390.926] * (-389.423) (-391.952) (-389.303) [-391.264] -- 0:00:51
149000 -- (-390.806) (-389.907) [-392.840] (-391.470) * [-392.393] (-393.185) (-390.151) (-394.503) -- 0:00:51
149500 -- (-389.901) [-389.238] (-392.388) (-390.162) * (-390.930) (-389.971) [-394.276] (-395.981) -- 0:00:51
150000 -- (-391.786) (-389.588) [-390.293] (-390.289) * (-390.012) [-391.967] (-395.978) (-396.069) -- 0:00:51
Average standard deviation of split frequencies: 0.014491
150500 -- (-390.350) [-391.091] (-390.541) (-390.707) * (-391.042) [-393.952] (-389.520) (-393.323) -- 0:00:50
151000 -- (-391.239) (-391.207) (-395.789) [-390.320] * [-390.826] (-393.206) (-393.726) (-390.796) -- 0:00:50
151500 -- (-392.413) [-391.596] (-397.338) (-390.301) * (-390.752) [-388.877] (-391.904) (-389.805) -- 0:00:50
152000 -- (-391.665) [-388.892] (-391.246) (-392.673) * (-393.718) (-393.858) [-390.493] (-390.947) -- 0:00:50
152500 -- (-394.398) (-391.683) (-391.273) [-390.496] * (-390.343) (-392.258) (-394.037) [-391.642] -- 0:00:50
153000 -- (-392.038) (-389.834) (-389.469) [-391.185] * (-394.226) (-391.544) (-389.800) [-390.660] -- 0:00:49
153500 -- [-389.062] (-389.456) (-391.591) (-392.727) * (-395.140) [-391.160] (-389.136) (-391.295) -- 0:00:49
154000 -- [-389.771] (-389.153) (-390.571) (-390.092) * (-391.365) (-393.881) (-389.206) [-390.389] -- 0:00:49
154500 -- [-392.064] (-390.029) (-389.488) (-388.895) * (-392.395) (-391.269) [-388.924] (-389.681) -- 0:00:49
155000 -- (-390.769) [-390.954] (-394.521) (-391.541) * (-390.251) (-390.824) [-390.012] (-392.896) -- 0:00:54
Average standard deviation of split frequencies: 0.014941
155500 -- (-389.487) [-391.462] (-391.352) (-390.638) * [-389.933] (-389.626) (-392.982) (-390.875) -- 0:00:54
156000 -- (-390.946) (-391.632) [-392.090] (-393.087) * [-390.296] (-390.525) (-390.327) (-395.528) -- 0:00:54
156500 -- (-393.342) [-390.414] (-390.714) (-393.593) * (-394.043) [-390.847] (-391.558) (-391.461) -- 0:00:53
157000 -- (-395.694) [-392.837] (-389.166) (-391.821) * [-391.176] (-393.492) (-390.043) (-395.245) -- 0:00:53
157500 -- (-391.046) [-389.935] (-389.712) (-393.112) * (-391.307) [-389.811] (-392.074) (-390.882) -- 0:00:53
158000 -- (-391.893) (-393.285) (-392.591) [-391.440] * (-389.443) (-389.504) [-392.375] (-390.226) -- 0:00:53
158500 -- (-391.095) (-390.813) (-388.929) [-389.460] * (-389.611) (-395.508) [-389.389] (-391.371) -- 0:00:53
159000 -- (-390.666) (-395.627) [-389.930] (-391.334) * [-389.553] (-390.786) (-390.182) (-391.663) -- 0:00:52
159500 -- [-389.557] (-390.196) (-391.974) (-392.600) * (-390.943) (-389.929) [-389.413] (-390.225) -- 0:00:52
160000 -- [-388.689] (-390.701) (-390.922) (-390.523) * (-389.979) [-394.034] (-389.215) (-390.764) -- 0:00:52
Average standard deviation of split frequencies: 0.016678
160500 -- (-390.041) (-395.341) [-392.006] (-392.177) * (-390.766) (-389.857) [-390.604] (-390.391) -- 0:00:52
161000 -- (-391.335) (-389.520) [-390.531] (-393.354) * (-391.216) (-389.337) [-389.319] (-392.047) -- 0:00:52
161500 -- [-391.719] (-393.472) (-391.376) (-389.778) * (-389.042) (-390.083) (-394.312) [-390.988] -- 0:00:51
162000 -- (-391.702) (-392.773) [-392.262] (-389.667) * (-391.252) (-390.682) [-389.753] (-390.751) -- 0:00:51
162500 -- (-391.442) (-392.776) [-398.629] (-391.187) * (-391.176) (-394.715) (-388.964) [-389.173] -- 0:00:51
163000 -- (-390.936) [-391.583] (-393.426) (-390.881) * (-389.920) [-389.612] (-389.357) (-389.529) -- 0:00:51
163500 -- (-390.751) (-393.630) (-392.369) [-390.972] * [-392.825] (-390.773) (-391.896) (-392.365) -- 0:00:51
164000 -- (-390.171) [-391.302] (-391.465) (-388.897) * (-393.492) (-391.334) [-389.783] (-389.162) -- 0:00:50
164500 -- (-391.651) (-391.784) [-391.174] (-389.201) * [-390.045] (-391.628) (-389.797) (-390.439) -- 0:00:50
165000 -- (-396.462) (-392.714) [-390.011] (-391.116) * (-389.986) [-389.617] (-390.836) (-393.440) -- 0:00:50
Average standard deviation of split frequencies: 0.017181
165500 -- (-391.001) (-392.152) (-393.116) [-392.415] * (-390.695) (-391.574) (-390.225) [-391.062] -- 0:00:50
166000 -- (-390.156) [-392.571] (-391.513) (-390.211) * (-389.896) (-390.686) (-396.330) [-388.962] -- 0:00:50
166500 -- (-389.347) [-389.491] (-391.401) (-391.876) * (-391.709) (-391.978) (-392.781) [-392.448] -- 0:00:50
167000 -- (-394.559) (-391.133) [-389.467] (-394.664) * (-393.197) [-390.439] (-393.330) (-389.998) -- 0:00:49
167500 -- [-391.201] (-390.375) (-391.152) (-390.087) * (-390.130) [-390.294] (-393.199) (-399.362) -- 0:00:49
168000 -- (-393.511) (-388.986) [-394.662] (-391.836) * (-390.264) (-391.473) (-391.707) [-390.690] -- 0:00:49
168500 -- [-388.964] (-390.111) (-394.362) (-391.390) * (-390.986) (-390.602) [-393.126] (-390.088) -- 0:00:49
169000 -- (-389.038) (-391.167) [-390.724] (-391.864) * [-391.358] (-390.028) (-394.039) (-389.317) -- 0:00:49
169500 -- [-389.710] (-391.464) (-392.786) (-389.097) * (-389.217) [-390.521] (-393.112) (-390.375) -- 0:00:48
170000 -- (-389.495) (-391.288) (-390.755) [-390.156] * [-390.660] (-389.530) (-392.966) (-390.482) -- 0:00:48
Average standard deviation of split frequencies: 0.017647
170500 -- (-395.285) (-392.404) [-389.162] (-391.997) * [-390.638] (-391.682) (-390.036) (-394.181) -- 0:00:48
171000 -- (-397.863) (-390.321) [-390.106] (-392.423) * (-391.886) [-390.391] (-390.893) (-393.383) -- 0:00:48
171500 -- (-390.241) [-390.762] (-390.108) (-392.563) * (-389.886) (-395.897) (-398.600) [-389.469] -- 0:00:48
172000 -- (-390.455) (-396.118) [-388.813] (-394.309) * (-390.897) [-390.318] (-393.418) (-389.563) -- 0:00:52
172500 -- [-391.386] (-389.856) (-391.050) (-390.424) * (-395.649) (-390.367) (-390.063) [-389.360] -- 0:00:52
173000 -- (-395.081) [-389.773] (-389.833) (-390.100) * (-394.101) (-391.195) [-390.860] (-390.925) -- 0:00:52
173500 -- (-389.369) (-389.503) [-389.356] (-395.867) * (-389.450) [-391.530] (-390.315) (-392.152) -- 0:00:52
174000 -- (-393.499) [-391.922] (-388.978) (-393.580) * [-390.913] (-393.777) (-391.439) (-390.014) -- 0:00:52
174500 -- [-394.054] (-390.162) (-390.706) (-390.532) * [-389.972] (-391.743) (-393.846) (-390.261) -- 0:00:52
175000 -- [-390.138] (-394.918) (-395.786) (-389.730) * (-396.258) (-397.016) (-393.608) [-390.166] -- 0:00:51
Average standard deviation of split frequencies: 0.015475
175500 -- [-390.899] (-390.396) (-399.353) (-391.997) * (-391.106) [-392.402] (-396.071) (-390.025) -- 0:00:51
176000 -- (-392.254) (-392.940) (-393.101) [-390.557] * [-390.633] (-390.824) (-396.050) (-389.892) -- 0:00:51
176500 -- (-389.726) [-391.137] (-393.085) (-390.805) * (-391.436) [-391.306] (-390.516) (-393.784) -- 0:00:51
177000 -- [-389.969] (-398.508) (-391.484) (-391.879) * [-390.077] (-393.070) (-391.977) (-391.049) -- 0:00:51
177500 -- (-393.171) [-392.487] (-391.522) (-393.309) * (-391.019) (-395.319) (-396.990) [-390.227] -- 0:00:50
178000 -- (-390.426) [-390.884] (-391.072) (-391.777) * [-392.780] (-393.009) (-390.426) (-392.553) -- 0:00:50
178500 -- (-392.424) [-389.629] (-389.190) (-391.804) * [-389.465] (-389.325) (-397.393) (-390.565) -- 0:00:50
179000 -- [-389.867] (-391.180) (-391.257) (-392.578) * [-392.027] (-392.752) (-390.807) (-392.429) -- 0:00:50
179500 -- [-389.973] (-389.659) (-389.814) (-392.767) * (-390.277) (-388.628) [-390.129] (-389.462) -- 0:00:50
180000 -- (-394.705) (-391.402) [-389.590] (-392.155) * (-390.664) (-389.527) (-394.965) [-390.341] -- 0:00:50
Average standard deviation of split frequencies: 0.014931
180500 -- (-394.408) [-390.657] (-391.300) (-392.994) * [-393.183] (-392.295) (-393.129) (-389.834) -- 0:00:49
181000 -- (-389.644) (-389.351) [-390.310] (-389.615) * [-396.714] (-394.465) (-392.517) (-391.620) -- 0:00:49
181500 -- (-389.818) [-390.166] (-389.730) (-392.757) * (-395.720) (-395.457) [-392.849] (-391.974) -- 0:00:49
182000 -- (-391.180) [-391.388] (-392.793) (-389.396) * (-394.589) (-394.131) [-389.815] (-394.960) -- 0:00:49
182500 -- (-391.581) (-391.380) [-390.093] (-392.199) * [-390.772] (-391.443) (-391.836) (-396.140) -- 0:00:49
183000 -- (-390.050) (-391.613) (-390.211) [-390.093] * [-390.871] (-392.788) (-392.950) (-392.710) -- 0:00:49
183500 -- [-392.586] (-393.860) (-392.205) (-388.826) * [-393.944] (-392.573) (-398.884) (-390.890) -- 0:00:48
184000 -- [-391.320] (-391.219) (-389.441) (-391.252) * (-390.226) [-391.527] (-389.486) (-390.518) -- 0:00:48
184500 -- (-391.901) (-391.315) [-389.892] (-388.707) * (-389.641) (-390.978) [-389.794] (-388.981) -- 0:00:48
185000 -- (-390.674) (-390.012) [-389.682] (-391.628) * (-389.239) (-389.659) (-391.039) [-389.272] -- 0:00:48
Average standard deviation of split frequencies: 0.013376
185500 -- [-390.820] (-389.395) (-390.200) (-394.118) * (-389.600) (-388.878) [-390.721] (-395.065) -- 0:00:48
186000 -- (-390.454) (-392.151) [-389.251] (-392.147) * [-390.229] (-389.107) (-392.394) (-391.404) -- 0:00:48
186500 -- (-392.174) (-392.222) (-389.726) [-389.599] * (-390.031) (-390.260) (-396.811) [-393.828] -- 0:00:47
187000 -- (-392.694) (-393.927) (-395.305) [-390.285] * (-389.540) [-390.821] (-392.378) (-391.962) -- 0:00:47
187500 -- [-392.924] (-393.028) (-393.587) (-390.140) * (-389.836) (-389.536) [-389.895] (-389.023) -- 0:00:47
188000 -- (-392.463) (-392.016) (-391.811) [-388.916] * (-391.260) (-389.043) (-390.693) [-390.045] -- 0:00:47
188500 -- (-391.503) (-394.017) [-393.327] (-391.414) * (-389.949) (-394.466) [-393.109] (-389.851) -- 0:00:47
189000 -- [-389.282] (-389.784) (-389.722) (-391.582) * [-389.937] (-392.050) (-389.389) (-391.706) -- 0:00:51
189500 -- (-390.099) (-390.198) (-390.002) [-390.320] * (-390.744) (-391.267) [-392.406] (-394.105) -- 0:00:51
190000 -- [-393.544] (-392.289) (-391.852) (-391.350) * (-390.934) [-390.819] (-390.752) (-391.164) -- 0:00:51
Average standard deviation of split frequencies: 0.013049
190500 -- (-392.146) (-390.102) [-393.344] (-392.770) * (-392.141) [-393.479] (-390.507) (-390.390) -- 0:00:50
191000 -- (-390.894) [-388.692] (-390.905) (-391.764) * (-394.342) (-390.493) (-390.015) [-391.973] -- 0:00:50
191500 -- (-389.650) (-389.915) (-391.463) [-389.797] * (-393.089) (-390.607) [-390.872] (-389.917) -- 0:00:50
192000 -- [-389.579] (-389.592) (-389.913) (-393.282) * (-390.055) [-394.131] (-396.105) (-391.400) -- 0:00:50
192500 -- (-392.048) (-388.801) [-391.084] (-391.348) * (-389.235) (-397.438) (-389.051) [-393.360] -- 0:00:50
193000 -- [-391.888] (-390.398) (-391.770) (-389.793) * (-389.601) (-390.184) (-389.772) [-390.509] -- 0:00:50
193500 -- (-393.317) (-389.750) (-389.143) [-389.562] * (-390.553) (-392.256) [-390.354] (-390.824) -- 0:00:50
194000 -- (-390.177) (-391.557) (-389.845) [-392.030] * [-390.222] (-396.789) (-389.605) (-391.040) -- 0:00:49
194500 -- [-390.839] (-393.002) (-391.287) (-390.048) * (-391.465) (-390.200) [-392.128] (-389.121) -- 0:00:49
195000 -- (-390.401) [-392.186] (-390.850) (-391.146) * (-395.055) (-389.881) (-390.347) [-389.984] -- 0:00:49
Average standard deviation of split frequencies: 0.015366
195500 -- (-391.553) (-391.182) (-390.182) [-390.826] * (-389.597) [-389.452] (-392.585) (-392.232) -- 0:00:49
196000 -- (-388.953) (-391.078) (-390.517) [-390.566] * (-389.718) (-394.298) [-390.112] (-392.718) -- 0:00:49
196500 -- (-391.705) [-390.945] (-391.084) (-393.278) * [-391.167] (-390.740) (-390.230) (-390.344) -- 0:00:49
197000 -- (-391.802) (-392.047) (-390.015) [-392.075] * [-391.370] (-390.969) (-392.841) (-389.049) -- 0:00:48
197500 -- (-391.135) (-391.882) [-389.656] (-392.651) * (-391.321) (-389.583) (-392.678) [-389.875] -- 0:00:48
198000 -- (-390.842) (-389.577) [-389.538] (-390.872) * (-389.672) (-390.098) [-389.062] (-389.196) -- 0:00:48
198500 -- (-391.863) (-394.312) (-393.926) [-388.937] * (-391.949) (-392.342) [-389.616] (-391.546) -- 0:00:48
199000 -- (-391.842) (-389.986) (-394.633) [-389.498] * (-390.479) [-392.124] (-388.582) (-391.840) -- 0:00:48
199500 -- (-391.052) (-390.903) (-393.427) [-390.253] * (-390.627) (-390.827) [-390.147] (-391.087) -- 0:00:48
200000 -- (-389.271) (-390.597) [-393.286] (-393.597) * [-392.776] (-392.314) (-391.002) (-390.316) -- 0:00:48
Average standard deviation of split frequencies: 0.016705
200500 -- (-389.093) [-390.080] (-390.864) (-393.701) * (-391.215) (-393.315) (-391.865) [-393.407] -- 0:00:47
201000 -- (-391.476) (-390.010) [-392.464] (-390.870) * (-394.010) (-393.014) (-392.419) [-394.553] -- 0:00:47
201500 -- (-396.613) (-389.038) (-390.002) [-390.699] * (-392.689) (-393.567) (-395.090) [-390.131] -- 0:00:47
202000 -- (-391.307) (-389.015) [-390.530] (-393.837) * (-390.652) [-391.019] (-391.752) (-393.925) -- 0:00:47
202500 -- (-391.533) [-392.618] (-388.866) (-393.395) * (-390.176) [-394.159] (-391.172) (-390.585) -- 0:00:47
203000 -- (-395.685) (-389.006) [-389.376] (-391.546) * (-394.449) (-393.476) (-391.380) [-391.135] -- 0:00:47
203500 -- (-392.857) [-393.281] (-390.919) (-390.887) * (-390.565) (-390.846) (-392.885) [-391.579] -- 0:00:46
204000 -- [-391.819] (-391.322) (-391.865) (-391.589) * (-390.750) [-389.195] (-392.939) (-390.073) -- 0:00:46
204500 -- [-389.802] (-394.352) (-392.590) (-389.409) * (-390.350) (-391.072) [-392.375] (-392.899) -- 0:00:46
205000 -- (-390.917) [-393.776] (-390.676) (-389.247) * (-390.004) (-389.818) (-391.475) [-393.101] -- 0:00:46
Average standard deviation of split frequencies: 0.015537
205500 -- [-392.256] (-392.745) (-390.528) (-390.502) * (-394.631) [-390.219] (-391.355) (-390.843) -- 0:00:46
206000 -- (-394.872) (-389.789) [-389.112] (-391.971) * (-391.404) (-390.063) [-390.162] (-394.478) -- 0:00:50
206500 -- (-392.081) [-390.304] (-389.681) (-389.063) * (-391.173) (-392.768) (-392.843) [-391.272] -- 0:00:49
207000 -- [-391.880] (-392.566) (-391.592) (-389.994) * [-389.255] (-391.202) (-389.716) (-393.541) -- 0:00:49
207500 -- (-395.657) [-390.515] (-391.825) (-394.229) * [-391.251] (-392.815) (-391.677) (-390.010) -- 0:00:49
208000 -- (-391.410) (-394.165) (-395.689) [-391.676] * (-392.072) (-394.991) (-394.215) [-390.222] -- 0:00:49
208500 -- [-389.025] (-390.691) (-392.270) (-389.627) * (-390.832) [-390.766] (-389.966) (-391.405) -- 0:00:49
209000 -- (-389.183) [-390.433] (-393.654) (-390.939) * [-389.249] (-391.505) (-390.964) (-391.572) -- 0:00:49
209500 -- (-394.384) (-391.887) [-392.302] (-390.283) * (-392.173) [-389.990] (-391.880) (-393.533) -- 0:00:49
210000 -- (-391.395) (-391.995) [-391.342] (-389.587) * (-391.456) (-390.639) [-391.358] (-392.767) -- 0:00:48
Average standard deviation of split frequencies: 0.015401
210500 -- (-391.995) (-390.504) (-390.349) [-390.939] * [-390.566] (-392.246) (-394.165) (-392.087) -- 0:00:48
211000 -- [-392.496] (-390.577) (-393.154) (-391.766) * (-390.466) [-391.105] (-391.123) (-394.926) -- 0:00:48
211500 -- (-392.898) [-394.573] (-390.414) (-392.784) * (-390.374) (-391.047) (-389.785) [-391.159] -- 0:00:48
212000 -- [-390.430] (-395.215) (-391.608) (-392.049) * (-391.559) (-389.919) (-389.130) [-391.820] -- 0:00:48
212500 -- (-391.731) (-393.522) [-389.081] (-393.368) * (-391.722) (-389.894) (-390.274) [-393.977] -- 0:00:48
213000 -- [-390.967] (-392.070) (-389.897) (-390.198) * (-389.496) (-390.292) [-390.892] (-390.361) -- 0:00:48
213500 -- (-388.935) (-391.742) [-390.479] (-389.679) * (-392.605) [-389.759] (-392.001) (-393.413) -- 0:00:47
214000 -- (-390.675) [-389.669] (-392.684) (-389.976) * (-392.953) (-389.947) [-391.278] (-388.839) -- 0:00:47
214500 -- (-391.648) (-394.415) [-391.543] (-389.704) * (-394.821) (-390.896) [-390.833] (-389.693) -- 0:00:47
215000 -- (-394.481) [-391.273] (-390.417) (-390.442) * (-391.286) (-389.867) [-390.301] (-393.191) -- 0:00:47
Average standard deviation of split frequencies: 0.016176
215500 -- [-391.495] (-391.078) (-389.767) (-391.492) * (-390.000) (-394.096) (-391.276) [-389.794] -- 0:00:47
216000 -- (-394.823) (-390.548) (-389.686) [-390.859] * [-391.061] (-389.368) (-390.267) (-390.875) -- 0:00:47
216500 -- (-391.356) (-390.215) (-392.482) [-389.785] * (-388.897) [-389.461] (-393.721) (-389.599) -- 0:00:47
217000 -- (-389.752) [-390.080] (-393.484) (-389.968) * (-391.590) (-389.574) (-393.465) [-391.433] -- 0:00:46
217500 -- (-389.548) [-389.512] (-391.844) (-396.344) * (-389.226) [-390.496] (-392.624) (-389.097) -- 0:00:46
218000 -- [-392.626] (-390.111) (-388.968) (-396.877) * (-390.108) [-391.431] (-390.619) (-389.310) -- 0:00:46
218500 -- (-390.225) [-391.105] (-390.357) (-393.223) * (-392.253) (-400.860) [-389.737] (-389.904) -- 0:00:46
219000 -- (-393.528) [-390.028] (-388.990) (-398.224) * (-390.239) (-390.616) (-391.779) [-389.872] -- 0:00:46
219500 -- (-395.151) [-391.846] (-388.879) (-394.657) * [-390.561] (-395.385) (-392.174) (-392.953) -- 0:00:46
220000 -- (-395.136) (-390.876) [-392.612] (-389.946) * (-393.388) (-391.015) (-391.812) [-394.763] -- 0:00:46
Average standard deviation of split frequencies: 0.016713
220500 -- (-389.581) (-394.521) [-390.201] (-390.166) * (-391.679) (-391.878) [-392.816] (-389.740) -- 0:00:45
221000 -- (-390.363) (-390.628) [-391.952] (-393.770) * [-392.283] (-390.536) (-394.661) (-391.561) -- 0:00:45
221500 -- [-389.803] (-396.402) (-392.816) (-393.734) * [-394.311] (-389.471) (-390.122) (-392.946) -- 0:00:45
222000 -- (-394.032) (-392.270) [-389.458] (-391.527) * (-389.575) (-389.347) (-391.563) [-390.821] -- 0:00:45
222500 -- (-389.565) [-392.192] (-393.711) (-390.360) * (-394.836) (-389.222) [-391.669] (-390.300) -- 0:00:45
223000 -- [-389.922] (-391.238) (-389.260) (-389.617) * (-396.153) [-390.799] (-389.302) (-388.951) -- 0:00:48
223500 -- (-390.076) (-389.245) [-388.958] (-392.214) * (-390.623) (-389.739) (-391.904) [-391.480] -- 0:00:48
224000 -- [-389.716] (-392.813) (-389.013) (-394.235) * (-392.465) (-391.047) [-389.809] (-392.063) -- 0:00:48
224500 -- (-391.970) (-390.891) (-390.049) [-390.469] * (-388.990) (-390.604) [-391.863] (-390.504) -- 0:00:48
225000 -- (-391.295) (-392.593) (-392.530) [-389.440] * (-392.310) [-390.953] (-389.085) (-391.064) -- 0:00:48
Average standard deviation of split frequencies: 0.016919
225500 -- [-390.694] (-390.824) (-391.513) (-389.590) * (-391.598) [-390.713] (-390.043) (-391.434) -- 0:00:48
226000 -- [-389.964] (-393.233) (-390.675) (-391.311) * [-390.432] (-390.242) (-391.544) (-393.769) -- 0:00:47
226500 -- (-393.367) (-391.033) (-389.868) [-392.620] * (-391.261) [-394.903] (-393.625) (-389.331) -- 0:00:47
227000 -- (-394.398) [-391.011] (-391.222) (-393.836) * (-389.039) (-390.501) (-389.757) [-390.479] -- 0:00:47
227500 -- (-394.517) (-390.102) (-389.680) [-390.417] * (-391.138) [-392.521] (-389.217) (-390.825) -- 0:00:47
228000 -- (-390.838) (-392.914) (-395.090) [-389.296] * (-393.732) [-392.518] (-388.675) (-391.450) -- 0:00:47
228500 -- [-391.736] (-390.760) (-393.858) (-394.866) * [-390.356] (-389.966) (-389.678) (-391.419) -- 0:00:47
229000 -- (-390.799) [-389.758] (-388.927) (-393.204) * (-394.252) [-390.489] (-391.161) (-394.131) -- 0:00:47
229500 -- (-392.977) (-390.356) (-389.623) [-390.816] * (-391.040) [-389.698] (-392.454) (-391.873) -- 0:00:47
230000 -- [-390.336] (-390.142) (-390.457) (-390.102) * (-393.209) (-390.542) (-391.206) [-391.268] -- 0:00:46
Average standard deviation of split frequencies: 0.015704
230500 -- (-391.373) (-392.210) [-391.657] (-392.138) * (-390.623) (-391.290) [-391.146] (-390.734) -- 0:00:46
231000 -- (-388.920) (-392.018) (-396.244) [-389.132] * (-389.849) (-389.722) (-394.921) [-390.637] -- 0:00:46
231500 -- (-395.476) (-390.612) (-394.240) [-388.805] * [-394.633] (-391.308) (-390.718) (-392.846) -- 0:00:46
232000 -- (-392.083) (-391.009) (-389.301) [-390.236] * (-395.138) (-397.300) (-391.070) [-390.331] -- 0:00:46
232500 -- (-389.744) [-389.952] (-389.455) (-395.566) * (-390.878) (-393.331) [-390.166] (-393.693) -- 0:00:46
233000 -- (-389.332) (-389.535) [-394.195] (-390.014) * (-392.726) (-392.372) [-390.737] (-391.833) -- 0:00:46
233500 -- (-390.138) (-390.684) (-389.585) [-391.337] * (-391.363) (-391.890) [-395.078] (-389.773) -- 0:00:45
234000 -- (-389.488) (-390.684) (-388.988) [-392.379] * (-390.203) (-391.054) [-393.055] (-390.124) -- 0:00:45
234500 -- [-390.092] (-390.915) (-389.132) (-394.229) * (-390.320) (-392.574) [-390.220] (-390.599) -- 0:00:45
235000 -- (-391.548) (-390.587) [-388.886] (-389.633) * (-390.665) (-391.737) (-390.547) [-390.260] -- 0:00:45
Average standard deviation of split frequencies: 0.015510
235500 -- [-391.674] (-395.557) (-390.543) (-390.496) * [-390.509] (-391.325) (-392.870) (-390.863) -- 0:00:45
236000 -- (-388.963) [-390.190] (-391.014) (-391.759) * (-391.086) (-391.164) (-390.346) [-391.704] -- 0:00:45
236500 -- (-390.474) (-392.013) [-392.481] (-391.208) * (-390.937) [-391.359] (-390.472) (-390.521) -- 0:00:45
237000 -- [-389.233] (-392.579) (-393.426) (-393.611) * (-389.674) (-391.708) [-390.917] (-392.192) -- 0:00:45
237500 -- (-391.592) [-393.627] (-390.584) (-390.993) * (-393.562) [-392.455] (-390.704) (-393.515) -- 0:00:44
238000 -- (-388.901) (-392.874) [-390.038] (-390.262) * (-393.048) [-389.820] (-393.412) (-390.377) -- 0:00:44
238500 -- (-392.514) (-390.673) (-392.251) [-389.745] * (-390.223) (-392.678) [-390.759] (-389.743) -- 0:00:44
239000 -- (-389.571) [-391.016] (-388.623) (-390.800) * (-390.053) (-390.188) (-388.741) [-392.711] -- 0:00:44
239500 -- (-395.329) (-389.817) [-390.244] (-390.417) * (-393.405) (-389.711) (-389.564) [-389.455] -- 0:00:47
240000 -- (-393.548) [-389.741] (-391.411) (-392.101) * (-391.745) [-389.372] (-389.053) (-390.165) -- 0:00:47
Average standard deviation of split frequencies: 0.016541
240500 -- (-390.283) (-392.883) [-389.421] (-391.321) * (-391.182) [-390.760] (-396.466) (-390.619) -- 0:00:47
241000 -- (-389.609) [-391.312] (-392.035) (-390.889) * (-390.426) (-389.694) (-395.652) [-391.514] -- 0:00:47
241500 -- (-389.427) (-390.004) (-390.601) [-390.636] * [-389.875] (-390.915) (-394.350) (-390.027) -- 0:00:47
242000 -- [-389.887] (-390.555) (-395.853) (-389.672) * (-392.419) (-392.261) (-390.242) [-391.832] -- 0:00:46
242500 -- (-390.533) (-389.477) [-393.028] (-391.657) * (-392.535) (-389.462) (-391.921) [-391.495] -- 0:00:46
243000 -- (-390.476) (-389.337) (-390.322) [-389.154] * (-395.009) (-389.326) (-390.470) [-392.076] -- 0:00:46
243500 -- (-391.673) (-388.967) (-393.588) [-390.266] * (-389.458) (-389.961) (-391.747) [-391.461] -- 0:00:46
244000 -- (-391.115) [-390.029] (-396.605) (-391.106) * [-391.840] (-390.052) (-390.403) (-392.809) -- 0:00:46
244500 -- (-393.737) [-390.434] (-392.673) (-389.834) * (-390.401) (-392.811) [-388.958] (-388.792) -- 0:00:46
245000 -- (-393.219) (-391.011) [-391.264] (-390.370) * (-390.283) (-393.460) (-391.466) [-388.971] -- 0:00:46
Average standard deviation of split frequencies: 0.015935
245500 -- (-390.903) [-390.957] (-395.489) (-389.802) * (-391.187) (-392.622) [-393.538] (-390.517) -- 0:00:46
246000 -- (-389.623) [-392.166] (-393.172) (-390.281) * (-389.589) [-396.544] (-393.553) (-392.186) -- 0:00:45
246500 -- (-390.551) (-389.053) [-389.504] (-390.346) * (-389.688) (-393.679) [-391.327] (-389.232) -- 0:00:45
247000 -- [-390.626] (-390.638) (-391.677) (-391.704) * (-390.813) [-390.797] (-389.687) (-399.538) -- 0:00:45
247500 -- (-391.905) [-394.676] (-392.304) (-392.443) * (-389.877) (-390.719) [-389.607] (-390.182) -- 0:00:45
248000 -- (-391.234) [-391.026] (-388.945) (-391.810) * [-391.642] (-394.671) (-388.931) (-388.882) -- 0:00:45
248500 -- (-391.495) (-393.726) (-389.408) [-389.002] * [-391.221] (-392.621) (-389.527) (-390.049) -- 0:00:45
249000 -- (-391.443) (-390.568) (-390.431) [-390.347] * [-391.379] (-390.548) (-389.347) (-392.234) -- 0:00:45
249500 -- [-390.276] (-389.381) (-391.310) (-392.161) * (-391.224) (-390.651) (-391.605) [-388.674] -- 0:00:45
250000 -- (-390.115) (-389.855) (-391.221) [-390.257] * (-391.484) (-392.063) (-389.195) [-391.543] -- 0:00:45
Average standard deviation of split frequencies: 0.016716
250500 -- (-390.048) (-390.138) [-389.892] (-391.256) * [-389.616] (-389.248) (-392.705) (-390.153) -- 0:00:44
251000 -- (-391.194) (-392.938) [-389.758] (-389.364) * [-389.046] (-391.512) (-392.835) (-389.630) -- 0:00:44
251500 -- (-392.072) (-390.425) (-393.314) [-391.016] * (-389.364) (-391.743) [-389.547] (-390.278) -- 0:00:44
252000 -- [-395.213] (-390.038) (-392.978) (-389.498) * [-393.362] (-390.856) (-391.088) (-393.708) -- 0:00:44
252500 -- (-393.274) (-390.998) [-391.023] (-388.927) * (-395.032) (-390.970) [-392.135] (-392.415) -- 0:00:44
253000 -- (-391.537) (-392.296) [-391.451] (-389.427) * (-392.699) (-389.878) (-394.138) [-392.367] -- 0:00:44
253500 -- [-393.820] (-390.192) (-390.459) (-390.950) * (-393.070) (-391.078) (-394.392) [-391.236] -- 0:00:44
254000 -- [-394.002] (-389.327) (-391.328) (-393.070) * (-390.464) [-391.665] (-393.397) (-391.235) -- 0:00:44
254500 -- (-390.643) [-389.047] (-393.384) (-389.950) * [-390.483] (-391.170) (-390.881) (-390.946) -- 0:00:43
255000 -- (-390.194) (-389.660) [-389.129] (-390.641) * (-389.254) (-389.992) (-389.147) [-389.319] -- 0:00:43
Average standard deviation of split frequencies: 0.016464
255500 -- (-389.518) (-394.151) (-390.728) [-390.443] * [-392.675] (-394.424) (-392.366) (-391.406) -- 0:00:43
256000 -- (-389.889) (-392.329) [-391.392] (-390.871) * (-390.992) (-394.790) [-392.005] (-389.446) -- 0:00:43
256500 -- (-394.084) [-390.459] (-389.243) (-389.812) * (-391.959) [-392.390] (-391.719) (-393.100) -- 0:00:46
257000 -- (-390.905) (-391.695) (-392.094) [-389.872] * (-390.636) (-392.131) (-392.156) [-391.177] -- 0:00:46
257500 -- (-390.068) (-389.429) (-392.051) [-388.768] * (-392.851) [-391.445] (-391.097) (-395.750) -- 0:00:46
258000 -- (-399.062) (-389.367) [-390.839] (-390.034) * (-391.041) (-389.481) [-392.144] (-391.285) -- 0:00:46
258500 -- [-391.217] (-391.816) (-391.368) (-390.429) * [-389.767] (-391.133) (-392.612) (-391.254) -- 0:00:45
259000 -- (-393.659) (-390.676) [-389.825] (-388.960) * (-389.351) [-389.738] (-398.237) (-390.745) -- 0:00:45
259500 -- [-389.956] (-392.525) (-392.309) (-393.478) * (-390.505) [-390.002] (-391.358) (-389.995) -- 0:00:45
260000 -- (-392.042) (-395.470) [-392.764] (-393.808) * (-392.032) [-392.216] (-390.304) (-390.378) -- 0:00:45
Average standard deviation of split frequencies: 0.015975
260500 -- (-392.324) [-392.372] (-391.885) (-394.773) * [-393.220] (-393.014) (-389.890) (-393.091) -- 0:00:45
261000 -- (-393.114) [-390.083] (-390.823) (-392.277) * [-392.953] (-391.985) (-391.585) (-389.612) -- 0:00:45
261500 -- (-390.441) [-389.454] (-391.649) (-389.125) * (-390.622) [-391.588] (-391.221) (-389.597) -- 0:00:45
262000 -- [-389.597] (-390.123) (-392.699) (-391.531) * (-389.535) (-393.266) (-390.251) [-392.409] -- 0:00:45
262500 -- (-392.812) (-392.922) (-391.125) [-390.608] * [-389.971] (-391.260) (-394.882) (-390.044) -- 0:00:44
263000 -- (-391.297) (-395.395) (-390.748) [-389.017] * (-392.693) [-390.101] (-391.158) (-390.072) -- 0:00:44
263500 -- (-392.884) (-391.026) [-389.829] (-390.352) * [-391.633] (-391.232) (-391.323) (-391.110) -- 0:00:44
264000 -- (-392.807) (-390.725) [-389.197] (-389.088) * (-390.330) (-390.061) [-390.857] (-397.407) -- 0:00:44
264500 -- (-389.682) [-391.082] (-390.372) (-390.467) * (-389.635) (-391.329) (-394.176) [-400.019] -- 0:00:44
265000 -- [-389.255] (-390.473) (-389.621) (-389.142) * (-391.452) (-390.141) (-391.016) [-393.091] -- 0:00:44
Average standard deviation of split frequencies: 0.017162
265500 -- (-389.020) (-391.913) (-389.055) [-390.717] * (-392.787) [-390.975] (-391.961) (-395.143) -- 0:00:44
266000 -- (-394.021) [-392.823] (-388.891) (-392.268) * [-389.239] (-392.547) (-392.832) (-393.319) -- 0:00:44
266500 -- [-390.285] (-398.530) (-391.625) (-396.581) * [-390.341] (-389.282) (-391.317) (-390.151) -- 0:00:44
267000 -- (-394.021) (-390.902) [-391.878] (-394.267) * (-389.781) (-392.599) (-390.807) [-391.181] -- 0:00:43
267500 -- (-396.133) [-389.674] (-390.247) (-393.805) * (-390.274) (-388.633) [-395.741] (-392.121) -- 0:00:43
268000 -- (-392.251) (-389.654) (-390.271) [-392.105] * (-390.340) (-393.093) (-392.813) [-390.800] -- 0:00:43
268500 -- (-391.684) (-393.757) [-392.631] (-389.131) * (-391.996) [-391.207] (-391.580) (-389.947) -- 0:00:43
269000 -- [-391.146] (-390.249) (-392.636) (-390.726) * (-389.996) [-391.900] (-390.065) (-389.350) -- 0:00:43
269500 -- (-393.763) (-389.203) [-389.417] (-394.685) * [-395.263] (-389.702) (-390.107) (-392.665) -- 0:00:43
270000 -- [-391.436] (-391.452) (-389.222) (-391.092) * (-389.091) (-390.150) (-390.279) [-389.898] -- 0:00:43
Average standard deviation of split frequencies: 0.017050
270500 -- (-389.768) [-392.151] (-389.965) (-390.927) * [-389.880] (-389.677) (-390.887) (-390.439) -- 0:00:43
271000 -- [-390.606] (-389.747) (-391.047) (-390.437) * (-389.901) [-391.987] (-390.783) (-390.536) -- 0:00:43
271500 -- (-400.061) [-388.964] (-392.017) (-395.801) * (-396.643) (-398.163) [-390.013] (-392.168) -- 0:00:42
272000 -- (-391.518) [-392.159] (-392.831) (-390.492) * (-391.003) (-391.800) [-390.276] (-392.479) -- 0:00:42
272500 -- (-390.355) (-389.706) [-392.063] (-392.891) * [-390.571] (-392.702) (-391.657) (-388.879) -- 0:00:42
273000 -- (-393.024) (-390.614) (-391.863) [-390.325] * (-390.676) [-388.835] (-388.943) (-389.138) -- 0:00:42
273500 -- (-392.973) (-391.186) (-392.924) [-389.504] * (-392.759) (-391.217) (-392.763) [-391.171] -- 0:00:45
274000 -- [-389.744] (-389.611) (-392.568) (-390.750) * (-390.812) (-390.410) [-389.621] (-390.409) -- 0:00:45
274500 -- (-390.897) (-391.459) (-390.673) [-389.111] * [-390.674] (-390.066) (-391.744) (-395.399) -- 0:00:44
275000 -- (-393.031) [-389.752] (-394.693) (-388.999) * (-392.144) [-390.894] (-388.687) (-394.589) -- 0:00:44
Average standard deviation of split frequencies: 0.017839
275500 -- (-393.193) [-389.192] (-394.880) (-390.298) * (-391.337) (-388.769) [-391.780] (-393.298) -- 0:00:44
276000 -- [-390.882] (-390.263) (-388.794) (-389.711) * (-390.197) (-391.045) [-390.717] (-392.509) -- 0:00:44
276500 -- (-390.961) [-388.980] (-389.746) (-390.589) * (-390.270) (-389.798) [-390.589] (-392.448) -- 0:00:44
277000 -- [-396.549] (-390.039) (-389.949) (-391.367) * (-392.808) (-391.755) [-393.488] (-390.274) -- 0:00:44
277500 -- (-390.513) (-390.061) (-390.638) [-393.064] * (-389.995) (-392.411) [-392.033] (-392.374) -- 0:00:44
278000 -- (-390.647) (-391.681) [-390.977] (-389.238) * [-390.160] (-391.814) (-390.828) (-391.841) -- 0:00:44
278500 -- (-390.433) (-390.992) (-393.532) [-392.329] * (-390.266) (-392.118) [-389.081] (-394.016) -- 0:00:44
279000 -- (-390.123) [-391.717] (-390.619) (-393.937) * (-389.297) (-389.751) (-391.446) [-390.619] -- 0:00:43
279500 -- (-389.639) (-391.578) (-390.097) [-391.728] * (-389.978) (-389.772) (-391.821) [-390.773] -- 0:00:43
280000 -- (-394.353) [-389.571] (-389.315) (-391.091) * [-391.806] (-389.214) (-400.012) (-390.643) -- 0:00:43
Average standard deviation of split frequencies: 0.018569
280500 -- [-390.813] (-389.597) (-389.715) (-390.649) * (-392.920) [-389.572] (-395.335) (-389.459) -- 0:00:43
281000 -- (-395.062) (-390.581) [-395.297] (-393.905) * (-392.292) [-390.107] (-392.868) (-390.017) -- 0:00:43
281500 -- (-391.121) (-390.660) (-391.365) [-391.228] * [-391.102] (-390.888) (-398.074) (-389.882) -- 0:00:43
282000 -- (-390.891) [-389.190] (-395.562) (-391.064) * (-392.667) (-392.194) [-390.052] (-390.226) -- 0:00:43
282500 -- (-391.341) (-394.698) (-393.117) [-388.902] * (-392.636) (-391.307) (-391.212) [-391.916] -- 0:00:43
283000 -- (-393.377) (-391.927) [-393.940] (-390.666) * (-391.246) [-390.011] (-390.508) (-393.766) -- 0:00:43
283500 -- (-394.463) [-391.460] (-392.213) (-390.750) * (-395.919) (-389.953) [-389.568] (-390.981) -- 0:00:42
284000 -- (-391.619) [-392.838] (-393.602) (-389.006) * [-392.148] (-389.308) (-392.170) (-389.782) -- 0:00:42
284500 -- (-391.171) (-390.304) (-389.524) [-389.316] * (-391.783) [-389.949] (-395.215) (-394.677) -- 0:00:42
285000 -- (-392.106) [-389.319] (-393.382) (-393.029) * [-389.423] (-392.258) (-395.346) (-390.651) -- 0:00:42
Average standard deviation of split frequencies: 0.018589
285500 -- (-389.694) (-392.993) (-390.458) [-392.163] * (-389.867) (-388.896) [-389.341] (-392.645) -- 0:00:42
286000 -- (-389.222) (-389.015) [-391.033] (-399.911) * (-390.943) [-389.138] (-392.037) (-396.501) -- 0:00:42
286500 -- [-392.498] (-391.539) (-389.995) (-397.594) * (-389.943) (-391.748) [-391.744] (-393.077) -- 0:00:42
287000 -- (-389.724) [-389.520] (-390.570) (-391.356) * (-390.924) (-394.398) [-389.195] (-389.788) -- 0:00:42
287500 -- [-389.951] (-392.533) (-397.294) (-393.801) * (-388.874) [-392.486] (-389.611) (-391.452) -- 0:00:42
288000 -- [-391.981] (-391.189) (-392.480) (-392.903) * [-389.676] (-393.693) (-388.897) (-398.951) -- 0:00:42
288500 -- (-391.571) (-389.298) [-391.879] (-392.536) * (-390.952) [-390.375] (-394.549) (-392.535) -- 0:00:41
289000 -- (-392.170) (-391.220) [-394.610] (-394.795) * (-391.066) (-390.345) (-389.451) [-393.919] -- 0:00:41
289500 -- (-392.055) (-390.475) [-389.944] (-390.149) * (-390.176) [-389.922] (-391.637) (-394.756) -- 0:00:41
290000 -- (-389.488) (-390.310) (-392.437) [-391.043] * [-391.049] (-391.628) (-390.820) (-389.707) -- 0:00:41
Average standard deviation of split frequencies: 0.018561
290500 -- (-392.360) [-394.695] (-389.812) (-389.848) * (-394.670) [-390.912] (-392.319) (-388.968) -- 0:00:43
291000 -- (-392.305) (-390.580) [-390.638] (-389.631) * [-393.848] (-390.138) (-390.022) (-391.729) -- 0:00:43
291500 -- (-391.410) (-394.903) [-392.833] (-390.328) * (-391.891) (-392.575) (-390.385) [-393.318] -- 0:00:43
292000 -- (-394.809) (-392.022) (-394.315) [-390.548] * [-389.448] (-395.239) (-391.007) (-392.623) -- 0:00:43
292500 -- (-391.534) (-389.128) [-390.281] (-389.247) * [-389.223] (-392.069) (-391.068) (-395.414) -- 0:00:43
293000 -- [-391.046] (-389.132) (-392.457) (-389.302) * (-392.425) (-389.359) [-390.711] (-391.914) -- 0:00:43
293500 -- [-389.238] (-391.546) (-390.345) (-392.946) * (-390.247) (-394.321) [-393.136] (-390.412) -- 0:00:43
294000 -- (-393.525) (-391.407) (-392.760) [-390.761] * (-390.430) (-391.089) [-391.271] (-390.476) -- 0:00:43
294500 -- (-390.623) (-390.468) (-391.944) [-391.227] * (-389.994) [-388.952] (-397.714) (-389.720) -- 0:00:43
295000 -- [-391.162] (-394.529) (-389.806) (-393.835) * [-390.278] (-389.828) (-394.236) (-388.890) -- 0:00:43
Average standard deviation of split frequencies: 0.017854
295500 -- (-393.551) [-390.039] (-390.788) (-392.270) * (-391.715) (-393.003) (-391.406) [-392.275] -- 0:00:42
296000 -- (-389.492) [-389.447] (-392.186) (-392.162) * (-391.637) [-391.066] (-391.549) (-392.500) -- 0:00:42
296500 -- (-389.994) (-390.372) [-390.632] (-395.534) * (-392.559) (-393.620) [-395.067] (-390.539) -- 0:00:42
297000 -- [-391.312] (-392.414) (-391.946) (-393.253) * (-391.642) [-393.608] (-391.179) (-389.926) -- 0:00:42
297500 -- (-389.983) (-393.215) (-392.757) [-392.019] * (-390.389) (-395.210) (-389.871) [-390.862] -- 0:00:42
298000 -- (-391.539) (-397.382) (-390.470) [-390.815] * (-389.791) (-392.480) (-390.507) [-390.103] -- 0:00:42
298500 -- (-390.387) [-391.676] (-394.422) (-395.968) * (-388.646) (-390.527) (-390.255) [-390.687] -- 0:00:42
299000 -- (-390.432) (-393.624) (-392.152) [-389.502] * (-388.799) (-393.128) (-393.943) [-391.052] -- 0:00:42
299500 -- (-390.368) (-390.020) (-393.555) [-396.526] * (-389.717) [-390.982] (-390.532) (-394.605) -- 0:00:42
300000 -- [-390.631] (-392.258) (-390.853) (-392.896) * (-394.798) (-390.197) [-389.895] (-389.733) -- 0:00:42
Average standard deviation of split frequencies: 0.016724
300500 -- (-392.435) [-390.388] (-389.317) (-390.054) * (-390.275) (-389.789) [-390.257] (-391.696) -- 0:00:41
301000 -- (-392.240) [-390.409] (-389.610) (-390.523) * (-389.216) [-393.331] (-391.064) (-389.909) -- 0:00:41
301500 -- (-397.638) [-390.406] (-390.853) (-393.504) * (-390.278) (-390.639) (-391.631) [-390.701] -- 0:00:41
302000 -- [-392.015] (-390.972) (-390.119) (-389.954) * (-389.819) (-392.566) (-391.250) [-394.750] -- 0:00:41
302500 -- (-398.199) (-389.685) [-390.323] (-395.027) * (-390.571) (-391.757) (-391.573) [-390.422] -- 0:00:41
303000 -- (-391.329) (-390.244) (-391.532) [-389.302] * (-390.387) [-389.827] (-391.135) (-391.827) -- 0:00:41
303500 -- (-392.536) (-390.507) (-390.213) [-396.051] * (-389.072) (-390.634) (-394.263) [-389.773] -- 0:00:41
304000 -- (-390.426) (-390.581) [-389.479] (-392.062) * (-389.898) [-391.432] (-394.119) (-391.421) -- 0:00:41
304500 -- [-391.437] (-393.033) (-388.768) (-390.762) * [-389.230] (-392.313) (-389.834) (-392.165) -- 0:00:41
305000 -- (-390.550) [-389.832] (-390.465) (-391.572) * [-390.706] (-390.842) (-389.511) (-394.008) -- 0:00:41
Average standard deviation of split frequencies: 0.017108
305500 -- (-390.013) (-390.136) [-390.349] (-390.524) * (-390.818) [-388.676] (-389.473) (-392.365) -- 0:00:40
306000 -- (-390.496) (-389.822) [-390.135] (-390.225) * (-392.032) (-390.177) [-390.648] (-390.515) -- 0:00:40
306500 -- [-391.564] (-392.160) (-391.120) (-391.022) * (-400.705) [-391.328] (-391.101) (-391.147) -- 0:00:40
307000 -- (-395.262) (-389.576) (-391.188) [-390.045] * [-393.041] (-391.511) (-392.728) (-390.668) -- 0:00:42
307500 -- (-394.780) [-390.521] (-390.006) (-390.695) * (-391.318) [-391.575] (-392.280) (-389.550) -- 0:00:42
308000 -- [-393.390] (-389.153) (-391.552) (-391.582) * [-391.668] (-390.485) (-391.363) (-391.625) -- 0:00:42
308500 -- (-394.873) (-390.984) [-390.587] (-390.461) * (-390.737) (-388.896) (-391.395) [-392.408] -- 0:00:42
309000 -- (-391.421) [-391.205] (-390.128) (-395.260) * (-390.279) [-390.608] (-389.281) (-390.612) -- 0:00:42
309500 -- (-391.763) (-393.478) (-389.956) [-390.678] * (-392.528) (-394.078) [-389.389] (-392.531) -- 0:00:42
310000 -- (-394.782) [-389.225] (-389.098) (-391.036) * (-391.728) (-390.221) [-389.952] (-391.189) -- 0:00:42
Average standard deviation of split frequencies: 0.017730
310500 -- (-389.845) [-391.062] (-390.843) (-392.557) * (-391.140) (-395.457) (-391.421) [-389.569] -- 0:00:42
311000 -- (-390.708) [-388.848] (-390.397) (-394.102) * (-391.481) (-390.335) (-395.637) [-389.820] -- 0:00:42
311500 -- (-392.859) (-390.822) [-391.596] (-394.722) * (-393.378) (-390.154) (-391.053) [-394.105] -- 0:00:41
312000 -- (-392.728) (-392.260) [-388.934] (-390.742) * [-391.963] (-391.836) (-389.123) (-392.374) -- 0:00:41
312500 -- (-394.936) (-391.913) (-388.967) [-389.212] * [-390.092] (-392.457) (-392.358) (-391.495) -- 0:00:41
313000 -- (-391.220) (-389.768) [-389.962] (-390.046) * (-390.605) (-390.514) [-393.837] (-395.946) -- 0:00:41
313500 -- [-390.391] (-391.619) (-389.070) (-391.739) * [-394.450] (-396.163) (-392.440) (-391.933) -- 0:00:41
314000 -- [-389.137] (-391.267) (-389.393) (-390.441) * [-390.161] (-393.762) (-392.937) (-395.596) -- 0:00:41
314500 -- (-389.475) (-391.588) (-393.292) [-389.868] * (-389.109) (-391.709) [-392.157] (-390.204) -- 0:00:41
315000 -- [-391.185] (-389.954) (-394.483) (-391.642) * (-390.510) (-389.088) [-390.249] (-389.416) -- 0:00:41
Average standard deviation of split frequencies: 0.017980
315500 -- (-390.555) (-391.509) [-392.640] (-389.271) * (-389.099) [-388.995] (-388.700) (-390.463) -- 0:00:41
316000 -- (-389.099) (-391.591) [-393.181] (-390.115) * (-390.053) (-391.384) (-389.492) [-390.701] -- 0:00:41
316500 -- [-389.675] (-394.414) (-389.612) (-389.741) * (-390.893) (-391.929) (-389.468) [-389.045] -- 0:00:41
317000 -- (-395.548) (-389.376) [-389.713] (-391.983) * (-388.670) (-392.985) (-390.406) [-396.245] -- 0:00:40
317500 -- [-389.284] (-388.750) (-389.217) (-390.570) * (-391.141) [-392.565] (-390.226) (-400.919) -- 0:00:40
318000 -- (-390.428) (-390.214) [-390.073] (-390.747) * (-392.486) [-391.418] (-395.842) (-391.885) -- 0:00:40
318500 -- (-390.440) (-390.357) (-396.489) [-394.728] * [-391.950] (-391.053) (-393.508) (-389.970) -- 0:00:40
319000 -- [-390.274] (-392.080) (-388.781) (-392.130) * [-390.494] (-390.476) (-389.646) (-390.599) -- 0:00:40
319500 -- [-391.153] (-389.483) (-390.990) (-390.608) * (-391.510) [-393.052] (-391.991) (-390.113) -- 0:00:40
320000 -- (-392.840) (-389.351) (-389.259) [-391.876] * [-389.232] (-389.768) (-389.647) (-389.424) -- 0:00:40
Average standard deviation of split frequencies: 0.018028
320500 -- (-393.986) (-392.335) (-390.929) [-389.503] * (-389.217) (-390.697) (-390.622) [-389.330] -- 0:00:40
321000 -- [-390.267] (-395.208) (-392.356) (-392.909) * (-391.436) [-390.298] (-389.937) (-389.123) -- 0:00:40
321500 -- (-394.881) (-396.713) [-389.971] (-391.025) * (-389.666) (-390.848) (-403.105) [-390.993] -- 0:00:40
322000 -- (-390.541) (-394.018) [-390.014] (-390.184) * [-389.132] (-390.307) (-391.747) (-390.754) -- 0:00:40
322500 -- (-390.821) (-390.933) (-390.421) [-390.647] * [-391.565] (-390.504) (-391.346) (-389.611) -- 0:00:39
323000 -- (-394.314) (-395.357) [-389.895] (-389.210) * [-390.560] (-393.789) (-391.551) (-391.413) -- 0:00:39
323500 -- [-390.293] (-394.073) (-390.384) (-389.270) * [-391.918] (-390.197) (-390.210) (-389.447) -- 0:00:39
324000 -- [-390.430] (-393.700) (-392.954) (-389.083) * (-389.920) (-390.437) (-391.512) [-390.241] -- 0:00:41
324500 -- (-391.297) [-391.958] (-389.426) (-393.840) * (-392.864) (-392.313) [-395.872] (-390.308) -- 0:00:41
325000 -- (-392.566) [-391.815] (-389.940) (-393.271) * (-393.718) [-390.655] (-393.640) (-395.351) -- 0:00:41
Average standard deviation of split frequencies: 0.017352
325500 -- (-390.777) (-392.625) (-392.163) [-390.583] * (-389.311) [-389.862] (-391.501) (-397.587) -- 0:00:41
326000 -- (-389.285) (-389.766) [-390.393] (-390.690) * (-390.616) (-392.672) [-390.617] (-395.096) -- 0:00:41
326500 -- (-389.408) (-389.566) [-390.636] (-390.473) * (-391.594) (-392.479) (-391.014) [-391.178] -- 0:00:41
327000 -- [-391.361] (-393.085) (-392.095) (-390.951) * (-393.873) (-390.844) [-391.435] (-390.953) -- 0:00:41
327500 -- (-391.007) (-392.856) [-391.619] (-389.547) * (-397.959) [-389.655] (-395.070) (-389.032) -- 0:00:41
328000 -- (-389.454) (-391.783) [-396.523] (-394.359) * (-391.298) [-390.711] (-391.080) (-389.008) -- 0:00:40
328500 -- [-389.877] (-390.556) (-391.022) (-389.756) * (-391.069) (-390.595) (-392.731) [-391.423] -- 0:00:40
329000 -- (-395.905) (-390.983) (-389.363) [-392.149] * (-393.539) (-391.423) (-393.049) [-389.493] -- 0:00:40
329500 -- (-392.892) [-389.060] (-389.095) (-391.475) * (-393.318) [-389.265] (-389.970) (-394.769) -- 0:00:40
330000 -- [-398.722] (-390.135) (-390.213) (-389.920) * (-392.190) [-389.375] (-395.057) (-397.162) -- 0:00:40
Average standard deviation of split frequencies: 0.017257
330500 -- (-392.905) (-390.729) [-390.268] (-391.068) * (-390.792) (-389.940) [-391.284] (-396.512) -- 0:00:40
331000 -- (-394.350) (-394.243) [-389.314] (-391.605) * (-389.840) (-390.846) [-390.462] (-394.468) -- 0:00:40
331500 -- (-391.240) (-391.765) [-388.937] (-391.061) * (-389.812) (-393.870) [-389.941] (-390.161) -- 0:00:40
332000 -- (-390.170) (-391.740) [-389.908] (-395.935) * [-390.597] (-394.412) (-393.029) (-392.361) -- 0:00:40
332500 -- (-394.334) (-390.427) (-392.895) [-391.625] * (-392.308) [-390.193] (-390.804) (-389.592) -- 0:00:40
333000 -- (-390.375) (-389.692) [-395.757] (-391.292) * (-391.527) (-390.569) (-392.733) [-389.710] -- 0:00:40
333500 -- [-389.592] (-396.253) (-391.393) (-394.081) * (-389.263) [-392.643] (-390.301) (-391.000) -- 0:00:39
334000 -- (-390.293) (-390.902) [-392.769] (-393.030) * [-395.936] (-390.083) (-389.495) (-397.205) -- 0:00:39
334500 -- [-390.477] (-390.946) (-394.434) (-390.557) * (-389.617) [-390.694] (-389.887) (-391.209) -- 0:00:39
335000 -- (-389.575) (-390.669) (-389.840) [-396.071] * (-389.790) (-389.938) [-393.747] (-390.341) -- 0:00:39
Average standard deviation of split frequencies: 0.016212
335500 -- (-390.194) [-389.706] (-389.681) (-390.153) * (-389.794) (-390.166) (-390.590) [-392.093] -- 0:00:39
336000 -- (-389.548) (-390.851) [-392.654] (-390.426) * (-393.372) [-389.997] (-391.416) (-390.532) -- 0:00:39
336500 -- (-391.413) (-390.302) [-391.769] (-390.736) * (-392.942) (-393.751) [-393.624] (-390.207) -- 0:00:39
337000 -- (-391.437) (-389.109) [-392.157] (-395.293) * (-392.117) (-394.293) [-389.420] (-392.255) -- 0:00:39
337500 -- (-390.704) (-391.352) (-395.009) [-390.742] * (-392.829) (-392.212) (-393.410) [-392.126] -- 0:00:39
338000 -- (-390.075) (-389.400) [-389.042] (-392.408) * (-390.926) (-391.137) [-391.210] (-391.438) -- 0:00:39
338500 -- (-390.644) (-391.937) [-390.889] (-393.236) * [-391.297] (-392.660) (-389.659) (-389.809) -- 0:00:39
339000 -- (-395.825) (-390.831) [-389.196] (-392.555) * [-394.757] (-391.391) (-391.036) (-389.878) -- 0:00:38
339500 -- (-389.725) (-389.786) [-391.925] (-391.244) * (-390.963) (-391.432) (-392.056) [-391.282] -- 0:00:38
340000 -- (-392.310) (-390.879) [-389.159] (-392.474) * (-391.618) [-391.093] (-390.387) (-392.773) -- 0:00:38
Average standard deviation of split frequencies: 0.015140
340500 -- (-391.271) (-390.410) [-393.255] (-391.601) * (-392.807) [-389.563] (-389.747) (-389.424) -- 0:00:40
341000 -- (-391.326) [-391.046] (-390.930) (-390.551) * (-389.403) [-392.197] (-393.082) (-394.997) -- 0:00:40
341500 -- (-389.141) [-389.237] (-390.267) (-392.065) * (-391.849) (-389.944) [-393.333] (-393.050) -- 0:00:40
342000 -- (-393.736) (-389.317) (-390.702) [-390.289] * [-390.422] (-392.184) (-389.696) (-391.838) -- 0:00:40
342500 -- [-389.717] (-388.905) (-390.403) (-393.896) * (-392.135) (-390.052) (-390.227) [-394.018] -- 0:00:40
343000 -- (-394.699) [-391.019] (-390.609) (-390.554) * [-392.004] (-390.601) (-390.432) (-392.238) -- 0:00:40
343500 -- (-390.123) [-390.302] (-388.766) (-391.101) * (-393.201) [-389.034] (-392.239) (-391.176) -- 0:00:40
344000 -- (-390.561) (-390.041) [-389.605] (-389.602) * (-389.029) (-390.603) (-389.646) [-389.614] -- 0:00:40
344500 -- (-392.143) [-391.249] (-392.306) (-389.728) * [-388.886] (-391.674) (-390.897) (-389.510) -- 0:00:39
345000 -- (-389.049) (-400.004) [-390.810] (-391.135) * [-390.134] (-393.160) (-397.534) (-395.224) -- 0:00:39
Average standard deviation of split frequencies: 0.015290
345500 -- [-391.577] (-393.681) (-389.370) (-392.258) * [-389.924] (-393.718) (-393.196) (-391.661) -- 0:00:39
346000 -- (-390.328) (-391.627) (-389.217) [-392.763] * (-391.552) (-394.979) (-392.117) [-389.089] -- 0:00:39
346500 -- [-390.032] (-390.573) (-389.574) (-389.895) * (-393.346) [-389.964] (-389.798) (-391.987) -- 0:00:39
347000 -- [-389.912] (-389.976) (-389.311) (-390.598) * (-390.380) (-394.177) [-389.325] (-390.160) -- 0:00:39
347500 -- (-395.164) (-389.791) (-391.124) [-389.224] * (-393.145) (-390.390) (-388.896) [-390.350] -- 0:00:39
348000 -- (-391.258) (-389.303) (-389.861) [-392.419] * [-395.856] (-390.465) (-388.886) (-390.777) -- 0:00:39
348500 -- (-390.553) [-388.798] (-389.874) (-392.556) * (-389.803) (-389.515) (-391.246) [-390.164] -- 0:00:39
349000 -- (-389.638) (-389.920) (-392.701) [-391.925] * (-391.609) (-390.338) [-391.794] (-390.166) -- 0:00:39
349500 -- (-389.753) [-391.698] (-390.305) (-389.810) * (-389.808) [-391.057] (-390.096) (-394.047) -- 0:00:39
350000 -- [-388.857] (-392.896) (-391.843) (-390.038) * [-389.963] (-389.565) (-395.163) (-392.366) -- 0:00:39
Average standard deviation of split frequencies: 0.015385
350500 -- [-389.787] (-391.922) (-394.783) (-389.796) * (-390.087) (-389.746) (-393.584) [-392.203] -- 0:00:38
351000 -- (-391.215) (-390.786) (-397.554) [-391.350] * (-391.286) (-391.290) (-392.713) [-388.807] -- 0:00:38
351500 -- (-395.892) [-389.697] (-395.175) (-392.329) * (-390.888) [-389.972] (-392.275) (-390.069) -- 0:00:38
352000 -- (-395.127) (-389.831) (-391.281) [-389.008] * (-395.032) (-389.044) (-391.381) [-390.823] -- 0:00:38
352500 -- (-391.333) [-391.284] (-391.787) (-390.219) * (-395.781) (-390.180) [-390.186] (-394.283) -- 0:00:38
353000 -- [-389.234] (-390.483) (-390.956) (-389.927) * [-399.366] (-389.170) (-390.677) (-388.909) -- 0:00:38
353500 -- (-390.088) [-389.689] (-392.890) (-391.210) * [-392.068] (-390.070) (-389.748) (-389.842) -- 0:00:38
354000 -- (-391.838) (-391.732) (-392.183) [-390.069] * (-392.277) (-391.044) (-392.382) [-388.828] -- 0:00:38
354500 -- (-390.174) (-392.978) [-391.771] (-390.021) * (-391.086) (-392.254) [-390.699] (-391.914) -- 0:00:38
355000 -- (-391.035) (-388.718) [-390.954] (-390.886) * [-394.534] (-389.445) (-390.488) (-388.788) -- 0:00:38
Average standard deviation of split frequencies: 0.015743
355500 -- [-391.693] (-391.145) (-391.543) (-390.543) * (-391.495) [-391.729] (-391.528) (-391.142) -- 0:00:38
356000 -- (-389.164) [-390.117] (-396.673) (-390.495) * (-391.634) (-389.510) [-392.117] (-390.538) -- 0:00:37
356500 -- [-389.572] (-389.453) (-392.509) (-392.147) * [-390.029] (-390.326) (-391.665) (-389.976) -- 0:00:37
357000 -- (-390.947) (-390.322) [-390.646] (-393.019) * (-389.628) (-392.048) [-389.608] (-390.062) -- 0:00:37
357500 -- (-390.717) [-391.154] (-388.655) (-390.820) * [-389.675] (-390.815) (-391.527) (-391.318) -- 0:00:39
358000 -- [-390.204] (-392.672) (-389.766) (-389.404) * (-389.643) (-390.067) (-390.071) [-390.428] -- 0:00:39
358500 -- [-392.408] (-392.569) (-391.166) (-396.760) * (-392.474) (-395.459) (-390.302) [-393.119] -- 0:00:39
359000 -- (-391.303) (-394.698) (-392.365) [-389.334] * [-391.039] (-393.948) (-394.217) (-395.595) -- 0:00:39
359500 -- (-391.128) (-392.858) (-391.959) [-394.903] * (-390.582) (-394.034) (-393.001) [-393.569] -- 0:00:39
360000 -- (-390.680) [-390.323] (-389.879) (-395.527) * (-391.602) (-392.691) [-389.359] (-389.473) -- 0:00:39
Average standard deviation of split frequencies: 0.015321
360500 -- (-390.877) (-388.537) [-390.261] (-391.977) * (-393.173) (-391.504) [-391.318] (-389.940) -- 0:00:39
361000 -- [-393.251] (-390.692) (-393.212) (-389.878) * (-393.564) [-392.077] (-391.183) (-393.222) -- 0:00:38
361500 -- (-390.775) [-390.489] (-392.275) (-391.451) * (-393.929) (-389.561) [-392.458] (-394.655) -- 0:00:38
362000 -- (-390.899) (-392.048) (-391.214) [-390.737] * [-388.725] (-389.795) (-390.451) (-393.249) -- 0:00:38
362500 -- [-390.426] (-389.958) (-390.659) (-392.042) * (-389.027) [-391.021] (-391.901) (-391.312) -- 0:00:38
363000 -- (-391.691) (-390.645) [-389.822] (-389.349) * (-390.534) (-390.408) [-390.877] (-392.119) -- 0:00:38
363500 -- (-389.637) [-389.339] (-390.754) (-390.038) * (-392.670) (-392.205) [-389.369] (-393.553) -- 0:00:38
364000 -- [-392.340] (-390.366) (-393.315) (-391.975) * (-391.233) (-394.335) (-392.532) [-390.569] -- 0:00:38
364500 -- (-389.651) [-390.333] (-390.412) (-390.755) * (-391.919) (-390.495) (-389.991) [-392.839] -- 0:00:38
365000 -- (-389.517) (-390.651) [-390.642] (-389.362) * (-393.990) [-392.340] (-391.588) (-389.048) -- 0:00:38
Average standard deviation of split frequencies: 0.015313
365500 -- (-393.096) [-391.076] (-394.294) (-390.115) * (-392.566) (-390.577) [-389.450] (-389.448) -- 0:00:38
366000 -- (-394.192) [-390.971] (-394.479) (-389.292) * [-390.359] (-398.220) (-390.204) (-390.986) -- 0:00:38
366500 -- [-390.051] (-390.993) (-392.347) (-391.825) * (-392.872) (-390.659) (-390.144) [-392.191] -- 0:00:38
367000 -- (-395.181) (-393.183) (-391.875) [-391.548] * (-390.990) [-392.090] (-391.027) (-390.689) -- 0:00:37
367500 -- (-390.286) (-391.369) [-391.619] (-391.430) * [-389.200] (-394.798) (-391.682) (-393.412) -- 0:00:37
368000 -- (-391.463) [-391.129] (-392.913) (-389.485) * (-389.209) (-394.928) (-390.299) [-388.881] -- 0:00:37
368500 -- (-392.641) (-390.010) [-390.150] (-389.676) * [-392.824] (-389.320) (-389.059) (-392.232) -- 0:00:37
369000 -- (-392.476) (-394.798) [-392.579] (-398.503) * (-389.247) (-392.712) (-390.410) [-390.186] -- 0:00:37
369500 -- [-392.528] (-392.176) (-393.980) (-395.059) * [-388.876] (-390.017) (-395.544) (-392.076) -- 0:00:37
370000 -- (-390.402) (-390.881) [-389.390] (-389.848) * (-393.034) (-389.770) (-390.320) [-389.378] -- 0:00:37
Average standard deviation of split frequencies: 0.015561
370500 -- (-389.877) (-390.457) (-389.492) [-389.239] * (-391.909) (-396.286) (-392.492) [-389.275] -- 0:00:37
371000 -- (-390.050) (-389.565) [-389.870] (-389.195) * (-390.352) (-391.994) [-388.935] (-391.380) -- 0:00:37
371500 -- (-390.135) [-389.194] (-389.667) (-389.428) * (-390.509) [-397.398] (-390.273) (-391.296) -- 0:00:37
372000 -- (-392.482) (-391.479) [-391.668] (-391.990) * (-390.071) (-389.419) [-389.191] (-392.607) -- 0:00:37
372500 -- [-390.913] (-390.263) (-394.127) (-391.152) * (-392.801) (-389.952) (-391.851) [-390.542] -- 0:00:37
373000 -- (-392.073) (-392.340) [-391.079] (-389.339) * (-391.924) (-392.828) (-392.281) [-388.689] -- 0:00:36
373500 -- (-389.969) (-394.769) (-388.872) [-389.152] * (-389.614) (-393.073) (-389.959) [-389.216] -- 0:00:36
374000 -- (-391.483) (-391.264) [-390.406] (-389.514) * (-390.570) [-389.180] (-391.726) (-390.886) -- 0:00:36
374500 -- (-388.885) [-390.890] (-395.099) (-389.736) * (-392.996) (-389.562) (-391.200) [-389.563] -- 0:00:38
375000 -- (-391.963) (-391.627) (-388.705) [-394.436] * [-394.099] (-389.768) (-390.717) (-389.829) -- 0:00:38
Average standard deviation of split frequencies: 0.014529
375500 -- [-390.875] (-389.633) (-390.964) (-390.309) * (-398.244) [-390.022] (-389.860) (-389.079) -- 0:00:38
376000 -- [-390.014] (-393.158) (-398.815) (-389.079) * (-393.537) [-388.821] (-394.292) (-391.989) -- 0:00:38
376500 -- (-391.008) [-391.004] (-388.989) (-389.607) * [-392.853] (-392.594) (-391.491) (-390.162) -- 0:00:38
377000 -- (-392.320) (-394.093) [-390.151] (-391.643) * (-390.870) [-395.793] (-389.507) (-390.007) -- 0:00:38
377500 -- (-392.804) (-392.861) [-391.144] (-390.339) * [-389.456] (-395.308) (-388.973) (-390.186) -- 0:00:37
378000 -- (-392.145) [-391.806] (-390.581) (-389.860) * (-391.389) (-394.022) [-389.861] (-389.524) -- 0:00:37
378500 -- (-394.389) [-390.525] (-389.982) (-390.048) * (-389.189) [-390.380] (-390.974) (-390.088) -- 0:00:37
379000 -- (-390.140) (-393.070) [-394.190] (-391.467) * (-389.441) (-391.847) [-393.425] (-391.346) -- 0:00:37
379500 -- (-390.115) (-392.410) [-392.589] (-390.141) * (-389.285) (-393.193) [-394.767] (-390.111) -- 0:00:37
380000 -- (-390.132) (-389.583) [-390.910] (-392.659) * [-390.983] (-391.777) (-392.737) (-389.972) -- 0:00:37
Average standard deviation of split frequencies: 0.015006
380500 -- [-390.484] (-389.163) (-389.096) (-392.587) * (-390.392) (-393.685) [-392.404] (-395.281) -- 0:00:37
381000 -- (-391.049) (-389.796) (-393.259) [-390.791] * (-391.565) (-393.357) (-392.158) [-392.948] -- 0:00:37
381500 -- (-390.707) (-391.135) [-395.877] (-391.516) * [-388.969] (-390.145) (-390.450) (-390.984) -- 0:00:37
382000 -- [-390.700] (-391.713) (-394.934) (-389.875) * (-391.309) (-389.672) (-392.033) [-391.042] -- 0:00:37
382500 -- (-392.510) [-389.761] (-392.521) (-391.162) * (-391.362) [-390.341] (-396.507) (-391.517) -- 0:00:37
383000 -- [-389.610] (-390.331) (-391.855) (-393.277) * (-391.718) [-390.740] (-394.649) (-389.570) -- 0:00:37
383500 -- [-389.524] (-390.128) (-390.616) (-395.389) * (-390.771) [-390.522] (-393.775) (-394.290) -- 0:00:36
384000 -- (-394.237) (-392.169) [-392.960] (-392.555) * (-391.414) (-392.065) (-394.385) [-390.381] -- 0:00:36
384500 -- (-389.702) (-391.797) [-390.283] (-391.077) * [-390.786] (-391.035) (-391.660) (-392.388) -- 0:00:36
385000 -- (-390.299) (-390.845) (-393.609) [-393.727] * (-390.428) (-390.186) (-391.176) [-389.980] -- 0:00:36
Average standard deviation of split frequencies: 0.015158
385500 -- [-390.508] (-396.215) (-391.088) (-388.883) * [-393.548] (-391.996) (-391.393) (-389.441) -- 0:00:36
386000 -- [-389.132] (-389.805) (-393.370) (-390.043) * (-392.008) (-391.006) (-391.556) [-393.615] -- 0:00:36
386500 -- (-390.944) (-389.775) [-392.149] (-391.178) * (-389.516) (-390.081) [-389.268] (-391.967) -- 0:00:36
387000 -- (-392.948) [-388.965] (-389.566) (-394.076) * (-391.193) (-395.391) [-389.054] (-390.391) -- 0:00:36
387500 -- (-389.691) (-389.564) [-391.482] (-390.244) * (-392.489) (-393.830) (-388.955) [-390.629] -- 0:00:36
388000 -- (-391.753) (-388.663) [-389.839] (-390.928) * [-391.018] (-390.743) (-390.840) (-389.914) -- 0:00:36
388500 -- (-392.446) (-390.625) (-389.842) [-389.624] * [-389.409] (-389.137) (-391.570) (-389.302) -- 0:00:36
389000 -- (-394.641) (-390.642) [-392.485] (-391.096) * (-394.681) (-390.484) [-391.682] (-389.997) -- 0:00:36
389500 -- (-391.621) [-391.503] (-391.542) (-390.614) * (-391.203) (-389.574) [-389.545] (-390.982) -- 0:00:36
390000 -- (-390.971) (-390.785) [-389.663] (-391.323) * (-391.645) [-390.865] (-391.584) (-391.670) -- 0:00:35
Average standard deviation of split frequencies: 0.014631
390500 -- (-392.689) (-393.565) [-390.864] (-389.796) * (-396.463) (-392.719) [-389.151] (-391.559) -- 0:00:35
391000 -- (-390.275) (-390.345) (-389.746) [-391.385] * (-392.235) (-389.312) [-390.274] (-389.713) -- 0:00:35
391500 -- [-390.355] (-393.114) (-391.595) (-392.064) * (-390.621) (-391.616) (-390.338) [-390.015] -- 0:00:37
392000 -- [-391.344] (-391.503) (-388.899) (-389.691) * (-389.515) [-389.530] (-390.461) (-392.195) -- 0:00:37
392500 -- (-392.917) (-393.863) (-388.776) [-390.533] * (-395.126) (-394.296) (-390.595) [-390.951] -- 0:00:37
393000 -- (-392.110) [-388.977] (-389.943) (-393.346) * (-401.105) [-392.021] (-393.946) (-390.598) -- 0:00:37
393500 -- (-392.086) (-389.563) (-390.521) [-392.550] * (-390.018) (-393.986) [-391.690] (-389.993) -- 0:00:36
394000 -- (-390.867) (-390.814) [-389.935] (-391.842) * (-390.534) (-389.584) (-390.311) [-390.192] -- 0:00:36
394500 -- (-390.877) (-390.612) (-390.852) [-389.427] * (-393.265) [-392.650] (-393.189) (-390.005) -- 0:00:36
395000 -- [-393.008] (-392.367) (-390.532) (-389.968) * (-392.944) [-389.497] (-390.705) (-389.585) -- 0:00:36
Average standard deviation of split frequencies: 0.014495
395500 -- (-390.047) (-392.048) (-391.702) [-389.674] * (-390.613) [-390.170] (-389.360) (-388.782) -- 0:00:36
396000 -- [-391.523] (-389.582) (-393.130) (-392.553) * [-392.066] (-393.669) (-389.548) (-392.576) -- 0:00:36
396500 -- [-392.092] (-391.063) (-390.707) (-389.642) * (-390.677) (-392.020) [-389.856] (-391.684) -- 0:00:36
397000 -- (-389.437) (-390.661) [-391.799] (-391.694) * [-390.603] (-393.680) (-392.627) (-390.907) -- 0:00:36
397500 -- (-392.089) (-392.764) [-393.659] (-394.527) * [-390.732] (-390.868) (-393.730) (-393.872) -- 0:00:36
398000 -- (-389.670) (-391.998) (-394.429) [-392.787] * [-391.098] (-391.661) (-393.118) (-389.505) -- 0:00:36
398500 -- (-389.564) [-389.392] (-390.140) (-391.647) * (-388.868) (-390.642) (-389.768) [-391.131] -- 0:00:36
399000 -- (-389.252) [-392.042] (-389.813) (-391.990) * (-391.519) [-390.425] (-392.519) (-390.193) -- 0:00:36
399500 -- (-396.405) (-390.510) (-391.118) [-395.061] * (-389.178) (-391.432) (-388.659) [-392.509] -- 0:00:36
400000 -- [-390.793] (-390.786) (-390.609) (-390.306) * (-391.637) (-394.792) (-389.911) [-391.127] -- 0:00:36
Average standard deviation of split frequencies: 0.014465
400500 -- (-392.948) (-393.343) (-392.522) [-390.477] * (-390.431) (-391.857) [-392.603] (-393.305) -- 0:00:35
401000 -- [-392.187] (-390.241) (-392.975) (-390.780) * (-391.391) [-389.539] (-391.129) (-393.840) -- 0:00:35
401500 -- (-395.939) (-391.117) (-393.736) [-390.813] * (-392.245) [-390.615] (-391.602) (-391.288) -- 0:00:35
402000 -- (-391.663) (-391.114) (-392.214) [-391.486] * (-390.971) (-390.487) [-390.419] (-395.002) -- 0:00:35
402500 -- (-389.966) (-390.586) (-391.348) [-390.694] * (-389.177) (-392.443) (-396.035) [-391.701] -- 0:00:35
403000 -- (-389.894) (-390.725) [-390.504] (-391.110) * (-392.101) (-389.624) (-389.535) [-396.139] -- 0:00:35
403500 -- [-391.963] (-392.130) (-392.545) (-390.580) * [-390.175] (-392.125) (-389.558) (-392.026) -- 0:00:35
404000 -- (-392.173) (-396.777) [-390.816] (-392.472) * (-390.179) (-393.013) (-391.209) [-389.187] -- 0:00:35
404500 -- [-391.309] (-389.105) (-390.235) (-390.977) * (-392.792) (-391.084) (-389.341) [-392.681] -- 0:00:35
405000 -- (-389.927) (-397.678) [-388.839] (-393.877) * (-391.180) [-389.953] (-393.651) (-391.833) -- 0:00:35
Average standard deviation of split frequencies: 0.014343
405500 -- (-389.933) (-390.034) (-390.660) [-389.617] * [-390.758] (-389.373) (-389.801) (-390.567) -- 0:00:35
406000 -- (-391.017) (-388.868) (-390.169) [-391.407] * (-395.579) (-390.321) [-391.915] (-389.850) -- 0:00:35
406500 -- [-390.585] (-391.144) (-390.418) (-390.145) * [-393.295] (-390.314) (-390.846) (-389.724) -- 0:00:35
407000 -- (-394.355) (-391.989) (-391.884) [-390.135] * (-391.352) (-389.439) (-390.133) [-392.776] -- 0:00:36
407500 -- (-392.359) (-396.405) [-391.413] (-392.505) * [-390.872] (-393.683) (-390.402) (-392.337) -- 0:00:36
408000 -- (-394.537) (-389.808) [-390.195] (-394.418) * (-391.320) (-389.394) [-389.856] (-389.711) -- 0:00:36
408500 -- (-389.704) [-391.731] (-395.290) (-393.410) * (-390.409) [-392.300] (-389.155) (-389.081) -- 0:00:36
409000 -- (-390.584) [-390.743] (-391.334) (-391.614) * (-389.968) (-390.387) (-391.691) [-392.439] -- 0:00:36
409500 -- [-392.254] (-390.647) (-391.754) (-391.706) * (-390.084) [-391.227] (-391.063) (-390.828) -- 0:00:36
410000 -- (-389.569) [-390.229] (-391.773) (-392.694) * (-390.772) [-391.554] (-391.466) (-389.993) -- 0:00:35
Average standard deviation of split frequencies: 0.013910
410500 -- (-391.038) (-391.967) (-389.400) [-389.423] * (-390.535) (-391.331) (-391.674) [-391.961] -- 0:00:35
411000 -- [-389.465] (-395.633) (-391.030) (-389.889) * (-390.915) [-390.363] (-390.271) (-391.334) -- 0:00:35
411500 -- (-391.094) (-390.867) (-395.032) [-390.151] * [-391.082] (-392.124) (-392.247) (-393.422) -- 0:00:35
412000 -- (-392.063) (-389.967) (-391.096) [-389.762] * (-390.046) [-391.559] (-389.497) (-391.423) -- 0:00:35
412500 -- (-391.328) [-394.348] (-393.359) (-390.815) * (-390.575) (-391.223) [-393.030] (-391.135) -- 0:00:35
413000 -- [-390.460] (-389.900) (-389.098) (-389.707) * (-390.275) (-393.188) [-390.422] (-391.382) -- 0:00:35
413500 -- [-389.160] (-390.900) (-389.115) (-392.324) * (-394.263) [-391.009] (-392.098) (-390.025) -- 0:00:35
414000 -- (-391.994) (-392.951) [-391.395] (-392.556) * (-391.704) (-394.103) [-388.980] (-389.916) -- 0:00:35
414500 -- (-389.471) [-392.514] (-389.975) (-391.269) * (-393.171) (-390.043) (-391.143) [-391.455] -- 0:00:35
415000 -- [-391.116] (-391.206) (-389.556) (-389.778) * (-391.834) (-391.011) [-392.575] (-389.595) -- 0:00:35
Average standard deviation of split frequencies: 0.014198
415500 -- (-389.729) (-395.210) (-388.999) [-388.871] * (-391.758) (-389.043) (-392.368) [-391.468] -- 0:00:35
416000 -- (-390.019) [-396.634] (-389.322) (-393.213) * (-390.484) [-389.205] (-396.226) (-391.971) -- 0:00:35
416500 -- [-392.860] (-393.554) (-391.015) (-393.032) * (-390.275) (-392.580) [-390.033] (-392.832) -- 0:00:35
417000 -- (-390.900) (-389.784) [-391.206] (-388.949) * (-389.423) (-390.837) (-390.823) [-389.539] -- 0:00:34
417500 -- (-391.740) (-388.869) (-391.600) [-389.199] * (-389.030) (-390.887) (-393.582) [-391.144] -- 0:00:34
418000 -- (-390.982) (-390.558) (-392.237) [-391.977] * (-390.740) (-390.303) (-392.478) [-389.793] -- 0:00:34
418500 -- (-395.320) (-391.658) [-389.559] (-390.600) * (-389.987) (-391.461) (-390.873) [-389.660] -- 0:00:34
419000 -- (-393.652) [-391.657] (-395.928) (-394.447) * (-389.586) [-391.709] (-389.668) (-390.484) -- 0:00:34
419500 -- (-390.798) [-389.407] (-392.867) (-392.635) * [-390.474] (-393.369) (-390.064) (-389.037) -- 0:00:34
420000 -- (-392.353) [-391.633] (-394.560) (-394.497) * (-392.272) [-390.498] (-391.258) (-391.760) -- 0:00:34
Average standard deviation of split frequencies: 0.013711
420500 -- (-391.414) (-390.899) (-393.322) [-391.511] * (-390.247) (-390.663) (-396.472) [-390.936] -- 0:00:35
421000 -- (-389.655) (-390.412) [-389.594] (-392.451) * (-390.298) (-392.164) [-389.895] (-390.215) -- 0:00:35
421500 -- (-390.401) [-389.111] (-392.918) (-390.373) * [-390.593] (-390.127) (-390.101) (-390.953) -- 0:00:35
422000 -- (-393.640) [-392.411] (-389.873) (-391.344) * (-390.670) (-392.997) (-392.394) [-390.568] -- 0:00:35
422500 -- (-391.186) (-390.189) [-389.410] (-391.836) * [-389.294] (-391.105) (-391.304) (-390.757) -- 0:00:35
423000 -- (-392.345) (-390.044) [-392.864] (-391.541) * (-389.762) (-390.978) (-390.597) [-389.974] -- 0:00:35
423500 -- (-388.708) (-390.561) [-391.163] (-391.214) * (-394.046) [-389.558] (-392.327) (-389.450) -- 0:00:35
424000 -- (-391.213) [-390.151] (-389.575) (-388.837) * (-389.758) (-390.056) [-390.228] (-389.073) -- 0:00:35
424500 -- (-391.841) (-392.830) (-389.150) [-390.539] * (-391.788) (-394.403) (-390.968) [-388.924] -- 0:00:35
425000 -- [-395.341] (-394.146) (-391.814) (-390.700) * (-391.097) (-392.442) (-391.453) [-390.383] -- 0:00:35
Average standard deviation of split frequencies: 0.014386
425500 -- (-389.179) (-390.259) (-391.329) [-392.176] * [-389.063] (-390.725) (-391.536) (-391.019) -- 0:00:35
426000 -- [-396.606] (-390.086) (-393.291) (-392.033) * (-389.335) (-390.521) (-393.934) [-391.229] -- 0:00:35
426500 -- [-392.420] (-389.993) (-395.275) (-390.371) * (-393.854) [-391.775] (-395.975) (-391.466) -- 0:00:34
427000 -- (-389.640) (-390.825) [-391.191] (-389.534) * (-392.884) (-389.762) [-391.189] (-392.606) -- 0:00:34
427500 -- (-389.585) [-389.916] (-392.181) (-389.608) * [-392.394] (-390.052) (-390.707) (-390.490) -- 0:00:34
428000 -- (-389.803) (-389.775) [-389.002] (-392.427) * [-389.513] (-389.139) (-390.233) (-390.855) -- 0:00:34
428500 -- (-396.388) (-388.811) [-390.612] (-394.188) * (-393.040) (-393.485) [-393.744] (-389.461) -- 0:00:34
429000 -- (-389.896) [-394.222] (-390.122) (-389.618) * (-391.900) [-391.694] (-394.202) (-389.799) -- 0:00:34
429500 -- (-391.504) [-388.980] (-389.969) (-391.529) * (-391.175) (-396.085) (-390.155) [-388.960] -- 0:00:34
430000 -- [-389.971] (-389.446) (-396.798) (-390.775) * (-395.998) (-393.415) (-390.742) [-390.039] -- 0:00:34
Average standard deviation of split frequencies: 0.013650
430500 -- (-390.612) (-389.911) [-391.208] (-394.219) * (-394.543) (-397.050) (-390.284) [-390.839] -- 0:00:34
431000 -- (-392.499) [-393.090] (-391.404) (-389.286) * (-392.459) (-390.585) [-390.256] (-395.382) -- 0:00:34
431500 -- (-391.355) (-393.426) [-394.780] (-393.132) * [-390.179] (-392.701) (-390.028) (-391.335) -- 0:00:35
432000 -- (-390.585) (-391.728) [-393.898] (-397.047) * (-389.943) [-389.251] (-392.559) (-390.443) -- 0:00:35
432500 -- (-394.448) (-391.683) (-391.790) [-392.150] * (-390.339) [-389.435] (-392.233) (-392.380) -- 0:00:35
433000 -- [-391.715] (-389.365) (-393.221) (-391.713) * (-392.362) [-391.612] (-392.843) (-394.728) -- 0:00:35
433500 -- (-392.354) (-393.849) (-390.236) [-389.418] * (-391.151) (-390.065) [-391.586] (-389.643) -- 0:00:35
434000 -- (-389.119) (-398.851) [-389.368] (-389.413) * [-389.835] (-391.656) (-394.855) (-389.375) -- 0:00:35
434500 -- [-392.773] (-390.491) (-393.314) (-390.298) * (-392.462) (-390.422) [-395.677] (-389.807) -- 0:00:35
435000 -- [-390.723] (-393.418) (-390.546) (-393.286) * (-393.694) (-390.018) (-390.799) [-390.079] -- 0:00:35
Average standard deviation of split frequencies: 0.013718
435500 -- (-391.498) [-392.900] (-390.738) (-391.595) * (-391.803) [-389.869] (-393.092) (-394.664) -- 0:00:34
436000 -- (-389.300) (-392.786) (-390.561) [-389.808] * (-399.471) [-393.471] (-393.482) (-394.412) -- 0:00:34
436500 -- (-395.506) (-389.393) [-389.488] (-391.145) * [-390.196] (-392.271) (-393.640) (-390.999) -- 0:00:34
437000 -- [-390.391] (-391.837) (-390.712) (-392.477) * (-393.431) (-392.642) [-392.549] (-392.857) -- 0:00:34
437500 -- (-390.448) (-390.479) [-393.710] (-389.470) * (-393.661) (-390.919) (-391.684) [-393.262] -- 0:00:34
438000 -- (-393.414) (-390.986) (-393.304) [-390.265] * (-390.706) (-391.209) [-392.513] (-396.292) -- 0:00:34
438500 -- (-390.603) (-390.248) (-392.645) [-391.650] * (-391.887) (-391.084) (-389.246) [-389.636] -- 0:00:34
439000 -- (-392.935) (-391.980) (-389.258) [-389.730] * [-391.127] (-393.827) (-394.900) (-389.089) -- 0:00:34
439500 -- (-390.010) [-391.694] (-390.945) (-388.677) * (-389.277) (-392.700) [-391.721] (-392.248) -- 0:00:34
440000 -- (-389.610) (-390.515) (-389.310) [-389.597] * (-389.571) (-393.246) [-389.054] (-390.872) -- 0:00:34
Average standard deviation of split frequencies: 0.014107
440500 -- [-390.010] (-392.608) (-390.317) (-390.061) * [-389.286] (-390.853) (-393.467) (-390.715) -- 0:00:34
441000 -- (-391.609) [-391.019] (-392.398) (-391.428) * (-389.997) [-395.781] (-389.916) (-389.684) -- 0:00:34
441500 -- (-392.495) (-390.783) [-389.618] (-395.363) * (-391.155) (-391.369) [-389.320] (-390.390) -- 0:00:34
442000 -- [-392.629] (-389.727) (-391.402) (-393.984) * [-389.346] (-390.504) (-389.507) (-393.324) -- 0:00:34
442500 -- (-393.586) [-391.448] (-390.407) (-391.168) * (-393.119) [-391.236] (-391.036) (-389.474) -- 0:00:34
443000 -- [-391.785] (-390.532) (-391.013) (-390.067) * (-390.760) (-389.569) (-389.866) [-390.275] -- 0:00:33
443500 -- (-390.657) (-390.644) (-390.610) [-390.512] * [-391.993] (-392.197) (-389.417) (-391.625) -- 0:00:35
444000 -- (-395.669) (-390.563) [-392.690] (-393.487) * (-391.423) (-390.451) [-390.915] (-392.240) -- 0:00:35
444500 -- (-401.430) (-392.987) [-392.375] (-392.121) * (-389.195) [-390.247] (-391.612) (-392.411) -- 0:00:34
445000 -- (-396.488) [-389.268] (-391.810) (-393.429) * (-393.467) [-392.604] (-399.467) (-390.222) -- 0:00:34
Average standard deviation of split frequencies: 0.013212
445500 -- (-389.795) (-390.454) (-392.573) [-393.257] * (-394.514) (-390.702) (-392.288) [-393.483] -- 0:00:34
446000 -- (-392.505) (-394.592) (-389.274) [-390.671] * (-392.306) (-389.432) (-394.609) [-392.060] -- 0:00:34
446500 -- (-394.252) [-393.777] (-389.994) (-391.375) * (-389.852) (-390.825) [-390.347] (-391.708) -- 0:00:34
447000 -- (-392.030) (-389.414) (-388.977) [-390.776] * (-394.630) [-389.935] (-389.511) (-390.693) -- 0:00:34
447500 -- [-391.177] (-390.863) (-394.985) (-391.778) * (-391.757) (-394.275) (-390.568) [-389.466] -- 0:00:34
448000 -- (-392.041) [-392.661] (-395.233) (-390.553) * (-390.928) [-391.418] (-392.989) (-392.787) -- 0:00:34
448500 -- (-393.869) [-389.830] (-392.645) (-393.526) * (-393.605) (-390.388) [-390.787] (-390.925) -- 0:00:34
449000 -- [-391.602] (-391.326) (-390.005) (-391.069) * [-390.012] (-389.925) (-393.927) (-389.243) -- 0:00:34
449500 -- [-393.112] (-390.939) (-389.922) (-391.169) * (-390.748) (-391.831) (-389.552) [-389.891] -- 0:00:34
450000 -- (-391.215) (-389.354) (-391.022) [-388.949] * [-394.021] (-391.424) (-389.598) (-389.464) -- 0:00:34
Average standard deviation of split frequencies: 0.011898
450500 -- [-390.869] (-391.702) (-394.165) (-390.486) * (-394.198) [-390.835] (-395.503) (-390.864) -- 0:00:34
451000 -- (-393.230) (-391.135) (-394.711) [-390.041] * (-389.999) [-391.923] (-394.215) (-392.616) -- 0:00:34
451500 -- [-393.068] (-395.557) (-390.943) (-393.448) * (-393.827) (-390.913) (-389.522) [-392.397] -- 0:00:34
452000 -- (-393.702) [-390.278] (-390.218) (-395.586) * (-392.936) (-391.648) [-392.484] (-391.954) -- 0:00:33
452500 -- (-392.419) [-388.579] (-388.675) (-398.171) * (-393.494) (-390.652) (-391.217) [-391.053] -- 0:00:33
453000 -- (-394.824) [-389.640] (-389.888) (-391.091) * (-396.675) [-391.442] (-394.755) (-393.067) -- 0:00:33
453500 -- (-392.569) [-389.574] (-389.589) (-389.738) * (-389.490) [-389.959] (-392.429) (-394.998) -- 0:00:33
454000 -- [-392.890] (-392.768) (-391.431) (-391.605) * [-389.193] (-389.790) (-390.011) (-389.973) -- 0:00:33
454500 -- (-389.738) (-393.054) (-390.682) [-389.500] * (-390.512) [-389.742] (-390.096) (-392.029) -- 0:00:33
455000 -- (-390.462) (-390.847) (-391.829) [-390.715] * [-389.964] (-391.809) (-390.132) (-392.716) -- 0:00:33
Average standard deviation of split frequencies: 0.011049
455500 -- [-394.596] (-390.131) (-391.396) (-399.613) * (-389.907) [-389.760] (-390.887) (-389.485) -- 0:00:33
456000 -- (-392.791) (-388.916) (-391.800) [-390.708] * [-391.835] (-391.294) (-390.081) (-395.869) -- 0:00:33
456500 -- (-391.566) [-389.858] (-389.489) (-391.673) * (-395.448) [-392.304] (-389.091) (-397.081) -- 0:00:34
457000 -- [-390.328] (-392.488) (-391.352) (-390.140) * (-392.263) [-390.151] (-390.677) (-389.292) -- 0:00:34
457500 -- (-391.539) (-391.825) [-389.872] (-392.405) * (-393.779) (-392.380) [-390.094] (-390.203) -- 0:00:34
458000 -- [-390.307] (-391.944) (-393.475) (-390.578) * (-396.087) (-392.340) [-391.061] (-392.038) -- 0:00:34
458500 -- (-389.474) (-391.515) [-396.381] (-393.854) * (-390.506) (-393.962) (-391.392) [-390.466] -- 0:00:34
459000 -- (-390.478) (-391.158) [-389.393] (-390.119) * (-389.652) (-389.761) (-391.889) [-389.381] -- 0:00:34
459500 -- (-390.382) (-390.866) [-393.282] (-389.391) * [-391.183] (-392.206) (-391.134) (-390.264) -- 0:00:34
460000 -- (-393.767) (-390.452) (-394.748) [-392.631] * (-399.956) (-392.509) [-389.271] (-391.749) -- 0:00:34
Average standard deviation of split frequencies: 0.010809
460500 -- (-395.083) (-389.688) [-390.169] (-394.136) * (-389.684) [-390.874] (-390.558) (-388.691) -- 0:00:33
461000 -- (-391.122) (-391.631) (-389.495) [-389.977] * (-391.025) (-391.893) (-391.788) [-388.607] -- 0:00:33
461500 -- (-392.481) (-393.167) (-391.878) [-389.779] * (-391.187) (-393.154) (-390.786) [-389.987] -- 0:00:33
462000 -- (-389.233) (-392.045) (-389.106) [-389.628] * (-390.684) (-391.596) [-389.905] (-390.429) -- 0:00:33
462500 -- (-395.062) (-391.460) (-389.250) [-392.822] * (-388.910) [-390.629] (-389.855) (-391.147) -- 0:00:33
463000 -- (-393.374) [-390.796] (-391.738) (-394.786) * (-390.085) [-390.400] (-390.108) (-392.235) -- 0:00:33
463500 -- (-389.916) (-389.366) [-390.252] (-390.996) * [-390.362] (-392.725) (-393.270) (-395.602) -- 0:00:33
464000 -- (-390.464) (-389.305) (-390.737) [-394.280] * [-390.640] (-391.542) (-391.311) (-394.114) -- 0:00:33
464500 -- (-392.357) (-390.657) [-390.001] (-390.859) * [-390.247] (-389.702) (-392.507) (-397.890) -- 0:00:33
465000 -- (-390.482) (-391.501) [-389.541] (-392.765) * (-392.954) (-389.303) [-390.445] (-395.138) -- 0:00:33
Average standard deviation of split frequencies: 0.010495
465500 -- [-392.545] (-389.527) (-389.610) (-390.347) * (-395.959) (-389.192) [-390.754] (-393.562) -- 0:00:33
466000 -- [-391.000] (-390.446) (-391.370) (-393.330) * (-392.694) (-394.133) [-391.143] (-396.074) -- 0:00:33
466500 -- [-391.522] (-393.476) (-396.052) (-391.670) * (-391.147) (-393.319) [-391.575] (-390.265) -- 0:00:33
467000 -- (-393.405) [-390.835] (-390.769) (-394.919) * (-390.565) (-390.135) (-390.332) [-390.285] -- 0:00:33
467500 -- (-392.909) (-390.833) (-391.257) [-394.036] * (-394.340) (-396.004) [-391.411] (-389.664) -- 0:00:33
468000 -- (-392.093) (-393.628) (-390.865) [-391.655] * (-394.087) (-394.731) (-392.249) [-389.948] -- 0:00:32
468500 -- (-390.477) (-389.835) (-390.556) [-389.320] * (-392.155) (-390.932) [-389.532] (-392.661) -- 0:00:32
469000 -- (-389.578) (-388.712) [-390.399] (-395.753) * (-389.162) (-389.613) [-391.291] (-394.657) -- 0:00:32
469500 -- (-392.319) (-388.712) [-393.297] (-390.294) * (-390.598) (-392.508) (-390.646) [-391.764] -- 0:00:32
470000 -- (-391.182) (-391.637) [-391.016] (-390.810) * (-394.129) [-392.922] (-392.266) (-389.712) -- 0:00:32
Average standard deviation of split frequencies: 0.011205
470500 -- (-390.465) [-389.986] (-395.166) (-393.401) * (-389.644) [-391.897] (-394.316) (-390.004) -- 0:00:32
471000 -- (-390.077) (-390.322) [-389.887] (-398.580) * (-389.782) [-390.150] (-390.963) (-389.230) -- 0:00:32
471500 -- (-391.903) [-393.465] (-393.076) (-389.504) * [-389.573] (-390.762) (-389.419) (-390.137) -- 0:00:32
472000 -- [-394.935] (-391.974) (-392.299) (-389.484) * (-393.160) (-391.120) [-388.816] (-391.791) -- 0:00:33
472500 -- (-391.432) [-390.667] (-391.168) (-389.791) * (-391.686) (-389.205) [-394.717] (-390.360) -- 0:00:33
473000 -- (-393.996) [-391.037] (-390.476) (-388.855) * [-391.175] (-397.453) (-390.854) (-390.559) -- 0:00:33
473500 -- (-393.823) (-391.082) (-389.993) [-391.626] * [-393.212] (-397.741) (-390.018) (-389.941) -- 0:00:33
474000 -- (-389.499) (-396.465) (-391.579) [-389.363] * [-390.293] (-390.400) (-391.618) (-390.330) -- 0:00:33
474500 -- (-389.209) (-391.594) (-392.048) [-389.416] * (-392.672) [-389.139] (-390.545) (-393.590) -- 0:00:33
475000 -- (-391.646) (-391.110) (-392.724) [-391.075] * (-398.285) [-389.781] (-389.229) (-390.224) -- 0:00:33
Average standard deviation of split frequencies: 0.011575
475500 -- [-397.034] (-397.677) (-390.779) (-393.223) * (-390.867) [-389.812] (-389.772) (-390.876) -- 0:00:33
476000 -- (-390.974) [-391.054] (-389.684) (-389.898) * (-394.208) (-389.276) [-392.829] (-390.575) -- 0:00:33
476500 -- (-390.735) [-390.708] (-390.701) (-391.965) * (-391.373) (-389.575) [-391.436] (-391.611) -- 0:00:32
477000 -- (-391.519) (-393.610) (-390.173) [-392.588] * (-391.787) (-391.263) [-391.235] (-390.579) -- 0:00:32
477500 -- (-391.310) [-389.432] (-390.402) (-392.176) * (-390.170) [-390.070] (-390.802) (-391.570) -- 0:00:32
478000 -- [-390.532] (-390.869) (-395.840) (-393.430) * (-392.188) (-389.339) [-389.583] (-391.674) -- 0:00:32
478500 -- (-390.926) [-390.417] (-389.524) (-396.530) * (-391.930) (-391.649) (-389.929) [-390.830] -- 0:00:32
479000 -- [-390.857] (-388.972) (-390.278) (-390.353) * [-391.287] (-393.122) (-392.415) (-392.999) -- 0:00:32
479500 -- (-391.521) [-389.455] (-390.148) (-389.912) * (-394.362) (-390.701) (-391.942) [-390.963] -- 0:00:32
480000 -- (-392.683) [-391.828] (-390.747) (-389.680) * (-392.312) (-392.099) [-389.385] (-392.938) -- 0:00:32
Average standard deviation of split frequencies: 0.010849
480500 -- (-391.210) (-391.465) [-392.306] (-391.878) * (-392.752) (-391.164) (-388.887) [-391.529] -- 0:00:32
481000 -- [-390.922] (-391.389) (-396.575) (-391.604) * (-388.956) (-394.295) (-393.579) [-389.157] -- 0:00:32
481500 -- (-390.330) (-392.252) (-391.953) [-391.721] * (-391.746) (-393.857) [-390.064] (-390.861) -- 0:00:32
482000 -- (-391.346) (-393.388) [-397.366] (-393.388) * (-391.983) [-391.252] (-392.311) (-391.347) -- 0:00:32
482500 -- (-391.633) (-389.869) (-393.987) [-391.410] * [-390.104] (-390.281) (-392.705) (-390.818) -- 0:00:32
483000 -- (-393.727) (-390.442) (-392.089) [-389.600] * (-390.712) (-390.650) (-390.215) [-389.504] -- 0:00:32
483500 -- (-393.333) (-392.144) (-392.398) [-389.999] * (-392.100) [-390.734] (-393.396) (-388.817) -- 0:00:32
484000 -- [-390.360] (-393.234) (-392.723) (-390.612) * (-389.440) (-390.346) [-391.266] (-390.014) -- 0:00:31
484500 -- (-389.986) (-389.047) (-390.638) [-388.784] * (-394.674) (-390.480) (-393.345) [-390.469] -- 0:00:31
485000 -- (-393.463) (-389.280) [-389.941] (-390.264) * (-390.380) [-389.652] (-388.983) (-389.212) -- 0:00:31
Average standard deviation of split frequencies: 0.010367
485500 -- (-390.912) (-391.659) (-392.873) [-395.061] * [-391.659] (-388.772) (-389.072) (-391.380) -- 0:00:31
486000 -- (-391.041) (-389.192) (-392.959) [-389.886] * [-400.092] (-393.103) (-390.622) (-390.491) -- 0:00:31
486500 -- (-392.796) [-389.345] (-395.630) (-393.047) * [-391.407] (-399.182) (-390.270) (-391.518) -- 0:00:31
487000 -- (-391.069) (-390.803) [-393.137] (-390.860) * (-392.568) (-391.360) [-391.187] (-392.015) -- 0:00:31
487500 -- (-389.041) (-393.510) [-392.307] (-390.049) * [-389.523] (-390.527) (-395.299) (-389.696) -- 0:00:32
488000 -- (-392.259) (-391.751) (-393.375) [-390.690] * [-390.262] (-393.733) (-389.744) (-390.586) -- 0:00:32
488500 -- (-391.586) (-390.015) (-394.111) [-388.877] * (-394.266) (-390.219) (-389.265) [-391.161] -- 0:00:32
489000 -- (-390.969) [-390.401] (-390.949) (-391.603) * (-388.985) (-391.659) [-391.625] (-388.914) -- 0:00:32
489500 -- (-390.307) [-391.220] (-392.116) (-391.230) * [-389.570] (-397.502) (-391.379) (-390.512) -- 0:00:32
490000 -- (-391.049) (-391.689) [-392.088] (-390.963) * [-392.998] (-394.498) (-392.193) (-394.844) -- 0:00:32
Average standard deviation of split frequencies: 0.009547
490500 -- (-390.572) (-393.278) (-391.431) [-389.025] * (-392.384) [-390.422] (-393.653) (-396.307) -- 0:00:32
491000 -- (-389.597) (-390.225) (-390.747) [-389.659] * (-392.792) [-394.429] (-391.390) (-392.156) -- 0:00:32
491500 -- [-390.310] (-393.884) (-390.352) (-389.599) * (-392.535) (-389.403) (-391.338) [-390.247] -- 0:00:32
492000 -- (-391.677) (-392.949) [-391.906] (-391.076) * (-389.123) (-390.492) [-395.649] (-392.511) -- 0:00:32
492500 -- (-395.750) [-394.647] (-394.697) (-392.879) * [-390.433] (-389.123) (-390.783) (-391.321) -- 0:00:31
493000 -- (-389.663) (-388.777) [-390.773] (-390.324) * [-393.820] (-391.492) (-392.790) (-390.370) -- 0:00:31
493500 -- (-392.024) [-390.373] (-393.124) (-389.887) * (-388.996) [-389.971] (-392.391) (-389.280) -- 0:00:31
494000 -- [-389.568] (-394.966) (-390.992) (-395.051) * (-389.698) (-392.938) [-391.596] (-389.777) -- 0:00:31
494500 -- (-391.385) [-388.713] (-390.993) (-392.819) * [-390.420] (-391.932) (-390.862) (-391.694) -- 0:00:31
495000 -- (-392.410) [-389.225] (-398.157) (-389.135) * (-391.395) (-391.902) [-391.198] (-391.283) -- 0:00:31
Average standard deviation of split frequencies: 0.010217
495500 -- [-393.744] (-393.807) (-390.504) (-394.988) * (-389.368) [-392.112] (-389.959) (-394.091) -- 0:00:31
496000 -- (-393.776) (-392.263) [-390.853] (-391.813) * [-390.680] (-389.922) (-391.374) (-389.483) -- 0:00:31
496500 -- (-394.056) (-393.215) [-393.041] (-388.914) * [-391.204] (-391.356) (-389.591) (-393.855) -- 0:00:31
497000 -- (-390.753) (-390.794) [-389.929] (-390.565) * (-391.697) (-392.296) (-391.525) [-392.609] -- 0:00:31
497500 -- (-392.698) (-391.503) [-390.001] (-389.379) * [-389.961] (-390.780) (-390.976) (-389.859) -- 0:00:31
498000 -- (-389.629) (-393.540) [-389.143] (-389.704) * (-392.602) (-391.917) [-392.090] (-390.360) -- 0:00:31
498500 -- [-389.192] (-390.295) (-392.009) (-390.257) * [-389.268] (-390.761) (-390.423) (-391.028) -- 0:00:31
499000 -- (-391.201) (-390.228) (-389.876) [-391.258] * (-389.518) (-390.399) [-389.157] (-390.227) -- 0:00:31
499500 -- (-391.861) (-389.764) (-395.808) [-390.272] * (-391.408) (-389.414) (-389.680) [-395.947] -- 0:00:31
500000 -- (-390.723) (-389.642) [-389.270] (-389.532) * (-389.142) (-389.328) (-390.132) [-389.436] -- 0:00:31
Average standard deviation of split frequencies: 0.010004
500500 -- [-392.945] (-389.242) (-389.177) (-391.744) * [-390.679] (-390.589) (-389.619) (-392.901) -- 0:00:30
501000 -- (-390.791) (-390.857) (-390.841) [-391.132] * (-391.581) (-390.547) (-392.481) [-389.832] -- 0:00:30
501500 -- [-390.343] (-390.459) (-390.342) (-391.209) * [-390.420] (-392.664) (-398.333) (-389.304) -- 0:00:30
502000 -- (-391.400) (-389.664) (-389.131) [-389.795] * [-389.899] (-392.442) (-390.168) (-390.692) -- 0:00:30
502500 -- (-392.191) (-389.341) [-388.992] (-389.021) * (-390.774) [-392.126] (-392.154) (-394.566) -- 0:00:30
503000 -- [-391.063] (-393.912) (-389.206) (-389.563) * [-393.925] (-393.377) (-393.480) (-394.262) -- 0:00:31
503500 -- (-389.530) (-392.638) [-390.626] (-391.940) * (-392.338) (-392.072) [-389.130] (-395.626) -- 0:00:31
504000 -- [-388.610] (-393.093) (-391.432) (-391.029) * [-392.159] (-394.295) (-388.938) (-390.974) -- 0:00:31
504500 -- (-392.701) [-389.249] (-391.721) (-389.130) * (-391.148) (-394.725) (-391.958) [-388.853] -- 0:00:31
505000 -- (-390.341) (-389.705) (-392.113) [-390.069] * (-391.070) (-389.658) (-392.241) [-394.829] -- 0:00:31
Average standard deviation of split frequencies: 0.010960
505500 -- (-390.413) (-391.712) (-389.818) [-391.311] * (-390.598) [-390.200] (-390.743) (-392.603) -- 0:00:31
506000 -- (-393.369) [-389.026] (-391.186) (-390.819) * (-391.711) [-390.477] (-395.264) (-392.157) -- 0:00:31
506500 -- [-392.355] (-390.197) (-392.344) (-391.441) * [-392.523] (-390.133) (-389.659) (-392.911) -- 0:00:31
507000 -- (-389.346) (-391.458) [-393.465] (-390.160) * [-392.458] (-391.624) (-395.207) (-390.654) -- 0:00:31
507500 -- (-392.385) [-389.942] (-392.372) (-390.243) * (-392.103) (-393.379) (-393.254) [-390.935] -- 0:00:31
508000 -- (-391.052) [-390.886] (-391.340) (-390.943) * (-392.388) (-390.615) (-396.626) [-389.818] -- 0:00:30
508500 -- [-391.757] (-390.327) (-390.183) (-391.809) * (-390.892) [-390.268] (-393.409) (-389.952) -- 0:00:30
509000 -- (-389.781) (-390.622) (-388.637) [-394.722] * (-390.567) [-390.331] (-390.334) (-392.477) -- 0:00:30
509500 -- (-392.310) [-391.550] (-389.656) (-398.753) * (-392.403) [-392.108] (-390.862) (-391.285) -- 0:00:30
510000 -- [-390.150] (-390.556) (-388.715) (-389.666) * [-389.848] (-391.122) (-391.318) (-392.563) -- 0:00:30
Average standard deviation of split frequencies: 0.010443
510500 -- (-389.533) (-389.556) [-389.218] (-389.784) * (-393.104) [-391.871] (-390.635) (-391.772) -- 0:00:30
511000 -- (-389.759) [-392.295] (-392.502) (-391.474) * (-391.371) (-389.395) (-392.709) [-390.881] -- 0:00:30
511500 -- [-389.339] (-390.601) (-391.104) (-390.417) * (-392.930) (-389.062) (-394.015) [-389.735] -- 0:00:30
512000 -- (-388.819) (-391.330) [-390.899] (-393.303) * (-392.721) (-390.024) (-389.242) [-389.634] -- 0:00:30
512500 -- (-392.709) (-390.605) [-391.813] (-390.767) * (-392.279) (-391.243) (-388.872) [-391.231] -- 0:00:30
513000 -- (-391.979) (-391.668) (-390.362) [-389.711] * (-390.161) [-389.789] (-390.419) (-393.822) -- 0:00:30
513500 -- (-390.528) (-393.713) [-389.170] (-389.367) * (-392.563) (-390.765) (-391.712) [-391.968] -- 0:00:30
514000 -- (-391.533) (-393.598) (-391.745) [-394.346] * (-389.981) (-391.535) (-390.968) [-388.869] -- 0:00:30
514500 -- (-390.544) (-391.000) [-394.122] (-390.463) * (-389.782) (-389.006) (-391.687) [-390.427] -- 0:00:30
515000 -- (-393.284) [-392.055] (-389.620) (-390.713) * (-392.186) (-391.064) [-389.673] (-389.914) -- 0:00:30
Average standard deviation of split frequencies: 0.010164
515500 -- (-391.295) [-391.206] (-389.356) (-393.434) * (-392.212) (-390.293) (-394.401) [-391.762] -- 0:00:30
516000 -- [-389.168] (-390.956) (-394.359) (-390.438) * (-389.939) [-391.706] (-389.632) (-389.803) -- 0:00:30
516500 -- [-392.416] (-391.331) (-390.367) (-389.720) * (-392.722) (-393.253) [-390.512] (-390.164) -- 0:00:29
517000 -- (-391.765) (-390.607) (-391.282) [-391.178] * [-390.660] (-394.445) (-390.856) (-390.368) -- 0:00:29
517500 -- (-394.057) (-392.981) (-390.380) [-391.975] * (-389.494) (-389.723) (-390.963) [-390.247] -- 0:00:29
518000 -- (-391.966) (-389.545) (-393.251) [-389.952] * (-389.383) [-391.056] (-390.626) (-392.365) -- 0:00:29
518500 -- (-391.658) (-392.256) (-390.550) [-390.166] * (-389.524) [-390.825] (-390.954) (-389.004) -- 0:00:29
519000 -- [-394.134] (-394.461) (-396.257) (-389.675) * (-397.368) (-395.837) (-392.674) [-389.189] -- 0:00:30
519500 -- (-397.011) (-393.406) [-390.045] (-389.369) * (-389.901) (-394.227) [-395.841] (-389.263) -- 0:00:30
520000 -- [-392.571] (-392.618) (-390.706) (-389.702) * (-393.373) (-389.860) [-392.372] (-388.644) -- 0:00:30
Average standard deviation of split frequencies: 0.009620
520500 -- [-392.354] (-391.362) (-389.502) (-388.809) * (-395.587) [-389.139] (-392.256) (-393.003) -- 0:00:30
521000 -- (-395.520) (-389.821) (-392.681) [-391.083] * (-392.865) [-391.315] (-390.464) (-391.827) -- 0:00:30
521500 -- (-392.879) (-390.079) (-394.935) [-389.204] * [-393.506] (-390.086) (-389.510) (-391.925) -- 0:00:30
522000 -- (-394.304) [-390.127] (-390.442) (-389.633) * (-393.091) [-389.209] (-391.301) (-389.763) -- 0:00:30
522500 -- (-396.867) (-389.372) (-395.185) [-389.790] * [-390.354] (-389.475) (-394.875) (-394.684) -- 0:00:30
523000 -- (-390.225) (-390.578) (-391.063) [-389.084] * (-392.311) [-393.829] (-393.121) (-393.637) -- 0:00:30
523500 -- [-390.501] (-391.053) (-390.149) (-389.763) * [-388.903] (-401.612) (-390.779) (-393.598) -- 0:00:30
524000 -- [-390.303] (-391.096) (-390.761) (-389.669) * (-389.602) (-390.952) [-388.918] (-390.044) -- 0:00:29
524500 -- [-393.838] (-390.819) (-391.060) (-389.942) * (-392.906) (-389.025) [-393.090] (-394.196) -- 0:00:29
525000 -- [-389.384] (-394.208) (-389.513) (-391.836) * (-392.841) (-391.517) [-392.074] (-392.077) -- 0:00:29
Average standard deviation of split frequencies: 0.008698
525500 -- (-389.168) [-389.478] (-392.114) (-390.411) * (-391.626) [-389.276] (-390.191) (-390.797) -- 0:00:29
526000 -- (-390.172) (-390.263) (-393.514) [-390.230] * (-389.438) [-391.286] (-389.930) (-391.468) -- 0:00:29
526500 -- [-388.874] (-391.850) (-391.617) (-390.708) * [-389.831] (-393.228) (-389.828) (-389.269) -- 0:00:29
527000 -- (-389.724) [-392.668] (-393.112) (-392.559) * (-391.126) (-390.301) (-389.708) [-393.998] -- 0:00:29
527500 -- (-391.102) [-389.526] (-392.041) (-391.068) * (-391.052) (-390.798) (-390.118) [-390.574] -- 0:00:29
528000 -- (-392.235) (-389.643) [-389.294] (-390.121) * (-392.271) (-396.795) (-390.642) [-389.375] -- 0:00:29
528500 -- (-395.640) [-391.444] (-389.054) (-390.628) * (-391.148) (-395.612) (-390.587) [-392.595] -- 0:00:29
529000 -- (-391.060) (-390.672) (-389.755) [-390.218] * (-398.090) (-394.584) (-389.749) [-391.945] -- 0:00:29
529500 -- (-390.866) (-391.017) (-391.307) [-390.397] * (-392.894) [-389.372] (-391.534) (-390.605) -- 0:00:29
530000 -- (-391.636) (-389.847) (-394.129) [-389.721] * (-390.085) (-394.009) (-391.242) [-391.336] -- 0:00:29
Average standard deviation of split frequencies: 0.009327
530500 -- [-391.799] (-389.982) (-389.604) (-389.864) * [-389.875] (-392.915) (-393.210) (-390.871) -- 0:00:29
531000 -- (-390.932) [-389.741] (-390.359) (-389.228) * (-396.863) (-390.986) (-392.989) [-389.188] -- 0:00:29
531500 -- (-391.172) [-391.563] (-389.227) (-389.075) * [-392.006] (-392.239) (-389.065) (-394.471) -- 0:00:29
532000 -- (-389.648) (-391.672) (-392.238) [-389.635] * [-391.881] (-392.099) (-388.789) (-390.650) -- 0:00:29
532500 -- [-389.646] (-389.943) (-388.983) (-391.282) * [-391.273] (-394.555) (-390.708) (-390.648) -- 0:00:28
533000 -- (-389.539) (-389.003) [-394.260] (-390.260) * (-390.895) (-392.761) [-394.660] (-390.587) -- 0:00:28
533500 -- (-391.128) (-389.584) [-389.795] (-390.944) * (-391.699) (-388.760) [-388.964] (-391.106) -- 0:00:28
534000 -- (-389.852) [-389.317] (-390.726) (-390.295) * (-394.513) (-389.705) [-392.473] (-389.063) -- 0:00:29
534500 -- (-390.334) [-389.803] (-393.107) (-389.701) * (-391.355) [-390.755] (-393.787) (-391.048) -- 0:00:29
535000 -- (-389.876) (-389.444) [-393.089] (-389.736) * [-390.996] (-391.947) (-391.533) (-391.527) -- 0:00:29
Average standard deviation of split frequencies: 0.009260
535500 -- (-392.554) (-389.031) (-390.700) [-391.664] * [-389.463] (-390.551) (-391.158) (-393.327) -- 0:00:29
536000 -- (-392.424) (-388.957) (-393.325) [-391.901] * (-389.168) [-390.440] (-390.759) (-392.045) -- 0:00:29
536500 -- [-390.347] (-391.361) (-390.862) (-391.146) * (-389.627) (-390.557) (-389.519) [-394.135] -- 0:00:29
537000 -- (-391.610) (-390.460) [-392.374] (-390.188) * (-390.231) [-391.704] (-396.129) (-394.922) -- 0:00:29
537500 -- [-390.606] (-389.938) (-389.826) (-395.802) * (-392.618) (-389.945) (-392.074) [-389.485] -- 0:00:29
538000 -- (-391.842) (-389.734) (-389.383) [-390.530] * (-393.509) [-390.149] (-389.375) (-389.006) -- 0:00:29
538500 -- [-392.791] (-389.549) (-394.592) (-390.135) * (-394.268) (-390.613) (-391.439) [-389.655] -- 0:00:29
539000 -- (-390.139) (-389.975) (-391.917) [-389.326] * [-392.327] (-393.595) (-390.173) (-390.634) -- 0:00:29
539500 -- [-391.911] (-391.481) (-389.486) (-393.057) * (-390.879) (-390.548) [-389.655] (-389.175) -- 0:00:29
540000 -- (-389.863) (-391.844) [-390.257] (-390.282) * (-390.319) (-389.731) [-390.410] (-389.592) -- 0:00:28
Average standard deviation of split frequencies: 0.009745
540500 -- (-390.397) [-392.719] (-394.946) (-392.415) * [-390.724] (-393.143) (-391.646) (-391.362) -- 0:00:28
541000 -- [-389.940] (-391.998) (-390.573) (-390.823) * (-389.959) (-388.770) (-391.252) [-391.657] -- 0:00:28
541500 -- (-390.362) [-389.492] (-389.115) (-391.391) * (-389.070) (-391.772) (-391.274) [-391.509] -- 0:00:28
542000 -- [-390.244] (-389.500) (-390.297) (-391.010) * [-389.740] (-392.703) (-392.552) (-394.162) -- 0:00:28
542500 -- [-391.836] (-389.720) (-394.675) (-389.906) * (-389.635) [-389.271] (-394.524) (-389.217) -- 0:00:28
543000 -- (-390.010) (-390.684) [-394.957] (-395.133) * (-389.326) (-392.797) (-390.580) [-390.667] -- 0:00:28
543500 -- [-391.400] (-389.924) (-394.051) (-390.714) * (-390.794) (-392.632) (-391.237) [-389.968] -- 0:00:28
544000 -- (-391.520) [-391.049] (-391.716) (-393.464) * (-391.434) (-389.304) (-391.279) [-390.568] -- 0:00:28
544500 -- [-389.683] (-389.764) (-392.818) (-392.090) * [-388.591] (-389.553) (-391.279) (-391.728) -- 0:00:28
545000 -- (-390.921) (-392.671) [-390.467] (-392.305) * (-390.396) (-392.277) [-390.178] (-391.564) -- 0:00:28
Average standard deviation of split frequencies: 0.010005
545500 -- (-392.560) [-392.249] (-391.874) (-389.970) * (-394.842) (-390.104) [-389.805] (-391.055) -- 0:00:28
546000 -- (-389.634) (-390.631) (-392.337) [-394.293] * (-390.333) (-389.973) [-391.509] (-394.280) -- 0:00:28
546500 -- [-393.822] (-397.450) (-389.978) (-393.964) * (-391.833) [-391.237] (-391.937) (-393.637) -- 0:00:28
547000 -- [-391.828] (-392.752) (-390.912) (-390.248) * (-390.193) (-390.750) [-392.073] (-390.443) -- 0:00:28
547500 -- (-390.698) (-395.337) (-389.471) [-393.133] * [-389.767] (-393.286) (-391.999) (-390.999) -- 0:00:28
548000 -- (-388.754) (-396.472) (-391.580) [-389.965] * (-390.740) [-390.679] (-392.169) (-389.544) -- 0:00:28
548500 -- (-389.938) [-390.191] (-390.652) (-391.260) * (-392.694) [-391.500] (-389.665) (-392.549) -- 0:00:27
549000 -- (-391.861) [-394.602] (-389.530) (-389.595) * (-389.742) (-394.202) [-390.418] (-388.958) -- 0:00:28
549500 -- (-392.819) [-391.433] (-390.548) (-391.947) * (-389.662) (-389.174) (-389.863) [-389.880] -- 0:00:28
550000 -- (-390.119) (-390.505) (-392.431) [-391.546] * [-392.578] (-392.234) (-393.761) (-397.282) -- 0:00:28
Average standard deviation of split frequencies: 0.010827
550500 -- (-390.469) [-391.407] (-395.195) (-393.204) * (-392.894) (-390.127) [-394.243] (-394.331) -- 0:00:28
551000 -- (-390.364) (-390.408) (-392.373) [-393.644] * (-393.718) [-388.934] (-390.883) (-396.098) -- 0:00:28
551500 -- (-392.796) (-389.911) [-393.406] (-390.931) * (-395.763) (-390.498) (-389.068) [-392.626] -- 0:00:28
552000 -- [-390.686] (-389.745) (-391.598) (-391.468) * (-390.971) (-391.011) [-389.883] (-393.573) -- 0:00:28
552500 -- (-389.271) [-390.231] (-391.432) (-392.074) * (-393.102) (-389.793) [-390.188] (-393.047) -- 0:00:28
553000 -- [-390.937] (-394.228) (-390.637) (-389.730) * (-390.847) (-390.063) [-392.848] (-391.519) -- 0:00:28
553500 -- (-392.407) (-393.785) (-389.976) [-389.210] * (-392.283) [-392.796] (-391.445) (-391.970) -- 0:00:28
554000 -- (-391.276) (-390.905) [-392.268] (-391.954) * [-390.138] (-391.445) (-390.729) (-390.105) -- 0:00:28
554500 -- (-390.164) [-389.207] (-394.317) (-395.425) * (-391.768) (-389.378) [-389.821] (-388.988) -- 0:00:28
555000 -- (-390.761) [-389.614] (-390.122) (-391.478) * (-393.960) (-389.496) (-392.122) [-389.499] -- 0:00:28
Average standard deviation of split frequencies: 0.010975
555500 -- (-390.436) (-389.803) (-391.833) [-394.561] * [-389.490] (-391.460) (-394.485) (-390.076) -- 0:00:28
556000 -- [-389.514] (-391.853) (-390.069) (-392.461) * (-392.324) [-389.983] (-395.453) (-393.959) -- 0:00:27
556500 -- [-389.341] (-391.310) (-393.237) (-391.003) * (-390.807) (-390.151) [-388.996] (-395.854) -- 0:00:27
557000 -- (-389.139) (-390.176) (-391.158) [-389.338] * (-391.639) (-390.976) (-390.702) [-391.186] -- 0:00:27
557500 -- [-392.688] (-389.493) (-391.864) (-389.302) * (-391.413) (-390.368) [-391.069] (-392.018) -- 0:00:27
558000 -- (-390.170) [-389.386] (-390.838) (-393.774) * (-394.819) [-392.050] (-391.098) (-398.127) -- 0:00:27
558500 -- [-391.418] (-389.539) (-390.285) (-391.803) * (-396.000) [-389.051] (-391.411) (-389.840) -- 0:00:27
559000 -- (-391.959) [-390.037] (-390.725) (-393.823) * [-392.664] (-391.673) (-393.024) (-393.048) -- 0:00:27
559500 -- (-393.766) (-394.344) [-392.543] (-391.943) * (-389.998) (-390.212) [-393.695] (-392.360) -- 0:00:27
560000 -- (-389.796) (-390.488) [-390.634] (-395.561) * (-390.486) (-394.046) [-390.088] (-391.238) -- 0:00:27
Average standard deviation of split frequencies: 0.010884
560500 -- (-389.744) (-392.223) [-390.815] (-390.085) * (-389.560) (-391.655) [-390.199] (-393.909) -- 0:00:27
561000 -- (-392.559) (-390.815) (-392.304) [-389.707] * [-389.368] (-395.821) (-391.052) (-394.924) -- 0:00:27
561500 -- [-391.361] (-391.239) (-390.958) (-389.053) * (-390.473) [-391.419] (-392.447) (-392.972) -- 0:00:27
562000 -- (-394.697) (-392.194) [-391.968] (-388.919) * (-389.749) (-392.659) [-391.385] (-392.433) -- 0:00:27
562500 -- [-390.402] (-392.048) (-393.553) (-390.185) * (-389.699) [-389.345] (-390.029) (-390.098) -- 0:00:27
563000 -- (-391.568) (-394.735) [-391.310] (-389.539) * (-393.084) (-395.970) [-392.008] (-390.577) -- 0:00:27
563500 -- (-391.048) (-391.834) (-390.142) [-390.004] * (-389.393) [-390.984] (-389.661) (-394.014) -- 0:00:27
564000 -- (-389.077) (-390.870) (-390.245) [-390.000] * [-391.542] (-389.504) (-393.906) (-391.227) -- 0:00:27
564500 -- (-389.922) [-389.789] (-390.180) (-390.578) * (-394.014) (-389.700) [-392.014] (-391.124) -- 0:00:27
565000 -- (-389.873) [-389.984] (-391.407) (-391.010) * (-392.025) [-391.516] (-392.445) (-389.851) -- 0:00:27
Average standard deviation of split frequencies: 0.010735
565500 -- [-389.565] (-390.057) (-390.384) (-392.388) * (-388.765) (-390.181) [-389.785] (-391.200) -- 0:00:27
566000 -- (-389.353) [-389.561] (-391.771) (-391.893) * (-389.384) (-390.717) (-392.171) [-391.403] -- 0:00:27
566500 -- (-391.146) [-390.953] (-393.519) (-390.454) * (-392.556) (-389.678) (-390.592) [-391.019] -- 0:00:27
567000 -- (-389.604) (-390.883) (-395.624) [-390.118] * (-391.226) (-392.158) [-391.075] (-393.309) -- 0:00:27
567500 -- (-393.788) (-393.454) [-389.741] (-389.365) * [-391.093] (-392.210) (-391.379) (-390.484) -- 0:00:27
568000 -- (-389.948) (-392.229) (-392.263) [-391.725] * (-389.817) [-388.899] (-392.426) (-389.322) -- 0:00:27
568500 -- (-390.092) (-391.380) (-392.422) [-390.062] * (-391.897) (-389.224) (-393.027) [-389.863] -- 0:00:27
569000 -- [-392.237] (-392.915) (-391.419) (-391.364) * [-389.668] (-391.678) (-389.839) (-390.085) -- 0:00:27
569500 -- (-390.345) (-390.694) [-390.582] (-392.185) * (-392.157) [-389.489] (-390.900) (-389.622) -- 0:00:27
570000 -- (-392.787) [-392.189] (-392.529) (-392.806) * (-390.442) (-390.293) [-389.701] (-389.444) -- 0:00:27
Average standard deviation of split frequencies: 0.010280
570500 -- (-390.009) (-392.301) [-392.831] (-392.615) * (-390.376) (-389.997) [-389.516] (-390.818) -- 0:00:27
571000 -- [-388.977] (-391.742) (-391.543) (-392.650) * (-390.424) [-391.142] (-394.054) (-390.932) -- 0:00:27
571500 -- (-389.429) [-392.047] (-391.927) (-393.047) * (-390.620) (-391.079) [-390.689] (-391.247) -- 0:00:26
572000 -- (-391.070) (-398.640) [-392.087] (-389.822) * (-389.694) [-391.063] (-391.929) (-394.223) -- 0:00:26
572500 -- (-391.417) (-391.833) [-391.790] (-390.715) * (-390.551) (-392.926) (-391.773) [-389.838] -- 0:00:26
573000 -- (-389.830) [-393.042] (-391.078) (-390.194) * (-390.715) (-394.750) [-389.680] (-389.774) -- 0:00:26
573500 -- (-390.895) [-389.625] (-391.212) (-389.380) * [-393.094] (-391.879) (-389.153) (-389.318) -- 0:00:26
574000 -- (-392.797) (-389.508) [-393.253] (-390.263) * (-389.487) (-392.951) (-388.788) [-389.462] -- 0:00:26
574500 -- (-389.479) [-389.552] (-393.930) (-391.653) * [-391.321] (-392.656) (-389.649) (-392.339) -- 0:00:26
575000 -- (-396.546) (-390.731) (-391.963) [-391.274] * (-390.801) [-391.400] (-392.305) (-394.214) -- 0:00:26
Average standard deviation of split frequencies: 0.010013
575500 -- (-393.670) [-392.375] (-395.223) (-390.593) * [-389.204] (-389.944) (-392.451) (-390.277) -- 0:00:26
576000 -- (-390.893) (-389.861) (-394.641) [-394.387] * (-396.194) (-392.686) (-392.603) [-389.337] -- 0:00:26
576500 -- (-394.030) (-393.645) [-390.550] (-394.744) * [-390.756] (-390.270) (-390.808) (-390.211) -- 0:00:26
577000 -- [-390.387] (-392.197) (-390.545) (-392.073) * (-393.032) [-390.928] (-393.519) (-391.311) -- 0:00:26
577500 -- (-395.522) [-389.395] (-389.585) (-391.309) * (-393.478) (-391.686) (-391.192) [-388.889] -- 0:00:26
578000 -- [-390.099] (-391.667) (-396.811) (-393.421) * (-390.344) [-389.544] (-391.327) (-395.191) -- 0:00:26
578500 -- (-393.035) (-394.545) [-390.384] (-395.443) * (-393.504) (-389.606) (-393.326) [-390.988] -- 0:00:26
579000 -- (-391.643) [-391.734] (-390.217) (-391.837) * [-390.330] (-392.047) (-391.513) (-390.701) -- 0:00:26
579500 -- (-390.305) (-390.960) (-389.181) [-389.791] * (-389.179) [-391.771] (-398.126) (-389.749) -- 0:00:26
580000 -- (-390.332) (-390.007) (-393.218) [-390.192] * [-389.522] (-388.944) (-390.435) (-388.869) -- 0:00:26
Average standard deviation of split frequencies: 0.009408
580500 -- [-389.984] (-389.511) (-389.480) (-392.443) * [-391.371] (-388.824) (-395.153) (-390.091) -- 0:00:26
581000 -- (-389.732) (-393.988) (-391.103) [-390.018] * (-389.317) (-389.487) (-389.918) [-393.887] -- 0:00:26
581500 -- (-390.856) (-396.063) [-390.349] (-391.823) * (-389.321) (-389.180) (-393.093) [-389.050] -- 0:00:26
582000 -- [-390.116] (-392.902) (-390.924) (-391.875) * (-391.238) (-390.866) (-395.998) [-391.933] -- 0:00:26
582500 -- [-390.655] (-390.914) (-389.791) (-391.981) * [-390.190] (-389.747) (-392.200) (-389.511) -- 0:00:26
583000 -- (-389.783) (-391.839) [-390.093] (-393.695) * (-390.823) (-393.381) (-392.689) [-392.022] -- 0:00:26
583500 -- (-391.111) [-390.167] (-390.687) (-393.307) * (-389.661) (-390.346) [-391.039] (-389.252) -- 0:00:26
584000 -- (-390.643) [-392.464] (-389.866) (-391.489) * (-389.245) (-389.351) (-392.437) [-390.661] -- 0:00:26
584500 -- (-391.083) (-392.737) [-391.707] (-389.999) * [-391.657] (-396.260) (-392.415) (-394.048) -- 0:00:26
585000 -- [-389.883] (-395.737) (-389.119) (-391.367) * (-391.944) (-389.945) [-389.875] (-391.432) -- 0:00:26
Average standard deviation of split frequencies: 0.009251
585500 -- (-390.538) (-392.643) (-390.791) [-392.419] * (-391.772) (-389.999) [-389.249] (-390.170) -- 0:00:26
586000 -- [-393.438] (-391.969) (-390.363) (-392.988) * (-394.250) (-388.868) (-389.340) [-391.758] -- 0:00:26
586500 -- [-390.877] (-389.115) (-389.971) (-391.050) * (-395.495) (-393.458) [-389.230] (-389.566) -- 0:00:26
587000 -- (-390.438) (-390.265) (-395.637) [-388.799] * (-396.464) [-394.848] (-393.602) (-389.575) -- 0:00:26
587500 -- [-392.030] (-392.663) (-389.965) (-392.448) * (-391.450) (-390.970) [-389.337] (-397.875) -- 0:00:25
588000 -- (-392.983) (-394.967) [-390.214] (-391.294) * [-389.699] (-391.518) (-392.257) (-390.818) -- 0:00:25
588500 -- (-389.331) [-392.035] (-390.216) (-394.238) * (-390.434) [-392.971] (-391.180) (-391.945) -- 0:00:25
589000 -- [-389.970] (-392.125) (-389.940) (-391.436) * (-392.863) (-391.893) (-389.320) [-392.117] -- 0:00:25
589500 -- (-390.532) (-392.186) [-390.975] (-391.260) * (-391.935) (-390.082) (-394.045) [-392.092] -- 0:00:25
590000 -- [-388.862] (-392.369) (-392.068) (-390.075) * (-390.578) [-390.900] (-390.942) (-392.059) -- 0:00:25
Average standard deviation of split frequencies: 0.009483
590500 -- (-394.036) (-390.393) (-391.839) [-389.659] * (-391.530) (-390.262) [-390.011] (-391.739) -- 0:00:25
591000 -- [-393.493] (-390.311) (-391.985) (-390.829) * (-392.099) (-390.561) (-391.346) [-393.122] -- 0:00:25
591500 -- (-389.661) (-391.103) [-391.010] (-389.816) * [-392.871] (-390.677) (-390.465) (-392.406) -- 0:00:25
592000 -- (-392.089) (-397.680) (-390.332) [-388.862] * (-391.056) [-390.762] (-393.412) (-397.350) -- 0:00:25
592500 -- (-393.265) [-393.405] (-388.868) (-389.740) * (-391.840) [-393.602] (-390.440) (-391.774) -- 0:00:25
593000 -- [-389.372] (-394.199) (-391.161) (-393.320) * [-392.787] (-391.045) (-389.560) (-393.952) -- 0:00:25
593500 -- [-391.409] (-389.510) (-391.042) (-392.114) * (-392.471) (-396.875) (-392.829) [-395.202] -- 0:00:25
594000 -- (-395.396) (-391.322) (-392.668) [-396.291] * (-392.873) (-389.792) [-391.992] (-392.314) -- 0:00:25
594500 -- (-391.984) (-389.062) [-391.969] (-392.423) * (-390.731) (-389.817) [-389.930] (-390.083) -- 0:00:25
595000 -- (-392.071) (-389.948) (-390.948) [-389.162] * [-390.630] (-391.715) (-390.910) (-391.561) -- 0:00:25
Average standard deviation of split frequencies: 0.009491
595500 -- (-395.070) [-389.310] (-391.152) (-389.229) * (-389.731) (-391.101) [-390.428] (-390.450) -- 0:00:25
596000 -- [-390.611] (-388.903) (-391.332) (-393.605) * (-393.745) (-390.043) [-393.355] (-391.890) -- 0:00:25
596500 -- (-392.508) [-390.543] (-389.354) (-388.997) * [-390.543] (-391.418) (-391.213) (-392.282) -- 0:00:25
597000 -- (-389.680) (-399.618) [-391.850] (-390.539) * [-388.957] (-395.024) (-389.821) (-396.513) -- 0:00:25
597500 -- (-393.682) [-397.661] (-391.897) (-390.063) * [-389.462] (-391.244) (-392.068) (-393.885) -- 0:00:25
598000 -- (-392.737) (-396.232) (-391.230) [-389.469] * [-392.972] (-391.197) (-391.397) (-389.114) -- 0:00:25
598500 -- (-393.582) (-389.642) (-390.261) [-390.044] * [-389.626] (-390.575) (-391.586) (-392.092) -- 0:00:25
599000 -- (-393.446) (-391.328) [-395.423] (-389.710) * [-390.544] (-390.161) (-389.780) (-393.329) -- 0:00:25
599500 -- [-391.350] (-390.707) (-389.574) (-391.244) * (-392.427) (-390.614) (-391.587) [-392.754] -- 0:00:25
600000 -- (-389.933) (-389.980) (-389.401) [-390.544] * (-389.384) (-395.696) [-392.456] (-393.833) -- 0:00:25
Average standard deviation of split frequencies: 0.009833
600500 -- (-391.831) [-389.561] (-389.405) (-393.119) * (-390.251) [-391.736] (-389.978) (-390.855) -- 0:00:25
601000 -- [-391.963] (-392.395) (-389.058) (-391.076) * (-389.974) [-389.618] (-388.982) (-391.015) -- 0:00:25
601500 -- [-395.301] (-389.787) (-390.261) (-388.909) * (-391.001) (-390.722) (-389.415) [-390.857] -- 0:00:25
602000 -- (-392.142) [-392.905] (-392.340) (-389.162) * (-390.448) (-390.977) (-389.206) [-390.084] -- 0:00:25
602500 -- [-398.424] (-391.039) (-391.312) (-390.216) * (-389.764) (-398.730) (-390.436) [-390.643] -- 0:00:25
603000 -- (-389.144) (-392.025) [-394.782] (-389.544) * (-392.137) [-389.723] (-392.255) (-393.300) -- 0:00:25
603500 -- (-391.841) [-392.445] (-392.411) (-390.159) * (-391.106) [-389.307] (-389.788) (-392.319) -- 0:00:24
604000 -- (-392.717) (-392.534) (-391.063) [-389.925] * (-392.342) (-390.663) (-392.340) [-390.349] -- 0:00:24
604500 -- (-395.201) (-394.393) [-391.724] (-390.521) * (-390.919) (-392.022) (-389.811) [-391.152] -- 0:00:24
605000 -- (-390.216) (-389.830) (-390.675) [-390.567] * [-392.872] (-393.048) (-390.760) (-393.901) -- 0:00:24
Average standard deviation of split frequencies: 0.010113
605500 -- (-391.457) (-389.626) [-390.824] (-391.595) * [-395.560] (-388.579) (-390.494) (-391.908) -- 0:00:24
606000 -- (-392.504) (-393.472) (-390.173) [-393.225] * (-391.491) (-390.873) [-389.307] (-391.348) -- 0:00:24
606500 -- [-395.447] (-390.589) (-390.023) (-391.442) * (-389.729) (-390.085) (-389.462) [-390.472] -- 0:00:24
607000 -- (-394.192) [-392.240] (-392.285) (-391.468) * (-389.306) (-389.533) [-392.187] (-391.565) -- 0:00:24
607500 -- (-394.290) [-391.336] (-393.703) (-392.008) * (-393.833) [-391.273] (-389.754) (-392.116) -- 0:00:24
608000 -- [-391.489] (-392.090) (-395.319) (-391.384) * [-389.619] (-391.113) (-389.610) (-389.319) -- 0:00:24
608500 -- (-391.626) (-392.394) [-391.369] (-390.396) * (-392.022) [-390.670] (-391.092) (-393.279) -- 0:00:24
609000 -- (-390.421) (-389.688) (-392.397) [-391.319] * (-396.471) (-391.863) (-391.930) [-390.738] -- 0:00:24
609500 -- [-388.812] (-391.474) (-391.763) (-389.592) * [-392.041] (-391.310) (-389.510) (-389.912) -- 0:00:24
610000 -- (-389.939) (-391.843) (-390.734) [-388.934] * (-392.460) [-393.757] (-391.137) (-390.853) -- 0:00:24
Average standard deviation of split frequencies: 0.010217
610500 -- (-397.833) (-392.685) (-390.928) [-392.169] * (-390.988) (-394.297) [-389.209] (-392.185) -- 0:00:24
611000 -- (-390.968) [-392.498] (-391.715) (-395.121) * (-391.874) (-391.279) [-389.074] (-389.356) -- 0:00:24
611500 -- [-390.183] (-389.393) (-390.161) (-389.916) * (-394.285) [-392.302] (-392.726) (-390.793) -- 0:00:24
612000 -- (-390.169) [-392.270] (-390.427) (-389.122) * (-390.394) (-393.724) (-389.224) [-391.183] -- 0:00:24
612500 -- (-395.623) [-390.399] (-389.113) (-392.357) * [-390.997] (-393.100) (-391.047) (-391.025) -- 0:00:24
613000 -- (-390.953) (-394.116) [-389.369] (-390.334) * [-390.865] (-391.892) (-390.643) (-393.788) -- 0:00:24
613500 -- [-389.378] (-390.194) (-394.482) (-391.242) * [-389.724] (-390.964) (-390.424) (-391.786) -- 0:00:24
614000 -- (-389.948) (-389.883) (-392.669) [-391.975] * [-392.512] (-389.535) (-389.492) (-390.306) -- 0:00:24
614500 -- (-393.570) (-389.312) (-392.275) [-390.574] * (-389.592) (-392.045) (-389.492) [-389.620] -- 0:00:24
615000 -- [-390.217] (-394.337) (-391.303) (-390.338) * (-391.481) (-391.204) (-391.674) [-390.317] -- 0:00:24
Average standard deviation of split frequencies: 0.010618
615500 -- [-389.248] (-398.096) (-389.592) (-393.615) * (-390.257) (-394.951) [-390.487] (-391.302) -- 0:00:24
616000 -- [-390.120] (-396.027) (-392.780) (-389.704) * (-389.951) (-390.567) (-390.170) [-393.138] -- 0:00:24
616500 -- (-390.314) [-391.331] (-390.225) (-389.216) * (-391.886) (-389.275) [-390.364] (-395.091) -- 0:00:24
617000 -- (-393.820) (-391.093) (-390.956) [-390.814] * (-390.994) [-390.986] (-391.012) (-393.350) -- 0:00:24
617500 -- (-390.936) (-391.131) [-389.098] (-391.146) * [-389.332] (-396.555) (-391.983) (-391.081) -- 0:00:24
618000 -- (-391.599) (-390.791) (-389.361) [-390.718] * (-389.236) (-390.390) [-389.453] (-391.524) -- 0:00:24
618500 -- [-391.137] (-389.530) (-389.153) (-391.435) * [-391.010] (-388.756) (-390.060) (-389.559) -- 0:00:24
619000 -- [-390.775] (-390.315) (-391.037) (-391.377) * (-392.570) (-391.998) [-391.293] (-392.092) -- 0:00:24
619500 -- (-394.438) (-392.199) [-390.599] (-390.897) * (-390.402) (-396.375) (-391.082) [-392.831] -- 0:00:23
620000 -- (-393.929) (-389.476) (-391.331) [-388.846] * [-389.069] (-391.448) (-390.751) (-390.039) -- 0:00:23
Average standard deviation of split frequencies: 0.010186
620500 -- (-395.469) (-389.362) (-393.127) [-389.864] * [-390.660] (-390.567) (-390.005) (-389.770) -- 0:00:23
621000 -- (-389.266) (-390.374) [-389.938] (-390.815) * [-391.270] (-391.245) (-392.374) (-391.908) -- 0:00:23
621500 -- [-393.001] (-389.695) (-391.486) (-396.643) * (-390.254) (-389.518) (-390.284) [-389.839] -- 0:00:23
622000 -- (-392.055) [-390.540] (-393.481) (-390.655) * (-395.175) (-393.971) (-390.906) [-389.556] -- 0:00:23
622500 -- (-390.186) (-390.572) (-393.429) [-392.509] * [-390.447] (-391.718) (-390.970) (-390.350) -- 0:00:23
623000 -- (-389.867) (-395.431) [-392.984] (-391.158) * (-389.701) (-393.617) (-393.717) [-390.715] -- 0:00:23
623500 -- (-391.716) (-395.826) (-390.821) [-390.874] * (-389.507) (-392.539) (-390.209) [-391.285] -- 0:00:23
624000 -- (-393.358) (-389.719) [-389.865] (-389.315) * (-390.916) (-389.742) (-392.124) [-393.565] -- 0:00:23
624500 -- (-389.394) [-394.150] (-389.689) (-390.848) * [-390.249] (-392.674) (-390.433) (-393.732) -- 0:00:23
625000 -- (-389.538) (-392.591) [-391.365] (-394.575) * (-389.368) [-392.409] (-391.106) (-389.621) -- 0:00:23
Average standard deviation of split frequencies: 0.010233
625500 -- (-392.138) [-392.668] (-389.902) (-389.830) * [-389.431] (-389.773) (-389.303) (-390.005) -- 0:00:23
626000 -- (-392.305) (-392.560) (-394.018) [-394.594] * (-391.161) [-390.599] (-389.373) (-392.965) -- 0:00:23
626500 -- [-393.817] (-390.734) (-394.249) (-388.822) * (-391.027) (-390.238) (-394.168) [-389.302] -- 0:00:23
627000 -- (-395.981) (-389.919) (-394.065) [-389.404] * (-394.840) (-394.314) [-392.402] (-389.317) -- 0:00:23
627500 -- (-392.781) (-390.432) (-390.048) [-389.823] * (-389.514) (-394.501) (-394.057) [-388.918] -- 0:00:23
628000 -- (-398.016) [-393.826] (-389.529) (-389.681) * [-391.991] (-393.452) (-392.062) (-392.221) -- 0:00:23
628500 -- [-391.026] (-389.903) (-392.989) (-389.603) * (-393.770) [-391.634] (-394.036) (-388.875) -- 0:00:23
629000 -- [-390.690] (-391.353) (-393.660) (-390.572) * (-395.989) [-389.900] (-392.892) (-388.917) -- 0:00:23
629500 -- (-391.658) [-390.928] (-391.610) (-393.473) * (-391.885) [-392.579] (-389.991) (-389.068) -- 0:00:23
630000 -- [-391.252] (-394.009) (-393.788) (-391.075) * [-390.527] (-391.922) (-389.865) (-392.627) -- 0:00:23
Average standard deviation of split frequencies: 0.010113
630500 -- (-393.128) [-395.926] (-393.518) (-390.447) * [-390.828] (-390.911) (-391.126) (-389.006) -- 0:00:23
631000 -- (-390.639) (-389.899) (-398.277) [-393.030] * (-389.527) [-393.333] (-389.485) (-392.264) -- 0:00:23
631500 -- (-393.032) [-390.880] (-395.338) (-389.639) * (-391.625) (-393.250) [-389.471] (-391.822) -- 0:00:23
632000 -- (-389.570) [-392.436] (-390.546) (-391.328) * (-392.342) (-391.528) (-389.537) [-389.783] -- 0:00:23
632500 -- [-389.336] (-393.043) (-391.299) (-389.899) * (-391.194) (-394.611) [-391.356] (-390.842) -- 0:00:23
633000 -- (-391.571) (-390.693) [-391.542] (-389.522) * (-390.866) (-389.347) [-392.101] (-390.925) -- 0:00:23
633500 -- (-390.709) [-394.188] (-389.989) (-391.138) * (-391.111) (-390.986) [-389.911] (-390.131) -- 0:00:23
634000 -- (-391.098) [-389.761] (-389.352) (-388.819) * (-392.931) [-388.877] (-391.023) (-390.914) -- 0:00:23
634500 -- (-391.759) (-391.118) (-393.215) [-390.404] * (-394.078) [-395.062] (-390.986) (-389.351) -- 0:00:23
635000 -- (-391.417) [-393.062] (-392.438) (-388.897) * (-391.147) [-390.447] (-392.868) (-388.780) -- 0:00:22
Average standard deviation of split frequencies: 0.009766
635500 -- (-389.835) (-391.784) [-389.944] (-391.032) * (-389.616) (-392.194) [-390.971] (-391.487) -- 0:00:22
636000 -- (-395.255) (-390.096) [-389.044] (-394.277) * (-391.546) (-390.269) (-388.941) [-390.122] -- 0:00:22
636500 -- [-390.208] (-390.625) (-391.580) (-394.417) * (-389.509) (-395.703) (-389.871) [-389.555] -- 0:00:22
637000 -- (-393.357) (-394.516) [-389.014] (-390.629) * (-391.920) [-395.277] (-392.513) (-390.397) -- 0:00:22
637500 -- (-392.461) (-390.618) [-390.349] (-392.685) * (-391.280) [-390.536] (-397.718) (-391.531) -- 0:00:22
638000 -- (-392.760) (-391.958) [-394.121] (-392.641) * (-391.612) (-393.815) (-389.733) [-391.307] -- 0:00:22
638500 -- (-389.864) (-392.954) [-390.079] (-390.200) * [-392.760] (-389.673) (-390.670) (-393.445) -- 0:00:22
639000 -- (-389.766) (-392.142) (-393.178) [-389.573] * (-391.476) [-389.856] (-393.605) (-392.346) -- 0:00:22
639500 -- (-393.039) [-389.295] (-393.054) (-389.293) * (-391.963) [-389.836] (-389.957) (-390.117) -- 0:00:23
640000 -- (-392.426) (-397.501) (-394.601) [-394.088] * (-389.933) (-390.457) [-390.031] (-394.660) -- 0:00:23
Average standard deviation of split frequencies: 0.009609
640500 -- (-390.197) (-392.031) [-392.295] (-390.313) * (-392.218) [-390.843] (-393.516) (-391.450) -- 0:00:23
641000 -- [-395.093] (-394.455) (-393.415) (-389.572) * [-391.831] (-389.560) (-391.553) (-391.052) -- 0:00:22
641500 -- (-391.891) (-390.283) (-393.027) [-389.920] * [-392.359] (-392.380) (-390.377) (-392.885) -- 0:00:22
642000 -- (-390.560) [-390.535] (-393.949) (-393.684) * [-389.858] (-389.116) (-390.608) (-388.849) -- 0:00:22
642500 -- (-390.481) (-389.577) (-389.361) [-389.425] * (-389.584) (-391.063) (-390.816) [-389.251] -- 0:00:22
643000 -- (-393.486) (-391.500) (-392.938) [-390.675] * (-389.016) (-392.169) (-389.142) [-394.277] -- 0:00:22
643500 -- [-389.497] (-395.202) (-390.362) (-391.416) * (-391.050) (-389.779) (-390.883) [-391.232] -- 0:00:22
644000 -- (-389.894) (-390.695) (-388.904) [-391.071] * (-389.166) (-390.676) (-393.907) [-389.813] -- 0:00:22
644500 -- (-390.706) (-394.487) (-389.963) [-390.466] * (-392.621) (-390.153) [-391.158] (-392.936) -- 0:00:22
645000 -- (-389.980) (-392.770) [-390.213] (-389.394) * [-391.728] (-392.988) (-390.494) (-394.728) -- 0:00:22
Average standard deviation of split frequencies: 0.009959
645500 -- (-394.570) (-394.594) (-391.285) [-390.313] * (-391.245) (-389.380) [-393.349] (-398.512) -- 0:00:22
646000 -- (-393.960) [-391.395] (-391.672) (-390.514) * (-390.783) [-391.903] (-389.853) (-393.735) -- 0:00:22
646500 -- [-391.887] (-391.189) (-390.354) (-391.188) * (-390.374) (-393.176) (-391.561) [-391.931] -- 0:00:22
647000 -- (-390.758) (-399.133) [-391.065] (-391.043) * [-391.221] (-391.206) (-388.994) (-393.264) -- 0:00:22
647500 -- (-392.132) [-393.464] (-390.467) (-392.463) * (-390.969) [-390.777] (-391.572) (-390.059) -- 0:00:22
648000 -- (-396.928) (-393.348) [-390.618] (-391.124) * (-391.523) [-389.142] (-391.738) (-388.899) -- 0:00:22
648500 -- [-395.884] (-391.711) (-390.402) (-390.125) * (-389.172) (-390.531) (-390.256) [-392.515] -- 0:00:22
649000 -- (-395.224) (-395.283) (-389.767) [-389.790] * (-390.184) (-392.479) [-392.779] (-390.956) -- 0:00:22
649500 -- (-391.612) [-389.426] (-392.475) (-392.469) * (-396.927) (-390.268) (-393.041) [-390.536] -- 0:00:22
650000 -- [-392.707] (-390.460) (-390.210) (-395.544) * (-395.524) [-393.517] (-391.345) (-390.677) -- 0:00:22
Average standard deviation of split frequencies: 0.009205
650500 -- (-395.824) (-390.998) (-390.462) [-389.870] * (-390.635) (-392.125) [-390.784] (-393.863) -- 0:00:22
651000 -- (-389.990) [-389.714] (-391.762) (-389.408) * (-389.804) (-390.407) (-389.795) [-391.568] -- 0:00:21
651500 -- [-390.044] (-390.421) (-389.647) (-390.808) * (-390.393) [-393.100] (-392.801) (-391.681) -- 0:00:21
652000 -- (-390.784) [-389.307] (-389.176) (-390.008) * [-389.478] (-390.984) (-390.742) (-391.932) -- 0:00:21
652500 -- [-390.083] (-391.279) (-390.442) (-390.923) * (-389.439) [-391.701] (-391.087) (-392.309) -- 0:00:21
653000 -- [-390.629] (-390.926) (-390.183) (-392.440) * (-390.014) (-393.462) (-388.780) [-389.460] -- 0:00:21
653500 -- [-395.150] (-390.350) (-390.642) (-391.373) * (-390.844) [-391.101] (-390.516) (-391.858) -- 0:00:21
654000 -- (-392.756) (-392.381) (-390.100) [-392.462] * (-391.437) (-391.619) (-391.290) [-390.948] -- 0:00:21
654500 -- (-392.924) (-401.184) (-390.472) [-392.313] * (-394.806) [-389.126] (-391.760) (-390.280) -- 0:00:22
655000 -- (-389.283) [-392.006] (-390.163) (-392.733) * (-393.743) (-392.322) [-389.261] (-389.309) -- 0:00:22
Average standard deviation of split frequencies: 0.009131
655500 -- [-388.964] (-391.608) (-390.424) (-395.274) * (-391.093) (-391.048) [-392.863] (-389.360) -- 0:00:22
656000 -- (-388.932) (-390.351) (-389.645) [-394.214] * (-389.956) (-392.813) [-394.028] (-391.613) -- 0:00:22
656500 -- (-391.149) (-391.150) [-390.273] (-390.750) * (-389.616) (-389.735) [-391.490] (-394.419) -- 0:00:21
657000 -- (-394.096) (-393.855) (-390.433) [-390.440] * (-390.435) [-390.576] (-390.560) (-390.444) -- 0:00:21
657500 -- (-391.294) (-389.086) (-392.998) [-390.484] * (-391.100) (-392.687) (-389.759) [-390.499] -- 0:00:21
658000 -- [-391.281] (-391.802) (-394.433) (-392.550) * (-393.144) [-390.841] (-393.980) (-392.242) -- 0:00:21
658500 -- (-391.670) (-394.172) [-392.877] (-389.156) * (-390.604) (-393.006) [-392.392] (-392.414) -- 0:00:21
659000 -- (-391.804) (-395.511) [-391.842] (-389.628) * (-390.345) [-390.048] (-391.197) (-392.157) -- 0:00:21
659500 -- (-391.018) (-391.407) [-394.805] (-389.673) * (-395.016) (-393.582) [-392.824] (-392.632) -- 0:00:21
660000 -- [-391.214] (-395.761) (-394.886) (-390.105) * (-391.781) (-392.372) [-389.737] (-395.761) -- 0:00:21
Average standard deviation of split frequencies: 0.009365
660500 -- (-392.363) (-389.517) [-391.168] (-390.619) * (-390.049) (-391.521) [-390.395] (-391.197) -- 0:00:21
661000 -- (-390.930) [-390.431] (-389.052) (-395.138) * (-391.018) (-388.995) [-391.779] (-391.259) -- 0:00:21
661500 -- (-391.905) [-388.872] (-392.549) (-390.470) * (-393.776) [-389.320] (-393.814) (-392.585) -- 0:00:21
662000 -- (-389.231) [-388.868] (-389.786) (-394.234) * (-390.219) (-389.912) [-392.071] (-391.092) -- 0:00:21
662500 -- [-389.473] (-389.506) (-389.665) (-390.851) * (-390.460) (-392.046) [-389.660] (-394.862) -- 0:00:21
663000 -- (-390.937) (-393.595) (-391.091) [-390.762] * [-391.754] (-397.559) (-393.529) (-391.213) -- 0:00:21
663500 -- [-390.435] (-391.616) (-393.110) (-396.599) * (-392.782) [-395.182] (-389.919) (-394.285) -- 0:00:21
664000 -- (-394.261) [-389.893] (-390.185) (-393.475) * (-391.989) (-389.530) [-393.637] (-394.060) -- 0:00:21
664500 -- (-390.988) (-389.445) [-391.117] (-393.688) * (-389.927) (-389.791) (-392.402) [-393.887] -- 0:00:21
665000 -- [-392.680] (-389.418) (-391.302) (-389.922) * (-390.308) (-389.596) [-390.017] (-390.081) -- 0:00:21
Average standard deviation of split frequencies: 0.009777
665500 -- (-392.238) (-390.443) (-391.120) [-389.446] * [-392.580] (-389.130) (-389.196) (-392.883) -- 0:00:21
666000 -- (-392.277) (-389.999) [-390.884] (-389.549) * (-393.449) (-389.887) (-390.356) [-393.777] -- 0:00:21
666500 -- (-391.054) [-389.090] (-394.475) (-388.936) * (-392.237) (-390.745) (-389.538) [-390.560] -- 0:00:21
667000 -- [-391.838] (-393.069) (-392.852) (-388.573) * [-390.521] (-391.961) (-390.906) (-390.509) -- 0:00:21
667500 -- (-391.098) (-389.674) [-391.674] (-391.195) * (-392.037) [-397.288] (-391.823) (-392.818) -- 0:00:21
668000 -- (-392.065) (-392.561) [-392.219] (-390.345) * (-390.713) (-402.206) (-390.287) [-392.368] -- 0:00:21
668500 -- (-393.130) [-394.534] (-390.768) (-390.746) * [-392.117] (-390.542) (-390.325) (-398.087) -- 0:00:21
669000 -- (-391.983) [-389.542] (-391.656) (-389.806) * (-392.900) (-389.837) [-391.232] (-393.051) -- 0:00:21
669500 -- (-392.320) [-390.197] (-389.123) (-389.520) * (-392.528) (-389.422) [-391.396] (-391.172) -- 0:00:21
670000 -- (-390.302) [-389.603] (-390.748) (-390.289) * [-390.817] (-392.517) (-390.904) (-392.863) -- 0:00:21
Average standard deviation of split frequencies: 0.009753
670500 -- (-389.818) (-389.981) [-389.026] (-391.081) * (-389.026) (-392.021) (-390.025) [-395.125] -- 0:00:21
671000 -- [-391.509] (-393.626) (-390.342) (-394.198) * (-394.099) (-391.122) (-389.203) [-391.240] -- 0:00:21
671500 -- (-390.339) [-390.970] (-390.698) (-390.218) * (-393.943) (-396.959) [-388.793] (-389.999) -- 0:00:21
672000 -- (-395.122) (-394.178) [-392.329] (-390.372) * [-391.766] (-395.220) (-388.901) (-390.747) -- 0:00:20
672500 -- (-392.860) [-389.943] (-390.006) (-388.789) * (-392.203) (-390.974) (-389.576) [-389.989] -- 0:00:20
673000 -- (-391.775) (-391.176) [-389.991] (-388.793) * (-391.657) (-390.278) (-390.992) [-392.217] -- 0:00:20
673500 -- (-390.298) (-393.869) [-391.423] (-390.286) * (-390.970) (-399.552) [-389.536] (-393.546) -- 0:00:20
674000 -- (-392.228) (-389.923) [-390.687] (-394.186) * (-397.673) [-390.191] (-389.580) (-391.887) -- 0:00:20
674500 -- (-391.220) [-389.050] (-392.739) (-391.025) * (-394.647) (-391.523) (-393.157) [-393.266] -- 0:00:20
675000 -- (-393.441) [-388.889] (-390.940) (-392.231) * (-391.352) (-390.356) (-390.132) [-389.026] -- 0:00:20
Average standard deviation of split frequencies: 0.009588
675500 -- (-390.574) (-396.080) [-390.785] (-393.786) * [-394.820] (-391.814) (-389.772) (-388.925) -- 0:00:20
676000 -- (-389.846) (-392.739) (-390.393) [-395.649] * [-391.928] (-391.579) (-389.040) (-390.313) -- 0:00:20
676500 -- [-389.892] (-391.467) (-391.909) (-391.475) * (-390.498) (-395.358) (-391.629) [-391.701] -- 0:00:20
677000 -- (-390.896) [-391.855] (-393.678) (-390.582) * [-392.090] (-394.012) (-389.807) (-390.579) -- 0:00:20
677500 -- (-391.436) (-390.577) (-392.925) [-390.765] * (-390.804) [-391.816] (-395.619) (-390.650) -- 0:00:20
678000 -- (-391.080) (-390.992) [-392.440] (-389.441) * [-390.347] (-389.128) (-393.080) (-390.482) -- 0:00:20
678500 -- [-389.618] (-392.154) (-390.703) (-391.923) * [-390.868] (-390.821) (-393.146) (-391.676) -- 0:00:20
679000 -- [-390.544] (-397.362) (-390.169) (-389.619) * (-391.635) (-393.443) (-393.416) [-389.276] -- 0:00:20
679500 -- (-392.651) [-388.990] (-389.252) (-389.763) * [-389.464] (-390.370) (-394.134) (-389.347) -- 0:00:20
680000 -- [-389.261] (-391.887) (-389.795) (-392.311) * (-390.158) (-392.499) [-391.163] (-391.168) -- 0:00:20
Average standard deviation of split frequencies: 0.009176
680500 -- (-389.849) [-394.540] (-391.867) (-390.725) * (-391.049) (-393.148) [-391.844] (-390.572) -- 0:00:20
681000 -- (-389.760) [-391.480] (-390.316) (-393.007) * (-390.008) [-391.986] (-393.236) (-391.304) -- 0:00:20
681500 -- [-389.629] (-391.360) (-390.603) (-389.915) * (-388.835) (-393.889) (-394.200) [-391.233] -- 0:00:20
682000 -- (-390.858) (-390.519) (-389.251) [-389.968] * (-391.967) (-390.781) (-392.032) [-393.085] -- 0:00:20
682500 -- (-391.335) (-389.996) (-392.440) [-389.683] * [-391.631] (-389.400) (-395.055) (-393.995) -- 0:00:20
683000 -- (-390.917) (-389.459) (-389.991) [-389.424] * [-390.657] (-389.482) (-395.613) (-393.254) -- 0:00:20
683500 -- (-390.078) (-389.336) [-391.130] (-393.045) * [-392.565] (-393.504) (-393.529) (-391.863) -- 0:00:20
684000 -- (-390.489) (-390.914) (-391.631) [-393.003] * (-391.593) [-389.354] (-390.108) (-390.707) -- 0:00:20
684500 -- (-392.352) (-392.505) [-390.643] (-392.614) * (-393.909) (-395.571) (-389.037) [-389.704] -- 0:00:20
685000 -- [-390.805] (-389.721) (-390.177) (-391.556) * (-394.038) (-391.331) [-389.562] (-388.888) -- 0:00:20
Average standard deviation of split frequencies: 0.009406
685500 -- (-389.632) (-390.211) [-390.253] (-391.851) * (-391.415) (-390.231) (-388.718) [-389.276] -- 0:00:20
686000 -- (-398.438) (-394.177) (-392.283) [-389.088] * (-390.771) [-389.016] (-389.684) (-391.044) -- 0:00:20
686500 -- (-390.131) (-392.648) (-392.976) [-392.011] * (-391.373) (-389.528) (-390.060) [-389.253] -- 0:00:20
687000 -- [-391.971] (-394.278) (-393.971) (-389.095) * (-391.526) [-389.489] (-389.258) (-389.614) -- 0:00:20
687500 -- (-392.952) (-389.367) [-390.980] (-393.354) * (-389.943) (-393.254) (-390.319) [-391.566] -- 0:00:20
688000 -- (-390.470) (-390.011) (-390.183) [-389.240] * [-390.716] (-393.761) (-392.780) (-391.183) -- 0:00:19
688500 -- (-390.564) (-390.011) [-391.079] (-388.884) * (-388.956) (-397.308) [-395.341] (-389.283) -- 0:00:19
689000 -- [-399.200] (-390.738) (-389.217) (-392.364) * (-390.431) (-400.022) (-389.454) [-389.804] -- 0:00:19
689500 -- (-393.613) (-389.868) [-389.164] (-392.641) * [-391.273] (-392.120) (-390.105) (-391.119) -- 0:00:19
690000 -- (-392.385) (-394.024) (-390.377) [-391.367] * [-389.464] (-390.773) (-389.514) (-392.948) -- 0:00:19
Average standard deviation of split frequencies: 0.009214
690500 -- [-391.958] (-391.305) (-391.499) (-389.502) * (-390.248) (-394.595) (-391.373) [-392.349] -- 0:00:19
691000 -- (-394.154) (-391.925) (-395.180) [-389.544] * (-391.436) (-392.845) (-390.329) [-390.771] -- 0:00:19
691500 -- (-392.315) (-392.554) (-389.838) [-390.028] * (-390.710) (-392.592) (-392.912) [-390.071] -- 0:00:20
692000 -- (-391.399) (-392.292) [-389.316] (-389.826) * [-393.046] (-389.812) (-389.772) (-390.982) -- 0:00:20
692500 -- [-390.030] (-391.228) (-390.575) (-390.916) * [-389.150] (-390.304) (-391.766) (-393.054) -- 0:00:19
693000 -- (-389.904) [-390.348] (-390.294) (-389.439) * [-389.300] (-389.156) (-392.571) (-391.189) -- 0:00:19
693500 -- (-390.635) (-390.643) (-390.708) [-390.993] * [-389.284] (-393.597) (-398.495) (-390.341) -- 0:00:19
694000 -- [-390.704] (-394.145) (-392.146) (-394.113) * [-391.212] (-392.399) (-393.561) (-391.324) -- 0:00:19
694500 -- (-392.046) [-391.199] (-390.509) (-391.430) * (-392.901) (-390.833) [-392.520] (-392.225) -- 0:00:19
695000 -- (-394.278) [-389.515] (-390.854) (-391.423) * (-392.538) (-390.178) [-391.368] (-390.850) -- 0:00:19
Average standard deviation of split frequencies: 0.009398
695500 -- (-393.301) [-391.472] (-389.942) (-391.152) * (-393.425) (-390.452) [-395.302] (-399.234) -- 0:00:19
696000 -- (-389.420) (-388.868) [-392.101] (-391.230) * (-392.433) [-393.384] (-394.225) (-392.150) -- 0:00:19
696500 -- [-388.847] (-391.215) (-391.484) (-389.216) * (-392.488) (-392.959) [-390.534] (-395.001) -- 0:00:19
697000 -- (-390.245) (-391.722) (-390.749) [-389.796] * (-391.827) [-390.911] (-392.369) (-390.597) -- 0:00:19
697500 -- (-393.506) (-394.924) [-389.583] (-389.454) * [-390.539] (-391.225) (-391.453) (-388.691) -- 0:00:19
698000 -- (-393.107) (-393.658) (-392.663) [-390.127] * (-393.316) (-389.392) [-391.435] (-389.885) -- 0:00:19
698500 -- (-393.478) (-395.242) [-390.360] (-390.199) * [-390.117] (-390.327) (-389.188) (-392.611) -- 0:00:19
699000 -- [-392.909] (-390.153) (-389.551) (-391.422) * [-390.442] (-390.082) (-400.069) (-390.413) -- 0:00:19
699500 -- (-391.207) [-391.482] (-389.795) (-389.943) * [-391.635] (-391.934) (-394.870) (-395.142) -- 0:00:19
700000 -- (-391.171) (-391.232) (-393.157) [-389.911] * (-389.775) [-389.932] (-390.898) (-390.951) -- 0:00:19
Average standard deviation of split frequencies: 0.009335
700500 -- (-391.287) (-392.657) [-392.329] (-389.251) * (-390.006) (-390.470) (-390.171) [-394.933] -- 0:00:19
701000 -- (-391.221) [-390.987] (-389.381) (-390.979) * (-392.014) [-390.384] (-392.474) (-390.548) -- 0:00:19
701500 -- (-393.797) (-392.444) [-390.278] (-389.276) * (-392.784) (-392.797) (-391.606) [-391.262] -- 0:00:19
702000 -- (-389.480) [-389.583] (-389.401) (-390.567) * (-391.667) (-390.082) (-390.711) [-390.614] -- 0:00:19
702500 -- (-389.266) [-391.424] (-391.219) (-393.103) * [-391.275] (-389.592) (-388.919) (-390.916) -- 0:00:19
703000 -- (-390.112) (-391.256) [-392.440] (-393.099) * (-390.937) (-390.395) (-389.188) [-390.045] -- 0:00:19
703500 -- [-393.480] (-389.704) (-390.872) (-399.106) * (-393.402) (-392.244) [-389.355] (-394.265) -- 0:00:18
704000 -- (-394.234) (-396.099) (-389.277) [-389.655] * (-389.716) (-390.955) (-393.065) [-389.737] -- 0:00:18
704500 -- (-391.592) [-394.432] (-390.695) (-390.756) * [-390.044] (-391.958) (-389.830) (-391.277) -- 0:00:18
705000 -- (-391.008) (-394.071) (-389.971) [-391.671] * (-393.060) (-394.496) [-390.375] (-390.945) -- 0:00:18
Average standard deviation of split frequencies: 0.009265
705500 -- [-392.522] (-392.585) (-389.633) (-393.553) * (-391.712) (-395.373) (-388.780) [-389.741] -- 0:00:18
706000 -- (-391.402) [-392.008] (-394.571) (-396.522) * (-391.186) (-393.379) [-390.862] (-392.117) -- 0:00:18
706500 -- [-389.156] (-391.817) (-393.175) (-392.966) * (-391.567) (-395.690) [-388.939] (-391.116) -- 0:00:18
707000 -- (-389.848) (-393.083) (-391.186) [-390.193] * (-393.293) [-390.986] (-392.252) (-391.738) -- 0:00:18
707500 -- (-388.755) (-391.938) [-391.636] (-391.517) * (-391.564) (-389.965) [-391.588] (-390.598) -- 0:00:19
708000 -- [-389.814] (-391.675) (-391.711) (-389.927) * (-393.177) (-390.130) (-389.719) [-390.148] -- 0:00:18
708500 -- [-388.923] (-390.137) (-391.528) (-392.359) * (-392.472) [-390.273] (-392.338) (-391.671) -- 0:00:18
709000 -- (-390.753) (-391.245) (-390.182) [-389.610] * (-389.772) [-392.428] (-393.410) (-390.148) -- 0:00:18
709500 -- (-390.878) (-389.804) [-389.113] (-390.384) * (-392.277) (-390.417) (-389.288) [-391.492] -- 0:00:18
710000 -- (-388.651) [-390.720] (-390.539) (-392.309) * (-390.266) (-397.825) [-389.832] (-388.614) -- 0:00:18
Average standard deviation of split frequencies: 0.008831
710500 -- (-389.366) (-393.711) (-391.035) [-392.486] * (-390.014) (-395.508) [-389.404] (-390.451) -- 0:00:18
711000 -- (-388.802) [-390.032] (-393.418) (-390.934) * (-390.365) [-388.889] (-390.002) (-390.020) -- 0:00:18
711500 -- (-389.608) (-393.547) [-394.790] (-391.246) * (-389.405) (-390.939) [-390.670] (-392.784) -- 0:00:18
712000 -- (-391.970) (-391.206) (-398.723) [-389.866] * (-389.405) (-393.182) (-390.404) [-390.977] -- 0:00:18
712500 -- (-392.127) (-391.453) (-392.481) [-389.735] * (-390.466) (-391.065) [-389.331] (-391.557) -- 0:00:18
713000 -- [-388.962] (-389.108) (-389.152) (-390.968) * (-388.701) [-394.032] (-390.389) (-391.986) -- 0:00:18
713500 -- (-390.894) (-392.496) (-391.315) [-389.939] * [-390.229] (-390.131) (-392.052) (-392.818) -- 0:00:18
714000 -- [-390.294] (-389.865) (-391.865) (-392.802) * (-389.544) (-388.927) (-393.396) [-390.139] -- 0:00:18
714500 -- (-391.386) [-392.513] (-394.061) (-394.872) * (-393.791) [-388.821] (-393.023) (-390.289) -- 0:00:18
715000 -- (-391.033) (-390.544) [-390.333] (-397.554) * [-389.913] (-390.823) (-395.606) (-390.885) -- 0:00:18
Average standard deviation of split frequencies: 0.008998
715500 -- [-389.907] (-392.207) (-403.903) (-398.255) * (-389.145) (-393.459) (-390.543) [-390.594] -- 0:00:18
716000 -- (-390.703) (-388.892) [-391.878] (-393.661) * (-393.072) (-393.297) [-390.424] (-390.639) -- 0:00:18
716500 -- [-391.594] (-389.890) (-389.629) (-389.362) * (-394.418) [-390.181] (-389.806) (-390.991) -- 0:00:18
717000 -- (-392.070) (-389.197) [-389.603] (-389.873) * (-393.373) [-389.115] (-392.384) (-389.156) -- 0:00:18
717500 -- (-395.748) (-390.546) (-392.691) [-389.807] * [-391.809] (-393.686) (-389.171) (-390.274) -- 0:00:18
718000 -- [-390.936] (-389.348) (-393.138) (-392.841) * (-391.379) [-389.726] (-391.641) (-392.175) -- 0:00:18
718500 -- [-390.996] (-389.175) (-390.956) (-394.836) * [-390.966] (-391.187) (-390.297) (-392.111) -- 0:00:18
719000 -- (-400.328) [-389.871] (-391.256) (-391.580) * (-390.958) (-391.428) (-391.634) [-391.614] -- 0:00:17
719500 -- (-395.943) (-393.472) [-391.114] (-390.607) * (-389.917) (-389.555) (-390.844) [-393.441] -- 0:00:17
720000 -- (-394.734) (-391.305) [-392.084] (-390.825) * (-390.400) [-388.675] (-390.661) (-393.100) -- 0:00:17
Average standard deviation of split frequencies: 0.008581
720500 -- (-389.504) (-392.034) [-391.950] (-390.328) * [-391.112] (-390.629) (-390.267) (-390.717) -- 0:00:17
721000 -- (-391.909) (-391.079) [-392.833] (-389.925) * (-390.566) (-395.142) (-390.830) [-392.948] -- 0:00:17
721500 -- (-397.052) (-391.542) (-399.629) [-389.915] * (-394.345) (-391.690) (-390.093) [-390.464] -- 0:00:17
722000 -- (-393.140) (-390.474) (-391.985) [-389.223] * [-390.510] (-390.547) (-389.558) (-389.927) -- 0:00:18
722500 -- [-390.554] (-394.374) (-391.751) (-391.878) * (-388.813) (-390.749) [-389.906] (-389.282) -- 0:00:18
723000 -- (-390.030) (-391.064) [-391.126] (-390.005) * [-389.498] (-392.391) (-390.892) (-390.061) -- 0:00:18
723500 -- (-393.003) (-391.244) (-389.959) [-391.093] * (-389.336) (-390.253) [-390.150] (-392.228) -- 0:00:17
724000 -- [-391.250] (-389.711) (-396.911) (-390.436) * [-389.190] (-391.493) (-389.640) (-389.826) -- 0:00:17
724500 -- (-392.473) [-391.309] (-389.838) (-392.492) * (-392.287) [-389.476] (-390.235) (-394.187) -- 0:00:17
725000 -- (-393.680) [-389.826] (-393.398) (-389.217) * (-390.994) (-391.229) [-389.816] (-392.491) -- 0:00:17
Average standard deviation of split frequencies: 0.008730
725500 -- (-390.014) [-391.322] (-394.845) (-389.567) * (-391.036) (-395.363) (-392.079) [-389.726] -- 0:00:17
726000 -- [-390.226] (-390.214) (-391.442) (-390.216) * (-391.404) [-392.096] (-394.722) (-389.537) -- 0:00:17
726500 -- (-389.342) (-389.456) (-395.186) [-389.700] * (-390.145) (-393.009) [-390.316] (-391.122) -- 0:00:17
727000 -- (-392.090) (-393.001) (-389.228) [-388.904] * (-391.471) (-390.122) [-390.110] (-390.235) -- 0:00:17
727500 -- (-389.742) (-389.338) [-398.061] (-389.354) * (-396.537) (-389.298) [-389.134] (-389.945) -- 0:00:17
728000 -- (-390.790) [-389.651] (-391.090) (-390.811) * (-392.487) (-390.144) (-389.971) [-390.347] -- 0:00:17
728500 -- (-393.997) (-389.422) (-391.912) [-390.359] * (-393.364) (-393.161) (-391.671) [-389.808] -- 0:00:17
729000 -- (-389.151) [-390.583] (-391.126) (-390.140) * (-389.887) (-389.251) (-393.673) [-390.024] -- 0:00:17
729500 -- [-390.676] (-390.639) (-390.562) (-391.189) * [-392.113] (-391.134) (-390.832) (-390.643) -- 0:00:17
730000 -- (-389.308) [-389.597] (-393.854) (-393.739) * [-389.897] (-391.329) (-399.015) (-390.939) -- 0:00:17
Average standard deviation of split frequencies: 0.008881
730500 -- [-390.713] (-390.230) (-390.122) (-392.496) * (-393.326) (-390.148) (-399.066) [-391.829] -- 0:00:17
731000 -- [-393.392] (-393.078) (-393.296) (-391.003) * [-392.805] (-390.169) (-401.515) (-390.824) -- 0:00:17
731500 -- (-395.937) [-390.695] (-390.037) (-394.747) * (-391.471) (-389.319) (-398.759) [-389.273] -- 0:00:17
732000 -- [-389.810] (-394.523) (-392.888) (-392.121) * [-393.208] (-390.746) (-392.737) (-393.730) -- 0:00:17
732500 -- [-394.686] (-390.913) (-390.767) (-391.964) * (-392.331) [-390.071] (-391.999) (-390.437) -- 0:00:17
733000 -- [-393.684] (-390.228) (-390.915) (-392.238) * (-389.302) (-390.904) [-391.763] (-390.998) -- 0:00:17
733500 -- [-388.903] (-391.314) (-389.285) (-392.531) * (-390.488) (-391.194) [-390.745] (-390.406) -- 0:00:17
734000 -- (-390.318) (-391.932) [-389.264] (-392.538) * (-390.802) (-389.661) [-391.113] (-391.948) -- 0:00:17
734500 -- (-390.889) (-388.638) (-392.219) [-391.958] * (-391.031) [-391.846] (-390.768) (-390.646) -- 0:00:17
735000 -- (-391.162) (-389.111) (-390.013) [-389.761] * (-389.690) [-389.303] (-395.567) (-392.348) -- 0:00:17
Average standard deviation of split frequencies: 0.009231
735500 -- (-395.480) (-388.700) (-389.248) [-391.811] * (-392.537) (-391.655) [-395.113] (-389.785) -- 0:00:17
736000 -- (-390.357) [-388.922] (-389.450) (-390.516) * (-389.607) (-394.563) [-390.680] (-391.721) -- 0:00:17
736500 -- [-392.701] (-390.835) (-389.169) (-389.311) * (-389.893) (-394.127) (-390.259) [-397.341] -- 0:00:17
737000 -- (-391.573) (-392.130) (-391.246) [-391.015] * (-391.160) (-389.965) (-392.721) [-389.805] -- 0:00:17
737500 -- [-391.186] (-392.542) (-391.005) (-392.176) * (-389.241) (-390.329) (-392.754) [-388.889] -- 0:00:17
738000 -- (-390.682) [-392.518] (-393.173) (-389.646) * [-389.571] (-393.068) (-389.675) (-392.782) -- 0:00:17
738500 -- (-398.909) [-391.477] (-390.433) (-393.250) * [-389.143] (-391.067) (-389.701) (-392.169) -- 0:00:16
739000 -- (-390.022) (-390.535) (-395.971) [-392.276] * (-389.142) [-392.454] (-392.897) (-390.308) -- 0:00:16
739500 -- [-393.723] (-391.423) (-390.549) (-390.699) * (-393.366) (-392.674) (-391.695) [-390.530] -- 0:00:16
740000 -- (-389.380) (-391.212) (-389.768) [-391.003] * [-389.850] (-391.555) (-390.295) (-390.637) -- 0:00:16
Average standard deviation of split frequencies: 0.008873
740500 -- (-390.327) (-390.403) (-389.883) [-391.838] * (-390.773) [-389.975] (-391.065) (-390.042) -- 0:00:16
741000 -- (-390.265) (-389.416) (-389.510) [-391.599] * [-393.387] (-394.603) (-390.381) (-390.748) -- 0:00:16
741500 -- (-390.314) (-389.533) (-391.349) [-391.672] * (-392.960) [-392.500] (-388.615) (-390.252) -- 0:00:16
742000 -- (-390.303) (-390.571) [-393.394] (-389.608) * (-395.504) [-390.265] (-388.812) (-393.543) -- 0:00:16
742500 -- (-392.913) [-390.123] (-389.294) (-389.974) * (-393.622) [-390.441] (-389.525) (-388.937) -- 0:00:16
743000 -- (-391.400) (-390.749) (-389.692) [-389.331] * (-392.527) (-389.533) [-389.879] (-391.530) -- 0:00:16
743500 -- (-393.384) [-390.627] (-393.052) (-389.646) * (-394.413) (-391.110) [-391.009] (-392.065) -- 0:00:16
744000 -- (-391.594) [-390.694] (-392.891) (-390.969) * (-391.875) [-392.137] (-391.495) (-393.322) -- 0:00:16
744500 -- [-391.262] (-395.296) (-392.321) (-391.961) * (-391.792) (-394.749) (-390.551) [-392.870] -- 0:00:16
745000 -- (-389.647) (-392.761) (-394.569) [-391.564] * (-392.224) [-392.969] (-390.722) (-389.271) -- 0:00:16
Average standard deviation of split frequencies: 0.009181
745500 -- (-390.535) (-389.605) [-391.451] (-389.344) * (-389.229) [-392.176] (-391.438) (-391.294) -- 0:00:16
746000 -- (-392.539) (-393.916) [-392.967] (-393.312) * [-391.249] (-389.333) (-392.959) (-390.435) -- 0:00:16
746500 -- [-389.661] (-391.386) (-399.638) (-392.177) * (-390.988) [-391.049] (-389.586) (-390.833) -- 0:00:16
747000 -- (-390.725) (-392.148) [-392.661] (-389.950) * (-389.930) (-389.443) (-393.603) [-390.350] -- 0:00:16
747500 -- [-390.295] (-395.961) (-389.643) (-389.784) * [-390.546] (-389.031) (-389.916) (-390.170) -- 0:00:16
748000 -- [-389.423] (-394.884) (-394.275) (-389.534) * [-389.776] (-390.429) (-393.061) (-389.233) -- 0:00:16
748500 -- (-391.614) (-390.678) (-392.996) [-390.050] * (-394.183) [-392.672] (-389.630) (-389.432) -- 0:00:16
749000 -- (-391.798) (-393.363) [-389.705] (-390.472) * (-392.959) [-390.364] (-390.391) (-391.329) -- 0:00:16
749500 -- [-390.527] (-390.971) (-394.668) (-391.847) * (-390.997) (-389.692) (-388.861) [-390.497] -- 0:00:16
750000 -- (-392.170) (-394.745) (-391.443) [-391.963] * (-391.811) (-391.095) (-392.715) [-389.838] -- 0:00:16
Average standard deviation of split frequencies: 0.008792
750500 -- [-394.233] (-392.734) (-390.653) (-393.705) * (-391.755) [-390.452] (-392.126) (-390.144) -- 0:00:16
751000 -- [-388.970] (-390.726) (-391.799) (-394.287) * (-390.477) (-395.529) (-395.238) [-393.051] -- 0:00:16
751500 -- [-390.266] (-389.844) (-390.692) (-390.197) * (-391.900) (-394.597) (-390.463) [-389.188] -- 0:00:16
752000 -- (-389.720) (-390.420) (-391.876) [-390.300] * (-390.773) (-393.070) [-390.240] (-389.751) -- 0:00:16
752500 -- [-391.398] (-391.425) (-391.967) (-391.637) * [-393.059] (-392.536) (-399.489) (-392.603) -- 0:00:16
753000 -- (-391.319) (-391.501) (-390.981) [-394.857] * [-390.105] (-390.547) (-390.038) (-391.071) -- 0:00:16
753500 -- (-390.539) [-390.025] (-393.627) (-392.497) * [-393.103] (-390.487) (-390.584) (-391.145) -- 0:00:16
754000 -- [-390.332] (-394.832) (-391.514) (-392.964) * (-390.320) [-390.033] (-390.325) (-390.769) -- 0:00:15
754500 -- (-390.689) [-389.690] (-392.019) (-390.062) * [-389.316] (-389.326) (-393.663) (-388.990) -- 0:00:15
755000 -- (-391.103) (-390.672) (-392.612) [-388.805] * (-395.779) (-389.006) [-389.322] (-389.849) -- 0:00:15
Average standard deviation of split frequencies: 0.009023
755500 -- [-389.347] (-392.301) (-389.632) (-389.005) * (-391.299) (-389.669) (-389.199) [-389.830] -- 0:00:15
756000 -- (-392.552) (-390.588) (-389.679) [-393.617] * (-389.250) (-393.054) [-389.190] (-389.065) -- 0:00:15
756500 -- (-390.814) [-390.018] (-390.202) (-391.931) * (-392.678) (-390.434) (-389.666) [-388.713] -- 0:00:15
757000 -- (-392.523) (-389.677) [-391.525] (-390.934) * (-391.910) (-389.591) [-392.479] (-389.757) -- 0:00:15
757500 -- (-393.477) (-392.508) (-391.022) [-390.555] * (-397.986) (-389.361) (-389.237) [-391.687] -- 0:00:15
758000 -- (-393.676) (-391.482) (-391.240) [-392.400] * (-389.877) [-389.313] (-391.646) (-389.916) -- 0:00:15
758500 -- [-390.491] (-389.885) (-392.184) (-395.328) * (-390.379) (-391.173) [-391.491] (-394.769) -- 0:00:15
759000 -- (-392.086) (-393.769) [-393.008] (-391.374) * (-389.775) [-391.255] (-391.446) (-391.066) -- 0:00:15
759500 -- (-393.132) [-391.054] (-390.402) (-396.604) * [-389.483] (-390.446) (-392.959) (-393.114) -- 0:00:15
760000 -- [-392.042] (-389.449) (-389.502) (-397.697) * (-396.879) [-390.850] (-390.998) (-389.428) -- 0:00:15
Average standard deviation of split frequencies: 0.009515
760500 -- (-392.572) [-391.051] (-390.957) (-393.041) * (-394.536) [-391.241] (-389.973) (-395.292) -- 0:00:15
761000 -- (-391.880) (-390.178) (-389.227) [-393.299] * (-391.141) (-394.936) (-389.340) [-399.381] -- 0:00:15
761500 -- (-390.756) [-389.630] (-390.155) (-401.707) * (-391.725) (-392.320) (-390.031) [-390.741] -- 0:00:15
762000 -- [-392.692] (-390.226) (-391.745) (-390.365) * (-391.862) (-390.875) (-389.054) [-392.107] -- 0:00:15
762500 -- (-392.387) [-391.137] (-388.944) (-389.947) * (-389.980) (-390.190) (-389.118) [-389.373] -- 0:00:15
763000 -- (-389.910) (-393.671) [-389.111] (-392.833) * (-393.134) (-392.569) (-390.710) [-390.508] -- 0:00:15
763500 -- (-391.966) [-390.684] (-390.561) (-393.556) * (-389.236) (-391.016) (-392.881) [-388.709] -- 0:00:15
764000 -- (-390.698) [-389.079] (-389.053) (-392.960) * [-391.798] (-391.589) (-390.150) (-389.540) -- 0:00:15
764500 -- (-390.212) (-392.255) (-395.028) [-390.250] * (-392.265) (-389.886) (-391.472) [-389.552] -- 0:00:15
765000 -- (-389.699) (-391.896) [-389.423] (-389.941) * (-390.029) [-389.824] (-392.465) (-390.638) -- 0:00:15
Average standard deviation of split frequencies: 0.009159
765500 -- (-389.840) (-391.548) (-394.736) [-389.353] * (-391.528) (-389.785) (-391.672) [-390.868] -- 0:00:15
766000 -- (-394.378) [-389.569] (-389.257) (-390.397) * [-389.549] (-390.331) (-390.882) (-389.685) -- 0:00:15
766500 -- [-391.124] (-391.472) (-391.287) (-390.462) * [-389.505] (-390.203) (-390.629) (-389.173) -- 0:00:15
767000 -- (-388.723) (-390.730) [-391.810] (-390.929) * (-393.728) (-389.714) [-389.099] (-394.610) -- 0:00:15
767500 -- (-393.423) [-391.239] (-390.443) (-389.075) * [-389.936] (-389.733) (-389.121) (-391.717) -- 0:00:15
768000 -- (-393.179) (-391.051) [-391.339] (-389.306) * (-391.523) (-393.447) (-391.517) [-396.278] -- 0:00:15
768500 -- (-393.740) (-390.653) (-392.056) [-389.419] * (-393.094) (-390.738) (-391.252) [-391.778] -- 0:00:15
769000 -- (-394.473) [-390.507] (-391.814) (-389.161) * (-389.381) (-393.542) (-391.273) [-393.371] -- 0:00:15
769500 -- (-389.811) [-392.863] (-392.245) (-389.464) * [-389.065] (-391.501) (-391.818) (-390.307) -- 0:00:14
770000 -- (-394.636) (-393.557) (-390.832) [-389.669] * [-389.726] (-390.895) (-389.966) (-391.613) -- 0:00:14
Average standard deviation of split frequencies: 0.008779
770500 -- (-392.708) [-390.480] (-391.644) (-390.143) * (-391.121) [-390.986] (-392.094) (-393.213) -- 0:00:14
771000 -- [-392.543] (-391.593) (-390.698) (-389.706) * [-389.496] (-390.411) (-388.720) (-396.445) -- 0:00:14
771500 -- [-391.512] (-391.385) (-390.655) (-389.977) * (-389.257) (-389.866) [-389.829] (-392.874) -- 0:00:14
772000 -- (-390.284) (-389.676) (-389.225) [-391.284] * [-389.183] (-389.301) (-390.489) (-390.057) -- 0:00:14
772500 -- (-390.915) (-390.023) [-390.506] (-390.433) * (-389.591) (-389.747) [-390.071] (-391.218) -- 0:00:14
773000 -- [-392.283] (-391.395) (-389.755) (-389.989) * (-393.524) (-391.343) [-389.811] (-391.207) -- 0:00:14
773500 -- (-391.293) (-391.343) (-394.253) [-389.999] * (-390.733) (-391.478) (-389.535) [-389.644] -- 0:00:14
774000 -- (-390.094) (-390.575) [-391.501] (-392.791) * (-390.287) (-392.649) [-389.161] (-390.114) -- 0:00:14
774500 -- (-393.724) (-389.839) [-390.221] (-389.599) * (-391.567) (-391.372) [-388.880] (-390.154) -- 0:00:14
775000 -- [-391.913] (-401.641) (-393.820) (-390.317) * (-389.105) (-391.783) [-390.725] (-390.738) -- 0:00:14
Average standard deviation of split frequencies: 0.008362
775500 -- (-390.530) (-393.983) [-392.086] (-390.169) * [-390.521] (-390.775) (-390.053) (-391.301) -- 0:00:14
776000 -- (-395.582) (-391.410) [-390.234] (-391.854) * (-390.468) [-391.907] (-390.178) (-393.684) -- 0:00:14
776500 -- (-392.035) [-391.002] (-389.521) (-391.016) * (-395.075) [-391.948] (-389.833) (-396.197) -- 0:00:14
777000 -- (-391.317) [-391.198] (-392.063) (-392.606) * (-392.947) (-394.739) [-391.685] (-397.106) -- 0:00:14
777500 -- [-391.035] (-392.947) (-391.181) (-394.520) * (-392.430) [-390.055] (-392.205) (-395.287) -- 0:00:14
778000 -- (-392.131) (-390.012) (-392.784) [-390.006] * [-392.096] (-388.779) (-391.022) (-393.844) -- 0:00:14
778500 -- (-390.948) [-390.078] (-392.469) (-391.366) * [-390.381] (-390.048) (-392.566) (-389.665) -- 0:00:14
779000 -- [-394.664] (-389.763) (-395.367) (-391.668) * (-391.551) (-392.317) [-390.865] (-390.716) -- 0:00:14
779500 -- [-391.411] (-393.904) (-391.235) (-393.109) * (-394.988) (-393.477) [-390.337] (-392.400) -- 0:00:14
780000 -- (-391.565) (-392.596) [-390.994] (-390.567) * (-397.715) [-390.608] (-392.886) (-392.225) -- 0:00:14
Average standard deviation of split frequencies: 0.008738
780500 -- (-392.644) [-390.945] (-392.032) (-391.570) * (-391.234) [-391.160] (-393.328) (-389.635) -- 0:00:14
781000 -- (-389.611) (-390.150) (-390.462) [-390.239] * (-394.209) [-391.903] (-391.983) (-389.732) -- 0:00:14
781500 -- [-391.032] (-394.078) (-389.730) (-391.449) * (-390.037) (-390.103) (-389.301) [-391.719] -- 0:00:14
782000 -- (-391.254) (-392.220) [-390.536] (-390.964) * (-389.931) (-389.234) (-393.094) [-389.194] -- 0:00:14
782500 -- (-390.962) (-395.536) [-392.479] (-389.106) * [-390.556] (-391.720) (-394.228) (-391.999) -- 0:00:14
783000 -- (-393.002) [-394.330] (-393.980) (-389.056) * (-389.183) (-392.856) (-390.163) [-392.966] -- 0:00:14
783500 -- (-390.066) [-392.653] (-397.980) (-391.264) * (-389.647) [-391.992] (-389.725) (-388.845) -- 0:00:14
784000 -- (-390.660) [-389.284] (-396.956) (-392.782) * (-389.257) (-390.062) (-395.175) [-391.905] -- 0:00:14
784500 -- [-391.356] (-394.693) (-389.450) (-394.085) * (-389.241) [-392.027] (-390.296) (-390.912) -- 0:00:14
785000 -- (-390.378) (-389.077) [-389.209] (-394.853) * [-396.287] (-391.950) (-390.811) (-393.213) -- 0:00:13
Average standard deviation of split frequencies: 0.009196
785500 -- [-390.493] (-389.023) (-393.510) (-393.325) * (-392.660) (-393.367) (-392.013) [-391.574] -- 0:00:13
786000 -- [-390.037] (-391.693) (-390.278) (-393.659) * [-394.082] (-389.492) (-390.167) (-393.094) -- 0:00:13
786500 -- (-390.432) [-389.683] (-389.259) (-392.266) * (-390.891) (-389.662) [-389.208] (-393.099) -- 0:00:13
787000 -- (-396.523) [-392.833] (-389.209) (-391.150) * [-389.869] (-392.564) (-390.611) (-395.493) -- 0:00:13
787500 -- (-390.230) (-391.118) (-392.506) [-393.559] * [-391.803] (-391.615) (-390.645) (-395.699) -- 0:00:13
788000 -- [-391.965] (-392.085) (-390.085) (-389.661) * (-390.081) [-390.385] (-391.173) (-390.945) -- 0:00:13
788500 -- (-390.741) (-392.510) (-394.645) [-390.372] * [-390.609] (-391.107) (-390.768) (-389.646) -- 0:00:13
789000 -- [-391.763] (-392.572) (-394.445) (-391.846) * (-391.000) (-391.074) (-392.839) [-389.433] -- 0:00:13
789500 -- [-391.627] (-396.064) (-391.876) (-390.283) * (-391.149) [-389.213] (-391.127) (-390.302) -- 0:00:13
790000 -- (-391.170) [-389.717] (-389.998) (-392.306) * (-390.727) (-389.055) [-389.231] (-391.060) -- 0:00:13
Average standard deviation of split frequencies: 0.009341
790500 -- [-389.494] (-390.455) (-390.959) (-393.505) * (-393.053) (-390.969) [-391.134] (-390.913) -- 0:00:13
791000 -- [-391.285] (-390.687) (-393.130) (-391.262) * [-390.900] (-391.256) (-390.762) (-389.233) -- 0:00:13
791500 -- [-391.906] (-392.170) (-390.024) (-399.175) * (-390.854) (-392.193) (-395.446) [-391.648] -- 0:00:13
792000 -- (-389.210) (-389.538) (-390.378) [-395.279] * (-391.328) (-393.719) (-391.441) [-389.212] -- 0:00:13
792500 -- (-390.500) (-391.399) [-392.222] (-390.883) * (-390.780) (-391.404) [-391.257] (-389.033) -- 0:00:13
793000 -- (-390.464) (-396.746) (-392.585) [-391.448] * (-389.130) [-390.963] (-391.920) (-388.999) -- 0:00:13
793500 -- (-392.077) [-390.048] (-391.137) (-391.801) * (-392.786) (-392.114) (-391.469) [-389.283] -- 0:00:13
794000 -- (-391.584) (-390.015) (-391.781) [-389.320] * [-392.473] (-389.922) (-391.645) (-389.370) -- 0:00:13
794500 -- [-392.548] (-390.076) (-389.362) (-390.107) * (-391.605) (-388.940) [-390.793] (-391.858) -- 0:00:13
795000 -- (-390.543) (-389.881) [-389.177] (-390.228) * (-394.045) (-391.036) (-390.827) [-391.718] -- 0:00:13
Average standard deviation of split frequencies: 0.009311
795500 -- (-391.548) (-391.044) (-391.546) [-391.869] * [-394.136] (-389.271) (-390.392) (-391.133) -- 0:00:13
796000 -- (-391.401) (-392.475) [-391.992] (-391.241) * (-392.552) (-389.407) (-389.995) [-388.956] -- 0:00:13
796500 -- (-394.915) [-393.543] (-391.653) (-390.016) * (-392.885) (-389.546) (-390.071) [-390.988] -- 0:00:13
797000 -- (-390.850) (-389.795) (-389.796) [-393.976] * (-390.174) (-388.992) (-391.359) [-393.240] -- 0:00:13
797500 -- (-389.704) (-389.383) [-389.332] (-390.777) * (-389.121) [-390.108] (-390.438) (-393.622) -- 0:00:13
798000 -- [-390.473] (-389.566) (-390.100) (-391.025) * [-391.093] (-393.049) (-391.105) (-391.112) -- 0:00:13
798500 -- (-389.208) (-389.079) (-394.252) [-389.919] * [-389.913] (-392.882) (-390.989) (-393.696) -- 0:00:13
799000 -- [-390.369] (-390.199) (-389.826) (-389.504) * (-389.856) [-392.290] (-392.354) (-390.364) -- 0:00:13
799500 -- (-390.896) [-388.828] (-394.028) (-393.772) * (-392.629) (-389.778) (-390.705) [-389.438] -- 0:00:13
800000 -- (-391.515) [-389.894] (-390.341) (-390.892) * (-393.334) (-390.454) (-389.428) [-392.578] -- 0:00:12
Average standard deviation of split frequencies: 0.009486
800500 -- (-390.959) [-388.847] (-392.792) (-391.702) * (-389.956) (-390.034) [-390.275] (-391.441) -- 0:00:12
801000 -- (-390.432) (-390.993) [-394.988] (-393.623) * [-394.783] (-391.971) (-396.070) (-390.660) -- 0:00:12
801500 -- (-390.177) (-392.035) [-389.441] (-392.756) * (-391.396) (-392.608) [-389.982] (-391.229) -- 0:00:12
802000 -- (-390.743) (-390.576) [-394.884] (-392.516) * (-390.034) [-391.113] (-390.164) (-390.177) -- 0:00:12
802500 -- (-389.966) [-390.648] (-394.212) (-389.949) * (-389.492) (-389.737) (-392.725) [-389.701] -- 0:00:12
803000 -- (-392.269) [-389.818] (-393.398) (-390.861) * [-389.950] (-391.810) (-395.990) (-393.009) -- 0:00:12
803500 -- (-398.708) [-391.014] (-392.407) (-393.882) * (-390.357) [-390.274] (-397.530) (-391.953) -- 0:00:12
804000 -- (-394.885) [-389.716] (-393.930) (-389.906) * [-390.913] (-390.265) (-390.735) (-391.528) -- 0:00:12
804500 -- (-389.508) [-390.577] (-391.184) (-393.426) * [-389.373] (-390.970) (-391.210) (-390.807) -- 0:00:12
805000 -- [-390.778] (-390.689) (-393.607) (-392.534) * (-388.875) (-394.958) [-389.697] (-392.525) -- 0:00:12
Average standard deviation of split frequencies: 0.009520
805500 -- (-390.929) (-390.227) (-392.465) [-390.189] * (-396.060) (-389.776) (-391.312) [-393.608] -- 0:00:12
806000 -- (-389.642) (-394.731) (-392.944) [-394.412] * [-394.012] (-388.848) (-391.413) (-396.163) -- 0:00:12
806500 -- (-393.506) [-392.242] (-390.700) (-389.405) * (-391.040) (-389.304) (-392.781) [-391.898] -- 0:00:12
807000 -- (-394.567) (-393.053) [-390.613] (-390.924) * (-394.207) (-389.292) [-389.804] (-394.692) -- 0:00:12
807500 -- (-392.037) (-391.689) (-395.834) [-390.650] * (-391.929) (-389.153) [-390.172] (-394.514) -- 0:00:12
808000 -- [-392.524] (-393.409) (-392.103) (-395.352) * (-391.543) (-392.846) (-391.200) [-392.587] -- 0:00:12
808500 -- (-389.218) (-391.930) [-389.861] (-389.756) * (-389.654) [-393.468] (-391.421) (-391.842) -- 0:00:12
809000 -- [-391.281] (-391.937) (-389.297) (-391.953) * [-390.490] (-392.562) (-391.316) (-395.257) -- 0:00:12
809500 -- [-390.701] (-389.314) (-391.687) (-390.315) * (-392.655) (-390.717) [-391.435] (-391.133) -- 0:00:12
810000 -- (-391.582) (-391.684) (-389.916) [-389.547] * (-391.345) (-391.684) (-391.010) [-390.942] -- 0:00:12
Average standard deviation of split frequencies: 0.009207
810500 -- (-394.087) (-389.574) (-390.265) [-390.352] * [-389.990] (-389.510) (-389.410) (-391.074) -- 0:00:12
811000 -- (-390.400) [-389.518] (-390.752) (-393.096) * (-392.597) (-390.242) [-389.659] (-396.271) -- 0:00:12
811500 -- (-392.086) [-390.618] (-394.181) (-391.500) * [-389.962] (-388.807) (-390.114) (-395.013) -- 0:00:12
812000 -- [-390.061] (-395.071) (-389.608) (-389.920) * (-390.486) (-392.368) [-390.752] (-391.317) -- 0:00:12
812500 -- (-389.212) (-396.971) [-390.720] (-392.119) * [-389.203] (-391.762) (-389.257) (-391.725) -- 0:00:12
813000 -- [-390.130] (-390.299) (-393.926) (-392.801) * [-388.972] (-392.343) (-389.932) (-392.184) -- 0:00:12
813500 -- (-389.552) [-389.452] (-392.445) (-389.564) * [-390.470] (-391.523) (-389.721) (-389.136) -- 0:00:12
814000 -- [-389.795] (-390.571) (-398.886) (-391.937) * (-391.561) (-391.539) (-394.380) [-389.536] -- 0:00:12
814500 -- (-392.180) (-389.373) [-389.740] (-390.322) * (-393.294) (-390.171) [-391.452] (-389.234) -- 0:00:12
815000 -- [-391.431] (-391.199) (-388.835) (-389.573) * (-393.781) (-391.994) (-393.232) [-396.402] -- 0:00:12
Average standard deviation of split frequencies: 0.009500
815500 -- (-389.451) [-390.230] (-391.384) (-390.181) * (-390.068) (-389.309) [-392.684] (-391.832) -- 0:00:11
816000 -- [-390.874] (-392.611) (-394.772) (-390.519) * [-393.316] (-390.482) (-395.339) (-389.172) -- 0:00:11
816500 -- [-391.697] (-390.365) (-394.869) (-391.353) * (-390.887) (-392.400) [-389.811] (-392.086) -- 0:00:11
817000 -- (-393.495) (-393.442) [-395.242] (-390.365) * (-394.163) (-390.343) [-391.278] (-389.250) -- 0:00:11
817500 -- (-392.711) (-389.450) [-390.380] (-390.392) * (-392.108) (-389.338) [-391.021] (-392.187) -- 0:00:11
818000 -- (-393.369) (-394.164) [-388.649] (-389.947) * (-391.246) (-390.549) [-390.067] (-391.118) -- 0:00:11
818500 -- (-394.695) (-392.318) (-389.755) [-390.517] * (-390.020) (-391.108) [-390.212] (-389.526) -- 0:00:11
819000 -- (-389.626) (-392.793) [-390.693] (-390.176) * (-388.992) [-389.056] (-390.944) (-391.001) -- 0:00:11
819500 -- (-388.776) (-398.451) [-390.230] (-390.783) * [-389.314] (-388.891) (-390.309) (-389.774) -- 0:00:11
820000 -- (-390.412) (-389.292) (-390.558) [-390.815] * (-389.674) [-390.234] (-390.976) (-391.053) -- 0:00:11
Average standard deviation of split frequencies: 0.009478
820500 -- [-392.346] (-393.727) (-391.466) (-390.103) * (-389.294) [-390.016] (-391.297) (-391.584) -- 0:00:11
821000 -- (-393.907) [-393.615] (-391.365) (-391.527) * [-390.337] (-391.915) (-390.311) (-392.625) -- 0:00:11
821500 -- (-389.845) (-392.664) [-390.759] (-391.793) * [-390.223] (-389.898) (-392.342) (-391.476) -- 0:00:11
822000 -- [-389.218] (-394.101) (-391.424) (-391.336) * (-397.267) [-390.761] (-390.072) (-390.658) -- 0:00:11
822500 -- [-391.035] (-393.307) (-394.258) (-389.892) * (-389.345) (-393.814) [-390.237] (-391.329) -- 0:00:11
823000 -- [-390.998] (-390.019) (-389.505) (-397.774) * [-390.473] (-389.515) (-392.130) (-390.219) -- 0:00:11
823500 -- (-391.155) (-391.673) (-392.070) [-393.267] * (-389.341) [-392.158] (-390.378) (-391.997) -- 0:00:11
824000 -- [-389.998] (-389.384) (-389.466) (-390.741) * (-390.335) (-389.426) (-392.182) [-390.748] -- 0:00:11
824500 -- (-389.736) (-389.118) [-392.975] (-390.431) * (-390.969) (-392.128) (-390.602) [-390.095] -- 0:00:11
825000 -- (-394.702) (-394.078) [-389.719] (-390.976) * (-396.533) (-389.490) (-389.321) [-394.211] -- 0:00:11
Average standard deviation of split frequencies: 0.009639
825500 -- (-393.732) (-390.424) (-391.587) [-389.487] * (-390.427) [-389.409] (-394.811) (-389.863) -- 0:00:11
826000 -- (-391.919) [-390.728] (-395.563) (-390.742) * (-389.630) [-389.815] (-394.927) (-389.348) -- 0:00:11
826500 -- (-393.819) [-389.554] (-391.540) (-389.056) * (-389.161) [-390.015] (-390.513) (-390.260) -- 0:00:11
827000 -- [-390.340] (-390.127) (-389.436) (-392.298) * (-389.379) (-390.816) [-390.484] (-390.101) -- 0:00:11
827500 -- (-395.443) (-393.019) [-389.344] (-392.860) * (-390.479) [-389.391] (-389.859) (-389.869) -- 0:00:11
828000 -- (-389.900) (-393.377) [-392.412] (-391.189) * (-390.614) (-390.320) [-389.386] (-390.960) -- 0:00:11
828500 -- (-390.150) (-389.881) (-393.513) [-389.210] * (-389.076) [-391.113] (-392.707) (-392.147) -- 0:00:11
829000 -- (-391.173) [-392.269] (-394.692) (-391.276) * [-392.089] (-394.310) (-391.570) (-390.252) -- 0:00:11
829500 -- (-393.040) (-391.777) [-395.205] (-390.208) * (-393.185) [-391.462] (-389.905) (-389.553) -- 0:00:11
830000 -- [-390.744] (-391.021) (-391.062) (-395.548) * (-391.245) [-389.798] (-389.595) (-390.504) -- 0:00:11
Average standard deviation of split frequencies: 0.009900
830500 -- (-390.751) (-395.437) [-390.390] (-393.346) * (-389.666) (-392.700) [-393.212] (-392.186) -- 0:00:11
831000 -- (-389.872) (-392.810) (-390.126) [-390.370] * (-391.553) [-389.916] (-391.965) (-392.818) -- 0:00:10
831500 -- (-389.683) (-395.893) (-389.034) [-389.144] * (-390.925) (-391.642) (-388.707) [-391.300] -- 0:00:10
832000 -- (-389.736) (-391.077) (-392.209) [-389.166] * (-390.305) [-392.755] (-389.961) (-391.101) -- 0:00:10
832500 -- (-389.603) [-395.282] (-389.860) (-389.624) * (-393.753) (-391.263) (-391.783) [-393.033] -- 0:00:10
833000 -- (-392.467) (-389.475) (-388.905) [-389.645] * (-391.688) (-389.544) (-392.083) [-391.622] -- 0:00:10
833500 -- (-389.499) (-391.759) [-392.024] (-400.966) * (-391.106) (-390.448) (-389.493) [-390.316] -- 0:00:10
834000 -- (-391.081) [-389.481] (-393.393) (-391.790) * (-396.895) (-390.237) [-389.508] (-390.318) -- 0:00:10
834500 -- [-389.645] (-390.516) (-398.594) (-390.480) * (-389.956) (-390.922) [-390.459] (-393.880) -- 0:00:10
835000 -- (-390.540) [-389.769] (-392.201) (-389.818) * (-391.258) (-390.821) [-390.186] (-392.319) -- 0:00:10
Average standard deviation of split frequencies: 0.009868
835500 -- (-393.402) (-392.471) [-390.200] (-389.792) * [-394.892] (-389.769) (-390.025) (-395.488) -- 0:00:10
836000 -- (-389.755) (-393.179) (-390.048) [-391.619] * (-390.913) (-389.189) [-389.721] (-392.183) -- 0:00:10
836500 -- (-391.827) (-393.332) (-390.371) [-391.783] * (-394.009) (-389.270) (-392.504) [-392.474] -- 0:00:10
837000 -- (-392.676) (-396.786) (-390.801) [-389.207] * (-391.053) [-392.862] (-390.370) (-391.299) -- 0:00:10
837500 -- (-397.155) (-391.230) (-389.845) [-390.948] * (-390.515) [-391.368] (-390.435) (-392.897) -- 0:00:10
838000 -- [-390.760] (-392.403) (-391.711) (-391.191) * (-392.224) [-388.993] (-390.936) (-392.255) -- 0:00:10
838500 -- (-392.553) [-389.504] (-391.595) (-395.713) * [-391.545] (-389.370) (-394.139) (-392.786) -- 0:00:10
839000 -- (-389.018) (-389.052) (-395.758) [-390.481] * (-390.693) [-389.483] (-391.856) (-391.407) -- 0:00:10
839500 -- [-390.096] (-390.159) (-391.800) (-395.505) * [-391.299] (-390.902) (-392.254) (-388.662) -- 0:00:10
840000 -- (-390.329) (-392.927) (-389.823) [-392.009] * (-391.932) [-391.425] (-388.892) (-389.526) -- 0:00:10
Average standard deviation of split frequencies: 0.009782
840500 -- (-390.339) (-389.678) [-389.616] (-393.149) * [-391.425] (-392.777) (-390.942) (-389.109) -- 0:00:10
841000 -- (-390.863) [-389.995] (-392.529) (-390.263) * (-391.742) (-390.384) [-393.675] (-391.020) -- 0:00:10
841500 -- (-389.063) [-389.787] (-388.800) (-393.051) * (-389.121) [-389.497] (-394.702) (-396.399) -- 0:00:10
842000 -- (-392.441) (-390.239) (-392.048) [-391.281] * (-389.156) [-391.371] (-391.220) (-397.208) -- 0:00:10
842500 -- [-393.327] (-392.025) (-391.739) (-389.921) * (-395.697) (-390.706) (-396.880) [-388.921] -- 0:00:10
843000 -- [-390.444] (-394.435) (-392.683) (-391.414) * (-393.744) (-394.202) (-388.901) [-390.841] -- 0:00:10
843500 -- (-390.538) (-394.197) (-389.272) [-390.234] * (-392.597) (-390.941) (-391.180) [-393.898] -- 0:00:10
844000 -- (-389.427) [-392.932] (-390.552) (-392.586) * (-390.699) (-389.920) (-390.609) [-390.910] -- 0:00:10
844500 -- (-390.069) [-392.259] (-391.286) (-391.078) * (-392.107) (-392.293) [-389.360] (-389.990) -- 0:00:10
845000 -- (-388.989) (-391.194) (-391.723) [-391.137] * [-390.613] (-395.048) (-389.182) (-395.618) -- 0:00:10
Average standard deviation of split frequencies: 0.009627
845500 -- (-388.970) (-390.548) (-390.341) [-390.426] * (-394.833) (-397.542) (-395.043) [-390.199] -- 0:00:10
846000 -- [-389.100] (-392.258) (-391.264) (-390.725) * (-392.564) [-394.948] (-392.079) (-390.696) -- 0:00:10
846500 -- [-391.121] (-392.917) (-391.466) (-390.288) * [-393.231] (-392.989) (-394.159) (-389.306) -- 0:00:09
847000 -- (-392.685) (-390.780) [-390.061] (-390.896) * (-391.767) (-391.028) (-390.119) [-392.234] -- 0:00:09
847500 -- (-394.744) [-388.854] (-392.535) (-390.834) * (-394.598) [-393.347] (-389.572) (-393.241) -- 0:00:09
848000 -- [-392.066] (-393.585) (-392.169) (-389.804) * (-394.485) [-392.362] (-389.307) (-390.642) -- 0:00:09
848500 -- (-391.343) (-393.633) (-395.540) [-390.614] * (-399.274) (-392.065) [-391.970] (-393.820) -- 0:00:09
849000 -- (-391.962) (-392.324) (-390.632) [-389.337] * (-400.249) (-391.807) (-390.990) [-390.302] -- 0:00:09
849500 -- (-389.473) [-394.475] (-389.992) (-389.584) * (-401.051) [-389.156] (-389.774) (-389.422) -- 0:00:09
850000 -- (-389.031) (-390.968) (-390.377) [-388.789] * (-391.956) [-390.296] (-390.636) (-390.160) -- 0:00:09
Average standard deviation of split frequencies: 0.009575
850500 -- (-390.467) [-393.133] (-392.178) (-390.270) * [-398.049] (-392.388) (-390.888) (-390.307) -- 0:00:09
851000 -- [-388.788] (-391.982) (-392.002) (-391.986) * (-394.883) (-394.779) (-394.083) [-395.500] -- 0:00:09
851500 -- (-390.576) (-389.215) (-390.697) [-389.588] * (-395.383) [-392.696] (-389.923) (-390.623) -- 0:00:09
852000 -- (-389.751) (-391.419) [-393.924] (-389.139) * (-390.663) (-389.502) [-390.735] (-392.648) -- 0:00:09
852500 -- (-390.414) [-393.502] (-390.431) (-392.173) * (-391.667) [-389.830] (-391.230) (-394.412) -- 0:00:09
853000 -- (-389.102) (-390.268) [-390.175] (-388.773) * (-391.772) (-391.693) [-393.814] (-389.824) -- 0:00:09
853500 -- (-390.642) (-390.884) (-389.753) [-390.945] * (-390.366) (-394.412) [-391.696] (-390.136) -- 0:00:09
854000 -- (-390.945) (-391.308) [-389.243] (-391.386) * (-390.220) [-393.307] (-390.794) (-390.383) -- 0:00:09
854500 -- [-389.135] (-394.815) (-393.149) (-389.497) * (-394.526) (-395.074) (-389.496) [-390.031] -- 0:00:09
855000 -- [-388.702] (-391.088) (-389.599) (-392.036) * [-390.435] (-391.785) (-390.513) (-390.325) -- 0:00:09
Average standard deviation of split frequencies: 0.009025
855500 -- (-389.559) (-391.051) [-389.697] (-393.325) * (-392.964) (-394.362) [-388.844] (-389.773) -- 0:00:09
856000 -- (-390.203) [-390.888] (-392.017) (-391.067) * (-390.372) (-392.130) [-390.252] (-392.004) -- 0:00:09
856500 -- (-395.489) (-390.373) [-389.751] (-391.017) * (-390.315) (-391.246) (-388.722) [-389.741] -- 0:00:09
857000 -- [-394.400] (-390.318) (-389.892) (-390.468) * (-391.552) (-391.178) [-389.629] (-391.014) -- 0:00:09
857500 -- [-392.184] (-394.329) (-390.122) (-392.692) * (-391.645) (-390.441) (-389.724) [-391.601] -- 0:00:09
858000 -- (-389.615) (-394.485) [-390.095] (-391.559) * [-393.420] (-389.346) (-391.012) (-389.940) -- 0:00:09
858500 -- (-389.991) (-395.323) [-389.878] (-389.665) * (-392.755) (-393.003) (-393.173) [-389.871] -- 0:00:09
859000 -- [-390.813] (-392.628) (-389.172) (-394.553) * (-391.593) (-392.284) (-394.772) [-390.915] -- 0:00:09
859500 -- (-391.935) (-398.620) [-389.932] (-389.857) * [-391.279] (-389.438) (-394.309) (-389.387) -- 0:00:09
860000 -- (-389.354) [-391.923] (-393.446) (-396.370) * (-391.488) (-392.590) (-393.113) [-390.298] -- 0:00:09
Average standard deviation of split frequencies: 0.009068
860500 -- (-389.179) (-389.100) (-391.909) [-395.193] * [-390.689] (-391.290) (-394.069) (-390.647) -- 0:00:09
861000 -- (-391.808) [-390.043] (-391.713) (-395.041) * [-390.255] (-392.263) (-389.458) (-390.606) -- 0:00:09
861500 -- [-392.722] (-392.950) (-390.070) (-396.612) * (-392.012) (-396.367) [-388.839] (-390.441) -- 0:00:09
862000 -- (-391.503) [-391.445] (-389.817) (-391.621) * [-390.474] (-390.727) (-389.121) (-391.795) -- 0:00:08
862500 -- (-389.587) [-393.733] (-390.160) (-390.462) * (-392.217) [-392.281] (-388.676) (-392.905) -- 0:00:08
863000 -- [-389.677] (-392.332) (-392.093) (-392.387) * [-389.380] (-393.406) (-390.637) (-397.287) -- 0:00:08
863500 -- [-391.992] (-392.933) (-389.527) (-391.474) * (-390.353) (-389.761) [-390.480] (-391.059) -- 0:00:08
864000 -- (-389.468) (-399.284) [-388.886] (-389.562) * (-391.324) (-395.616) (-390.680) [-393.216] -- 0:00:08
864500 -- [-391.599] (-392.016) (-389.700) (-393.518) * (-390.855) [-391.523] (-391.112) (-391.483) -- 0:00:08
865000 -- [-389.887] (-391.137) (-391.301) (-389.878) * (-391.744) [-390.167] (-393.047) (-392.095) -- 0:00:08
Average standard deviation of split frequencies: 0.009224
865500 -- [-390.875] (-392.320) (-390.760) (-389.589) * [-389.217] (-392.561) (-391.326) (-391.042) -- 0:00:08
866000 -- (-391.838) [-389.713] (-388.826) (-390.170) * (-390.075) (-390.790) (-392.121) [-389.152] -- 0:00:08
866500 -- [-389.387] (-390.542) (-391.914) (-391.806) * [-390.072] (-390.960) (-390.444) (-390.843) -- 0:00:08
867000 -- (-391.242) (-391.542) [-391.967] (-391.909) * (-390.830) (-390.898) (-395.260) [-392.978] -- 0:00:08
867500 -- [-393.684] (-390.180) (-395.911) (-389.006) * (-390.203) (-391.214) [-389.968] (-392.157) -- 0:00:08
868000 -- (-391.372) [-389.686] (-389.450) (-391.710) * (-391.504) (-391.552) [-390.339] (-390.698) -- 0:00:08
868500 -- (-389.490) (-392.550) (-389.078) [-392.154] * (-391.828) (-397.215) [-390.380] (-391.207) -- 0:00:08
869000 -- [-390.641] (-390.504) (-390.203) (-392.801) * (-389.737) (-393.861) [-390.237] (-389.959) -- 0:00:08
869500 -- [-391.036] (-390.098) (-391.393) (-392.123) * (-389.719) (-392.809) (-393.379) [-389.376] -- 0:00:08
870000 -- (-389.832) [-390.333] (-389.743) (-389.589) * [-391.418] (-391.489) (-394.055) (-389.950) -- 0:00:08
Average standard deviation of split frequencies: 0.008631
870500 -- (-389.617) (-390.275) (-390.992) [-389.806] * [-390.072] (-390.077) (-392.532) (-390.785) -- 0:00:08
871000 -- (-391.018) (-392.129) (-392.726) [-389.209] * (-392.755) [-390.138] (-389.686) (-390.924) -- 0:00:08
871500 -- (-391.561) (-389.745) (-389.432) [-391.078] * [-389.446] (-395.422) (-389.303) (-395.114) -- 0:00:08
872000 -- (-389.635) (-389.875) (-392.213) [-389.535] * (-389.449) (-391.098) (-389.011) [-392.107] -- 0:00:08
872500 -- (-391.586) (-391.096) [-390.496] (-389.461) * (-390.636) [-394.065] (-391.260) (-389.608) -- 0:00:08
873000 -- [-391.530] (-394.841) (-389.571) (-389.641) * [-390.340] (-389.868) (-390.006) (-391.932) -- 0:00:08
873500 -- [-391.256] (-393.974) (-389.243) (-395.119) * (-390.011) [-391.722] (-389.122) (-392.303) -- 0:00:08
874000 -- [-392.132] (-392.407) (-391.561) (-389.144) * (-390.294) (-396.311) [-391.843] (-390.146) -- 0:00:08
874500 -- (-389.517) (-393.964) [-391.366] (-389.226) * (-392.096) (-392.105) (-390.428) [-389.625] -- 0:00:08
875000 -- [-389.346] (-394.215) (-391.026) (-390.160) * (-391.737) (-391.119) (-393.247) [-390.101] -- 0:00:08
Average standard deviation of split frequencies: 0.008294
875500 -- (-389.440) (-392.785) [-389.667] (-392.178) * [-391.511] (-389.717) (-394.536) (-394.222) -- 0:00:08
876000 -- (-389.558) [-390.614] (-395.577) (-390.106) * (-396.110) (-391.883) [-388.952] (-396.365) -- 0:00:08
876500 -- (-391.698) [-389.728] (-390.918) (-391.465) * (-393.502) (-390.759) (-390.877) [-390.816] -- 0:00:08
877000 -- (-395.026) (-391.167) (-396.660) [-393.305] * (-392.165) (-389.924) (-394.016) [-394.089] -- 0:00:07
877500 -- (-391.427) (-389.166) (-390.325) [-393.011] * (-392.675) [-390.760] (-390.491) (-390.549) -- 0:00:07
878000 -- (-389.956) (-388.738) (-391.156) [-393.761] * (-392.376) (-391.289) [-392.518] (-390.992) -- 0:00:07
878500 -- (-389.079) [-390.995] (-391.127) (-393.322) * (-391.725) [-390.035] (-388.721) (-390.630) -- 0:00:07
879000 -- (-390.954) (-389.995) (-391.099) [-390.020] * (-391.088) (-389.559) (-390.334) [-390.457] -- 0:00:07
879500 -- (-390.465) (-391.784) (-390.940) [-390.009] * (-390.640) (-390.212) [-390.154] (-390.266) -- 0:00:07
880000 -- (-389.771) (-391.287) (-390.173) [-389.401] * [-389.480] (-393.292) (-393.288) (-389.914) -- 0:00:07
Average standard deviation of split frequencies: 0.008092
880500 -- (-388.884) [-390.100] (-391.600) (-390.043) * (-389.549) (-392.313) (-390.061) [-389.344] -- 0:00:07
881000 -- [-391.836] (-392.292) (-390.939) (-389.747) * [-391.251] (-393.292) (-390.011) (-390.659) -- 0:00:07
881500 -- (-391.046) [-391.212] (-395.043) (-389.865) * (-392.257) [-390.224] (-393.394) (-389.672) -- 0:00:07
882000 -- (-392.404) (-388.856) [-394.762] (-393.580) * (-393.004) (-391.459) (-393.448) [-390.961] -- 0:00:07
882500 -- [-394.542] (-390.190) (-393.788) (-392.017) * (-390.329) (-389.470) (-390.640) [-390.521] -- 0:00:07
883000 -- (-391.078) [-392.797] (-389.522) (-389.607) * [-389.875] (-393.052) (-390.636) (-389.133) -- 0:00:07
883500 -- [-393.074] (-391.671) (-391.730) (-391.532) * [-389.875] (-390.216) (-390.295) (-390.244) -- 0:00:07
884000 -- (-392.174) (-389.083) (-390.337) [-391.372] * [-389.849] (-389.354) (-394.068) (-390.040) -- 0:00:07
884500 -- (-390.354) (-389.698) (-390.492) [-389.394] * [-391.079] (-394.741) (-391.807) (-389.334) -- 0:00:07
885000 -- (-390.239) (-392.343) (-392.894) [-392.206] * [-389.076] (-394.484) (-392.582) (-390.529) -- 0:00:07
Average standard deviation of split frequencies: 0.008106
885500 -- [-389.970] (-391.770) (-391.628) (-389.311) * [-390.703] (-391.549) (-390.167) (-392.089) -- 0:00:07
886000 -- [-390.920] (-390.659) (-393.593) (-392.631) * (-390.483) (-390.962) [-394.360] (-391.215) -- 0:00:07
886500 -- (-391.729) (-393.105) [-392.264] (-393.372) * (-391.879) (-390.910) (-392.194) [-390.101] -- 0:00:07
887000 -- [-389.503] (-389.081) (-392.182) (-389.836) * (-389.704) (-393.775) (-391.017) [-391.899] -- 0:00:07
887500 -- [-393.687] (-390.266) (-391.816) (-392.158) * (-391.158) (-393.254) [-389.269] (-390.171) -- 0:00:07
888000 -- (-389.702) (-390.266) (-390.898) [-391.624] * (-391.525) (-391.326) (-389.896) [-390.887] -- 0:00:07
888500 -- [-390.526] (-390.635) (-389.090) (-390.774) * [-391.951] (-389.482) (-389.170) (-390.586) -- 0:00:07
889000 -- (-392.056) [-391.501] (-393.349) (-389.045) * (-390.988) (-393.191) [-389.752] (-391.761) -- 0:00:07
889500 -- (-389.452) [-392.201] (-391.816) (-389.115) * (-389.487) [-392.633] (-395.326) (-391.152) -- 0:00:07
890000 -- (-394.093) [-390.632] (-390.280) (-391.552) * (-390.811) [-393.028] (-392.284) (-392.853) -- 0:00:07
Average standard deviation of split frequencies: 0.008468
890500 -- (-390.285) (-391.924) (-389.994) [-390.434] * [-388.669] (-394.484) (-390.903) (-389.900) -- 0:00:07
891000 -- [-390.845] (-392.034) (-390.448) (-390.251) * (-392.471) [-389.975] (-393.203) (-390.449) -- 0:00:07
891500 -- (-390.837) (-396.536) (-391.220) [-389.205] * (-389.928) [-391.112] (-390.440) (-394.236) -- 0:00:07
892000 -- (-391.502) (-390.373) (-389.786) [-392.017] * (-389.148) [-390.979] (-390.402) (-393.174) -- 0:00:07
892500 -- (-391.103) [-389.215] (-391.873) (-391.529) * [-390.530] (-391.498) (-389.487) (-396.852) -- 0:00:06
893000 -- (-392.235) (-389.646) (-391.235) [-389.896] * (-395.821) [-391.482] (-389.047) (-392.783) -- 0:00:06
893500 -- (-392.857) (-390.625) (-390.524) [-389.709] * (-392.414) (-390.213) [-391.580] (-392.605) -- 0:00:06
894000 -- (-393.738) (-391.560) [-391.065] (-390.624) * (-390.086) [-392.512] (-392.584) (-390.962) -- 0:00:06
894500 -- [-393.747] (-394.976) (-392.635) (-392.241) * (-389.040) (-393.380) [-389.340] (-392.777) -- 0:00:06
895000 -- (-391.612) (-391.016) [-392.685] (-392.989) * (-390.926) [-393.942] (-391.252) (-392.376) -- 0:00:06
Average standard deviation of split frequencies: 0.008108
895500 -- (-391.062) (-393.650) [-389.594] (-390.537) * (-390.868) [-389.695] (-393.368) (-390.634) -- 0:00:06
896000 -- (-391.475) (-390.662) [-392.221] (-390.466) * (-390.576) (-389.970) (-390.596) [-389.460] -- 0:00:06
896500 -- (-389.871) (-391.352) [-391.708] (-395.539) * (-392.356) (-391.373) [-389.271] (-392.132) -- 0:00:06
897000 -- (-393.199) (-390.226) [-389.710] (-390.082) * (-390.330) [-389.936] (-390.034) (-390.841) -- 0:00:06
897500 -- (-390.604) [-389.746] (-391.287) (-392.521) * (-393.150) (-389.670) (-392.643) [-390.645] -- 0:00:06
898000 -- [-392.356] (-389.977) (-390.607) (-392.904) * (-390.035) [-391.294] (-392.888) (-389.817) -- 0:00:06
898500 -- (-390.715) [-389.697] (-390.050) (-391.547) * (-391.609) (-393.235) [-390.615] (-395.570) -- 0:00:06
899000 -- (-391.842) (-392.256) [-392.769] (-390.521) * [-389.442] (-389.377) (-390.473) (-392.582) -- 0:00:06
899500 -- (-390.699) (-394.420) [-393.221] (-392.245) * (-389.389) (-388.720) [-389.484] (-391.366) -- 0:00:06
900000 -- [-389.949] (-389.316) (-394.125) (-394.916) * (-389.334) (-390.303) (-391.099) [-389.994] -- 0:00:06
Average standard deviation of split frequencies: 0.007974
900500 -- [-389.931] (-389.676) (-390.018) (-390.115) * [-389.040] (-393.678) (-390.353) (-392.873) -- 0:00:06
901000 -- (-388.762) [-391.060] (-393.725) (-392.830) * (-390.863) (-395.124) [-390.627] (-398.332) -- 0:00:06
901500 -- (-391.849) (-391.386) (-388.773) [-394.999] * (-391.024) (-390.713) (-389.812) [-393.341] -- 0:00:06
902000 -- (-390.895) (-390.966) (-390.795) [-389.944] * (-390.704) [-389.597] (-391.693) (-391.448) -- 0:00:06
902500 -- (-389.281) (-389.969) (-389.630) [-391.567] * (-391.286) [-390.229] (-391.460) (-389.738) -- 0:00:06
903000 -- (-390.894) [-391.141] (-389.571) (-390.147) * (-390.582) (-389.819) (-392.307) [-394.319] -- 0:00:06
903500 -- (-392.301) (-393.376) [-389.748] (-395.903) * [-391.681] (-388.753) (-391.420) (-390.051) -- 0:00:06
904000 -- (-391.506) (-390.217) (-391.321) [-393.549] * (-389.773) (-388.731) (-394.960) [-394.213] -- 0:00:06
904500 -- [-389.163] (-389.498) (-392.178) (-392.610) * (-392.755) (-388.781) [-390.154] (-391.566) -- 0:00:06
905000 -- [-389.583] (-390.356) (-393.121) (-393.454) * (-393.786) [-389.848] (-392.243) (-390.852) -- 0:00:06
Average standard deviation of split frequencies: 0.007866
905500 -- [-391.189] (-391.493) (-394.327) (-394.062) * [-393.442] (-391.744) (-389.637) (-391.108) -- 0:00:06
906000 -- [-392.436] (-390.756) (-389.766) (-395.687) * (-392.641) (-391.915) [-391.793] (-392.567) -- 0:00:06
906500 -- (-390.971) (-390.294) [-388.902] (-393.954) * [-392.804] (-391.436) (-389.131) (-391.231) -- 0:00:06
907000 -- (-393.263) (-390.282) (-390.138) [-394.913] * (-392.142) (-392.126) [-388.930] (-397.918) -- 0:00:06
907500 -- (-388.817) (-391.390) (-390.493) [-391.297] * [-391.158] (-394.738) (-392.138) (-392.541) -- 0:00:06
908000 -- (-390.348) (-392.251) (-389.911) [-390.721] * [-390.039] (-391.050) (-390.463) (-390.839) -- 0:00:05
908500 -- (-393.010) (-391.449) (-392.716) [-390.399] * (-392.035) (-389.828) [-389.874] (-394.302) -- 0:00:05
909000 -- (-396.525) (-394.953) [-390.744] (-391.118) * (-392.583) [-389.351] (-391.418) (-392.851) -- 0:00:05
909500 -- (-396.749) (-391.611) [-390.464] (-390.651) * (-394.413) (-390.409) [-390.037] (-389.888) -- 0:00:05
910000 -- (-391.146) (-391.832) [-391.852] (-392.918) * (-391.831) (-389.607) (-392.526) [-390.248] -- 0:00:05
Average standard deviation of split frequencies: 0.008379
910500 -- (-391.489) (-390.085) [-388.902] (-393.337) * (-390.933) (-389.457) [-390.300] (-390.531) -- 0:00:05
911000 -- (-389.829) (-393.066) [-391.509] (-390.657) * (-391.294) [-388.874] (-390.686) (-392.130) -- 0:00:05
911500 -- (-391.508) (-390.257) [-391.489] (-390.617) * [-389.668] (-394.058) (-394.090) (-392.856) -- 0:00:05
912000 -- (-392.279) (-391.033) (-391.225) [-389.447] * (-390.347) (-391.326) [-392.434] (-392.352) -- 0:00:05
912500 -- (-391.076) (-391.061) [-390.978] (-389.940) * (-389.585) (-389.080) (-390.870) [-390.705] -- 0:00:05
913000 -- (-390.457) (-392.757) [-391.388] (-393.958) * (-393.737) (-389.362) (-394.665) [-392.181] -- 0:00:05
913500 -- (-390.143) (-389.383) [-390.980] (-391.588) * (-390.894) [-391.845] (-392.027) (-390.730) -- 0:00:05
914000 -- (-390.989) (-394.602) [-389.795] (-395.000) * (-390.003) (-390.828) (-389.772) [-392.537] -- 0:00:05
914500 -- [-391.806] (-391.644) (-392.370) (-398.485) * (-390.944) (-391.060) (-391.540) [-391.365] -- 0:00:05
915000 -- (-395.769) [-392.512] (-390.251) (-392.407) * (-391.150) [-392.496] (-392.337) (-390.438) -- 0:00:05
Average standard deviation of split frequencies: 0.008266
915500 -- (-391.700) (-391.624) (-390.665) [-390.409] * (-391.878) [-392.777] (-392.427) (-393.615) -- 0:00:05
916000 -- [-390.997] (-394.539) (-393.357) (-392.011) * (-389.276) [-395.096] (-389.329) (-390.151) -- 0:00:05
916500 -- (-390.838) (-392.944) (-389.812) [-391.024] * (-389.935) (-394.281) [-391.340] (-391.815) -- 0:00:05
917000 -- (-391.619) (-390.296) (-391.197) [-390.541] * (-392.812) [-391.637] (-392.539) (-393.767) -- 0:00:05
917500 -- (-390.581) (-393.099) [-390.833] (-393.342) * (-389.243) (-392.257) (-392.554) [-395.493] -- 0:00:05
918000 -- [-390.583] (-395.386) (-393.196) (-393.374) * (-396.517) (-393.313) [-393.734] (-393.503) -- 0:00:05
918500 -- (-390.310) [-391.734] (-395.148) (-391.333) * [-398.459] (-389.669) (-389.785) (-391.108) -- 0:00:05
919000 -- [-389.384] (-389.886) (-393.453) (-390.743) * (-392.940) [-389.834] (-393.330) (-390.147) -- 0:00:05
919500 -- (-394.821) (-390.183) [-390.552] (-390.559) * [-393.710] (-390.018) (-391.088) (-395.318) -- 0:00:05
920000 -- (-390.248) (-390.219) [-390.817] (-389.231) * (-391.987) (-391.019) (-389.493) [-391.035] -- 0:00:05
Average standard deviation of split frequencies: 0.008576
920500 -- [-391.960] (-390.779) (-390.091) (-389.160) * [-390.592] (-389.692) (-389.772) (-390.891) -- 0:00:05
921000 -- (-391.607) (-389.560) (-391.657) [-389.066] * (-390.328) [-390.033] (-389.560) (-391.191) -- 0:00:05
921500 -- (-389.450) (-394.542) [-389.763] (-390.758) * [-393.175] (-389.357) (-389.090) (-390.520) -- 0:00:05
922000 -- (-391.478) [-390.690] (-389.355) (-390.844) * (-393.626) (-393.303) (-389.574) [-388.964] -- 0:00:05
922500 -- (-389.760) [-392.566] (-389.851) (-391.816) * (-391.156) (-390.381) (-388.993) [-391.489] -- 0:00:05
923000 -- (-389.258) [-393.267] (-397.441) (-390.949) * (-389.705) [-390.890] (-394.916) (-389.957) -- 0:00:05
923500 -- (-394.488) (-393.887) (-390.794) [-389.722] * (-390.753) [-390.170] (-393.827) (-389.589) -- 0:00:04
924000 -- (-396.017) (-392.421) (-390.455) [-389.219] * (-391.194) (-389.373) (-390.527) [-392.882] -- 0:00:04
924500 -- (-391.346) (-391.585) [-390.511] (-391.583) * [-390.023] (-390.213) (-389.939) (-394.507) -- 0:00:04
925000 -- (-390.691) (-395.371) (-391.468) [-391.684] * (-396.368) (-390.359) [-390.098] (-391.447) -- 0:00:04
Average standard deviation of split frequencies: 0.007636
925500 -- [-393.444] (-391.238) (-390.277) (-391.305) * (-392.043) (-396.229) [-389.250] (-391.870) -- 0:00:04
926000 -- (-392.218) (-389.553) (-392.855) [-391.081] * [-395.260] (-391.708) (-389.522) (-392.253) -- 0:00:04
926500 -- [-389.447] (-389.537) (-393.284) (-390.287) * (-394.515) [-390.104] (-389.418) (-391.378) -- 0:00:04
927000 -- (-391.513) (-389.510) [-389.786] (-391.488) * (-391.255) (-390.166) (-390.577) [-391.612] -- 0:00:04
927500 -- (-390.653) (-391.294) (-393.463) [-389.549] * (-393.109) (-390.938) [-390.136] (-393.144) -- 0:00:04
928000 -- (-390.895) [-390.313] (-392.493) (-391.003) * (-390.871) (-389.682) (-390.426) [-394.418] -- 0:00:04
928500 -- (-392.404) [-389.923] (-393.391) (-389.645) * (-389.565) [-389.078] (-390.834) (-390.549) -- 0:00:04
929000 -- [-391.866] (-390.078) (-390.986) (-389.104) * [-388.995] (-391.578) (-389.593) (-390.678) -- 0:00:04
929500 -- (-390.262) [-391.130] (-392.606) (-389.002) * (-389.770) (-392.184) [-390.348] (-390.059) -- 0:00:04
930000 -- (-392.855) (-391.009) [-390.084] (-389.399) * (-390.999) (-400.860) [-394.456] (-391.060) -- 0:00:04
Average standard deviation of split frequencies: 0.007568
930500 -- [-391.689] (-392.191) (-396.672) (-389.795) * [-388.823] (-393.837) (-391.996) (-392.417) -- 0:00:04
931000 -- [-389.658] (-396.655) (-389.643) (-394.427) * [-388.856] (-390.882) (-394.594) (-392.317) -- 0:00:04
931500 -- (-390.562) (-396.484) [-389.954] (-391.429) * (-392.349) [-389.655] (-393.368) (-391.251) -- 0:00:04
932000 -- [-390.084] (-391.491) (-395.337) (-394.203) * (-389.623) (-389.921) [-390.946] (-390.025) -- 0:00:04
932500 -- (-389.959) (-389.749) (-395.630) [-392.878] * (-392.044) (-390.535) (-392.682) [-389.032] -- 0:00:04
933000 -- (-392.471) [-390.228] (-391.318) (-391.755) * (-392.671) (-390.653) (-394.243) [-390.599] -- 0:00:04
933500 -- [-397.635] (-391.117) (-392.274) (-390.197) * (-389.289) [-390.463] (-396.889) (-390.409) -- 0:00:04
934000 -- (-392.714) (-393.235) (-391.710) [-392.219] * (-388.792) (-394.916) (-389.624) [-390.655] -- 0:00:04
934500 -- (-390.893) (-391.054) [-391.419] (-391.497) * [-392.148] (-392.404) (-390.089) (-389.243) -- 0:00:04
935000 -- (-396.700) (-392.453) [-390.683] (-390.393) * [-390.126] (-390.532) (-393.310) (-390.403) -- 0:00:04
Average standard deviation of split frequencies: 0.007673
935500 -- (-390.180) (-395.631) [-390.820] (-391.351) * (-391.819) (-392.709) (-389.831) [-389.787] -- 0:00:04
936000 -- (-394.345) [-389.044] (-393.510) (-391.852) * (-389.119) [-391.611] (-389.629) (-394.186) -- 0:00:04
936500 -- (-391.269) (-392.030) [-391.318] (-391.380) * (-390.911) [-390.687] (-391.559) (-394.374) -- 0:00:04
937000 -- (-393.270) [-394.575] (-392.717) (-390.864) * (-392.855) (-391.327) [-393.452] (-392.043) -- 0:00:04
937500 -- [-391.293] (-394.043) (-391.781) (-390.980) * (-391.454) (-391.150) (-390.689) [-392.404] -- 0:00:04
938000 -- (-392.238) (-391.136) (-391.025) [-389.731] * (-390.254) (-393.528) [-390.661] (-391.839) -- 0:00:04
938500 -- (-389.179) [-390.125] (-390.222) (-393.267) * [-389.511] (-392.805) (-389.663) (-389.534) -- 0:00:03
939000 -- [-392.724] (-391.421) (-390.442) (-392.196) * (-389.928) [-389.498] (-389.614) (-390.507) -- 0:00:03
939500 -- (-391.213) (-392.601) (-390.768) [-391.348] * (-390.107) (-392.205) [-392.068] (-391.078) -- 0:00:03
940000 -- (-391.442) [-389.429] (-392.660) (-389.967) * [-388.969] (-389.482) (-390.786) (-391.946) -- 0:00:03
Average standard deviation of split frequencies: 0.007812
940500 -- (-395.037) (-389.905) (-389.775) [-390.259] * (-389.865) (-392.209) [-389.965] (-390.177) -- 0:00:03
941000 -- (-399.711) (-389.838) (-390.462) [-391.548] * [-390.214] (-391.238) (-391.807) (-392.804) -- 0:00:03
941500 -- (-395.015) (-391.277) [-390.563] (-389.310) * (-393.729) (-392.618) (-390.926) [-389.848] -- 0:00:03
942000 -- (-393.113) [-389.213] (-391.240) (-389.986) * [-391.150] (-394.695) (-390.980) (-392.414) -- 0:00:03
942500 -- (-389.097) (-399.448) [-390.151] (-388.871) * [-390.813] (-390.546) (-389.913) (-390.816) -- 0:00:03
943000 -- (-393.893) (-394.381) [-391.110] (-389.513) * [-392.485] (-390.604) (-395.241) (-389.300) -- 0:00:03
943500 -- (-396.393) (-392.594) [-389.901] (-389.102) * (-392.636) (-391.190) [-388.953] (-389.428) -- 0:00:03
944000 -- (-392.159) (-390.554) [-391.297] (-388.719) * (-391.009) (-392.875) (-393.655) [-390.879] -- 0:00:03
944500 -- (-393.952) (-394.990) (-391.691) [-390.779] * (-389.488) (-390.673) (-389.853) [-391.726] -- 0:00:03
945000 -- (-392.796) (-394.193) [-389.989] (-390.203) * (-389.667) [-392.482] (-390.943) (-394.097) -- 0:00:03
Average standard deviation of split frequencies: 0.007826
945500 -- (-389.797) (-391.339) (-388.911) [-389.060] * [-391.028] (-389.818) (-388.796) (-393.544) -- 0:00:03
946000 -- (-391.309) (-389.621) (-389.988) [-394.302] * (-388.985) [-389.427] (-388.742) (-390.359) -- 0:00:03
946500 -- (-390.365) (-395.138) [-389.143] (-392.538) * [-388.638] (-390.824) (-388.833) (-390.758) -- 0:00:03
947000 -- (-393.178) [-390.147] (-389.494) (-389.044) * (-394.758) [-389.211] (-389.180) (-389.702) -- 0:00:03
947500 -- [-391.044] (-389.397) (-389.800) (-388.694) * (-389.784) (-389.663) (-390.772) [-393.244] -- 0:00:03
948000 -- [-389.586] (-390.857) (-389.839) (-389.654) * (-393.677) [-390.690] (-392.972) (-392.982) -- 0:00:03
948500 -- [-391.257] (-391.783) (-393.471) (-391.065) * (-389.947) (-391.101) (-391.531) [-391.021] -- 0:00:03
949000 -- [-390.402] (-394.281) (-393.400) (-390.400) * (-391.281) (-389.164) [-390.875] (-390.426) -- 0:00:03
949500 -- (-389.069) (-393.145) [-389.398] (-392.998) * (-392.789) (-390.317) [-392.189] (-391.004) -- 0:00:03
950000 -- (-393.276) (-393.130) [-391.075] (-390.376) * (-391.399) (-390.984) (-393.710) [-392.719] -- 0:00:03
Average standard deviation of split frequencies: 0.008182
950500 -- (-393.270) (-390.171) [-392.506] (-389.865) * (-389.812) (-389.630) [-394.473] (-392.228) -- 0:00:03
951000 -- [-390.680] (-389.856) (-392.852) (-391.546) * [-390.301] (-389.604) (-390.217) (-391.208) -- 0:00:03
951500 -- [-393.856] (-392.326) (-391.228) (-391.569) * [-389.204] (-390.244) (-391.806) (-389.797) -- 0:00:03
952000 -- (-389.082) (-389.770) (-389.258) [-389.178] * (-389.869) (-390.924) (-392.982) [-392.484] -- 0:00:03
952500 -- [-391.054] (-390.724) (-393.243) (-388.725) * (-394.058) (-390.925) [-390.622] (-395.370) -- 0:00:03
953000 -- (-393.641) (-393.022) [-391.847] (-389.212) * (-393.185) (-392.897) [-390.168] (-394.500) -- 0:00:03
953500 -- (-395.979) (-391.012) [-392.880] (-392.106) * (-389.433) (-391.773) (-389.134) [-390.512] -- 0:00:03
954000 -- (-391.664) [-390.120] (-392.163) (-391.803) * (-391.405) [-389.845] (-389.250) (-388.999) -- 0:00:02
954500 -- (-392.167) (-390.186) (-392.283) [-391.294] * (-391.712) [-391.261] (-389.551) (-389.064) -- 0:00:02
955000 -- (-392.926) (-389.271) [-390.178] (-393.050) * (-392.631) (-389.996) [-390.454] (-389.985) -- 0:00:02
Average standard deviation of split frequencies: 0.007982
955500 -- (-394.605) (-393.194) [-388.557] (-392.596) * (-391.409) (-390.345) (-392.303) [-390.449] -- 0:00:02
956000 -- (-389.679) (-396.715) (-392.568) [-389.506] * (-391.882) [-390.642] (-392.270) (-390.363) -- 0:00:02
956500 -- (-392.506) (-390.733) [-390.029] (-389.370) * (-397.040) (-391.292) (-389.774) [-390.874] -- 0:00:02
957000 -- (-393.296) (-390.775) [-391.409] (-391.774) * [-390.362] (-390.554) (-389.403) (-391.456) -- 0:00:02
957500 -- (-389.484) [-391.305] (-389.947) (-390.466) * [-390.046] (-389.850) (-391.273) (-395.266) -- 0:00:02
958000 -- (-390.052) (-389.124) (-389.371) [-392.755] * (-392.111) (-390.007) (-390.031) [-393.508] -- 0:00:02
958500 -- (-389.840) (-389.520) [-390.042] (-391.333) * (-390.214) [-388.972] (-390.177) (-393.055) -- 0:00:02
959000 -- (-390.269) (-392.218) [-389.225] (-393.955) * [-392.060] (-392.784) (-391.899) (-395.112) -- 0:00:02
959500 -- (-391.724) (-390.167) (-390.542) [-392.107] * (-392.218) (-393.018) [-395.456] (-394.598) -- 0:00:02
960000 -- (-391.204) [-389.388] (-395.617) (-391.182) * [-389.206] (-390.966) (-398.419) (-391.824) -- 0:00:02
Average standard deviation of split frequencies: 0.007483
960500 -- (-393.272) [-391.011] (-391.227) (-390.568) * (-390.125) (-395.623) (-389.853) [-395.897] -- 0:00:02
961000 -- (-391.545) (-389.531) [-390.711] (-392.948) * (-390.036) (-390.947) [-389.247] (-391.968) -- 0:00:02
961500 -- (-396.758) (-392.250) [-392.827] (-390.402) * (-392.061) [-390.219] (-389.278) (-393.837) -- 0:00:02
962000 -- [-392.274] (-389.126) (-389.579) (-392.505) * (-394.866) [-390.070] (-390.764) (-394.057) -- 0:00:02
962500 -- (-393.357) (-389.510) (-389.201) [-389.341] * (-394.205) (-390.026) [-388.661] (-393.445) -- 0:00:02
963000 -- (-391.935) (-389.207) (-389.451) [-389.453] * [-393.963] (-391.651) (-388.908) (-394.987) -- 0:00:02
963500 -- [-390.641] (-390.268) (-392.556) (-397.243) * (-392.297) (-391.799) [-388.890] (-390.093) -- 0:00:02
964000 -- (-389.170) [-390.142] (-389.958) (-392.428) * [-389.939] (-392.380) (-391.052) (-393.122) -- 0:00:02
964500 -- [-393.335] (-391.725) (-391.315) (-392.458) * (-391.832) [-391.980] (-389.827) (-392.837) -- 0:00:02
965000 -- (-391.928) [-393.367] (-391.414) (-391.254) * [-389.819] (-389.752) (-389.997) (-390.071) -- 0:00:02
Average standard deviation of split frequencies: 0.007137
965500 -- (-390.739) (-391.072) (-390.702) [-392.375] * (-393.105) [-389.617] (-389.539) (-391.404) -- 0:00:02
966000 -- [-398.368] (-390.335) (-391.011) (-393.349) * (-390.702) (-392.701) [-390.087] (-389.712) -- 0:00:02
966500 -- (-394.528) [-389.834] (-392.620) (-393.137) * (-392.274) [-394.961] (-392.360) (-389.727) -- 0:00:02
967000 -- (-391.803) (-390.262) [-388.876] (-395.106) * (-396.127) (-393.654) [-396.420] (-392.048) -- 0:00:02
967500 -- (-392.031) [-390.510] (-392.812) (-392.739) * (-392.741) (-393.269) (-392.092) [-391.812] -- 0:00:02
968000 -- (-391.568) (-390.661) [-390.664] (-394.367) * (-391.459) (-392.392) (-395.304) [-390.798] -- 0:00:02
968500 -- (-391.052) (-392.762) [-389.101] (-393.836) * (-390.155) [-390.661] (-389.748) (-389.136) -- 0:00:02
969000 -- (-389.580) [-390.375] (-389.903) (-390.046) * (-391.403) [-389.647] (-389.176) (-391.463) -- 0:00:02
969500 -- (-389.970) (-390.377) [-392.477] (-390.258) * (-393.198) [-390.091] (-389.008) (-390.940) -- 0:00:01
970000 -- [-389.650] (-389.870) (-396.813) (-388.819) * [-399.524] (-391.031) (-389.080) (-389.731) -- 0:00:01
Average standard deviation of split frequencies: 0.006921
970500 -- (-391.709) (-393.798) (-389.376) [-391.314] * (-391.204) [-391.661] (-390.507) (-393.097) -- 0:00:01
971000 -- [-390.263] (-393.264) (-389.326) (-390.360) * (-394.464) [-391.100] (-389.049) (-396.212) -- 0:00:01
971500 -- [-390.060] (-393.760) (-389.185) (-393.789) * (-390.832) [-390.022] (-389.206) (-390.073) -- 0:00:01
972000 -- (-391.307) (-397.195) (-390.490) [-392.032] * (-394.058) (-389.589) (-390.860) [-390.682] -- 0:00:01
972500 -- (-393.333) (-391.193) (-389.957) [-391.001] * (-392.650) (-389.829) [-394.108] (-391.839) -- 0:00:01
973000 -- (-392.780) (-392.329) (-391.164) [-389.618] * [-389.640] (-391.079) (-392.776) (-391.929) -- 0:00:01
973500 -- (-392.220) (-389.339) (-396.913) [-392.787] * (-390.854) (-392.375) (-390.643) [-388.936] -- 0:00:01
974000 -- (-392.217) [-389.865] (-390.249) (-390.119) * (-391.646) (-389.330) [-393.622] (-389.416) -- 0:00:01
974500 -- (-390.958) (-391.829) (-390.286) [-390.145] * [-389.351] (-389.047) (-390.638) (-391.027) -- 0:00:01
975000 -- (-391.983) (-392.514) [-390.342] (-389.154) * [-389.225] (-389.248) (-389.704) (-389.778) -- 0:00:01
Average standard deviation of split frequencies: 0.007094
975500 -- (-391.348) [-390.224] (-391.964) (-390.802) * (-394.895) (-395.425) (-390.448) [-390.905] -- 0:00:01
976000 -- (-391.943) [-393.121] (-389.312) (-391.517) * (-400.848) (-390.247) [-389.882] (-391.140) -- 0:00:01
976500 -- (-390.723) [-389.432] (-389.417) (-390.051) * (-390.832) (-392.229) [-390.754] (-391.918) -- 0:00:01
977000 -- (-391.880) (-394.339) [-389.611] (-390.162) * (-390.140) (-391.359) [-391.897] (-390.381) -- 0:00:01
977500 -- (-393.377) (-392.155) (-389.634) [-389.457] * [-388.651] (-391.764) (-392.219) (-389.448) -- 0:00:01
978000 -- (-391.813) [-398.403] (-390.570) (-389.404) * (-393.094) (-389.755) (-392.271) [-388.825] -- 0:00:01
978500 -- (-392.773) (-396.318) [-390.104] (-391.555) * (-393.260) [-391.779] (-390.214) (-390.910) -- 0:00:01
979000 -- [-391.690] (-391.442) (-391.339) (-392.594) * (-392.046) [-391.749] (-389.657) (-394.739) -- 0:00:01
979500 -- (-391.058) (-389.730) (-392.418) [-389.126] * (-389.507) (-391.612) [-388.923] (-391.866) -- 0:00:01
980000 -- [-391.048] (-392.206) (-390.576) (-393.423) * [-390.318] (-391.890) (-393.609) (-391.046) -- 0:00:01
Average standard deviation of split frequencies: 0.006956
980500 -- (-390.810) [-389.368] (-389.224) (-391.580) * [-392.247] (-391.536) (-392.038) (-393.300) -- 0:00:01
981000 -- (-390.161) (-389.389) [-392.079] (-390.731) * (-391.001) (-392.967) [-390.133] (-391.476) -- 0:00:01
981500 -- (-391.247) (-392.378) [-392.505] (-390.801) * (-390.779) (-389.254) (-390.560) [-392.124] -- 0:00:01
982000 -- (-390.471) (-389.831) [-391.586] (-391.003) * (-389.066) (-390.167) (-389.526) [-390.141] -- 0:00:01
982500 -- (-389.424) (-392.934) (-398.669) [-389.653] * (-391.609) (-393.842) (-390.351) [-390.044] -- 0:00:01
983000 -- (-393.888) [-392.673] (-399.771) (-389.806) * (-389.992) (-397.924) (-391.996) [-391.241] -- 0:00:01
983500 -- [-389.250] (-392.494) (-392.794) (-389.896) * (-389.567) (-393.086) (-389.977) [-390.611] -- 0:00:01
984000 -- [-389.101] (-391.952) (-392.903) (-390.884) * (-390.381) (-389.877) [-392.549] (-391.391) -- 0:00:01
984500 -- (-392.018) (-390.504) (-389.683) [-391.008] * (-393.554) (-389.160) (-389.243) [-391.823] -- 0:00:01
985000 -- (-391.092) [-388.889] (-390.944) (-391.141) * (-390.684) [-389.983] (-392.143) (-394.611) -- 0:00:00
Average standard deviation of split frequencies: 0.007115
985500 -- (-390.282) [-389.198] (-392.600) (-389.772) * (-391.756) (-392.269) [-391.947] (-390.891) -- 0:00:00
986000 -- (-392.285) [-389.629] (-389.302) (-394.058) * [-390.912] (-390.487) (-389.542) (-389.474) -- 0:00:00
986500 -- (-389.866) [-390.510] (-392.963) (-391.977) * (-391.392) (-392.185) [-389.910] (-390.067) -- 0:00:00
987000 -- (-393.252) (-394.334) (-392.259) [-395.387] * (-390.515) (-394.156) (-389.962) [-391.340] -- 0:00:00
987500 -- (-390.780) (-389.953) (-392.036) [-391.373] * [-390.686] (-392.360) (-390.284) (-390.539) -- 0:00:00
988000 -- (-392.824) [-389.890] (-391.059) (-389.771) * (-391.695) [-393.358] (-390.249) (-389.189) -- 0:00:00
988500 -- (-391.161) (-389.003) (-390.779) [-389.711] * [-389.407] (-391.970) (-389.382) (-396.410) -- 0:00:00
989000 -- (-394.392) (-390.535) (-389.575) [-391.864] * (-390.076) [-389.732] (-393.018) (-391.276) -- 0:00:00
989500 -- (-396.960) [-389.018] (-388.929) (-392.667) * (-390.486) (-391.092) (-390.220) [-390.563] -- 0:00:00
990000 -- (-392.174) [-391.984] (-388.896) (-389.020) * (-390.332) [-393.168] (-392.187) (-392.009) -- 0:00:00
Average standard deviation of split frequencies: 0.007138
990500 -- (-391.129) (-390.626) [-390.873] (-390.003) * (-390.564) (-389.511) [-392.649] (-393.102) -- 0:00:00
991000 -- [-389.534] (-390.987) (-390.096) (-390.179) * (-392.712) (-392.271) [-393.895] (-390.043) -- 0:00:00
991500 -- (-394.288) (-392.839) [-392.943] (-388.810) * (-389.754) (-393.404) (-392.082) [-390.447] -- 0:00:00
992000 -- (-390.942) [-390.787] (-389.984) (-392.650) * (-389.864) [-391.764] (-391.088) (-395.707) -- 0:00:00
992500 -- (-391.048) (-389.828) [-390.692] (-393.077) * (-391.143) [-390.103] (-390.910) (-391.099) -- 0:00:00
993000 -- (-389.835) (-391.338) [-390.490] (-390.629) * (-391.658) [-390.173] (-390.041) (-395.135) -- 0:00:00
993500 -- (-390.619) (-391.654) (-389.236) [-392.769] * (-392.486) (-393.805) (-390.799) [-388.977] -- 0:00:00
994000 -- (-393.053) (-388.575) [-390.977] (-391.518) * [-394.880] (-393.457) (-389.110) (-389.769) -- 0:00:00
994500 -- (-391.803) (-391.654) (-389.834) [-389.607] * (-391.947) [-393.119] (-391.774) (-388.780) -- 0:00:00
995000 -- (-392.668) [-389.569] (-391.073) (-390.435) * (-390.250) [-390.068] (-391.638) (-389.979) -- 0:00:00
Average standard deviation of split frequencies: 0.007239
995500 -- (-392.008) [-393.235] (-391.706) (-389.837) * [-389.668] (-391.329) (-389.644) (-391.202) -- 0:00:00
996000 -- [-393.048] (-394.135) (-396.237) (-389.219) * [-390.845] (-390.089) (-390.178) (-388.979) -- 0:00:00
996500 -- (-391.144) (-393.580) (-390.585) [-388.923] * [-390.406] (-389.927) (-390.103) (-390.505) -- 0:00:00
997000 -- (-391.130) (-391.693) [-388.934] (-390.014) * (-391.051) (-389.771) [-395.434] (-390.440) -- 0:00:00
997500 -- (-391.420) (-389.950) (-390.466) [-391.688] * (-394.036) [-393.051] (-393.111) (-392.184) -- 0:00:00
998000 -- (-392.288) (-390.827) (-388.695) [-393.436] * (-389.582) [-389.235] (-390.741) (-389.646) -- 0:00:00
998500 -- (-392.151) (-390.978) [-389.744] (-389.508) * (-389.585) (-392.137) [-388.597] (-397.844) -- 0:00:00
999000 -- (-393.818) [-390.021] (-389.752) (-391.280) * (-392.605) (-390.017) [-389.173] (-393.108) -- 0:00:00
999500 -- (-392.703) (-391.356) (-389.193) [-393.045] * [-389.586] (-389.705) (-390.848) (-391.476) -- 0:00:00
1000000 -- [-391.662] (-391.763) (-391.884) (-394.051) * (-394.482) (-389.899) (-392.542) [-389.195] -- 0:00:00
Average standard deviation of split frequencies: 0.007260
Analysis completed in 1 mins 5 seconds
Analysis used 63.85 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -388.52
Likelihood of best state for "cold" chain of run 2 was -388.53
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.7 % ( 74 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
39.5 % ( 33 %) Dirichlet(Pi{all})
38.3 % ( 22 %) Slider(Pi{all})
78.7 % ( 42 %) Multiplier(Alpha{1,2})
77.9 % ( 44 %) Multiplier(Alpha{3})
25.7 % ( 23 %) Slider(Pinvar{all})
98.7 % ( 98 %) ExtSPR(Tau{all},V{all})
70.1 % ( 65 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 89 %) ParsSPR(Tau{all},V{all})
28.2 % ( 22 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.5 % ( 13 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.7 % ( 74 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
40.3 % ( 25 %) Dirichlet(Pi{all})
39.7 % ( 30 %) Slider(Pi{all})
78.7 % ( 58 %) Multiplier(Alpha{1,2})
77.6 % ( 52 %) Multiplier(Alpha{3})
25.8 % ( 25 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 63 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 82 %) ParsSPR(Tau{all},V{all})
28.2 % ( 18 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
30.1 % ( 16 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.63 0.49
2 | 167074 0.82 0.66
3 | 165958 166771 0.84
4 | 167055 166824 166318
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166923 0.82 0.67
3 | 166341 166328 0.84
4 | 166744 166965 166699
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -390.24
| 2 |
| 2 2 |
| 2 2 2 22 1 |
| 1 1 111 21 2 1 1 1 1 1 21 22 2 2 |
| 1 1 1 12 2 21 1 2 1 2 12 |
|1 2 2 22 2 1 1 2 1 1 2 1 |
| 2 22 2 1 2 2 1 1 2 21 1 1 11 *|
| 2 1 12 1* 2 1 2 1 1 2 |
| 11 2 11 1 2 2 11 1 22 1 |
|22 2 2 2 2 1 12 * 2 2 |
| 1 1 |
| 1 |
| 1 |
| 2 |
| 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -392.10
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -390.23 -393.72
2 -390.21 -394.36
--------------------------------------
TOTAL -390.22 -394.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.887198 0.085958 0.350301 1.470841 0.859625 1493.65 1497.32 1.000
r(A<->C){all} 0.168950 0.020220 0.000030 0.455639 0.130728 253.77 368.49 1.002
r(A<->G){all} 0.165996 0.019209 0.000103 0.444065 0.131829 253.37 286.19 1.000
r(A<->T){all} 0.168380 0.018865 0.000263 0.442971 0.137501 212.19 318.26 1.000
r(C<->G){all} 0.164096 0.020469 0.000149 0.450937 0.122861 279.80 371.01 1.004
r(C<->T){all} 0.159689 0.018492 0.000005 0.432721 0.125397 180.77 226.66 1.001
r(G<->T){all} 0.172889 0.019064 0.000128 0.443622 0.141696 172.29 277.40 1.004
pi(A){all} 0.191937 0.000521 0.148532 0.236752 0.191364 1393.12 1404.61 1.001
pi(C){all} 0.291382 0.000699 0.237026 0.341496 0.290600 1150.93 1292.22 1.000
pi(G){all} 0.338678 0.000782 0.284179 0.392478 0.338526 1262.61 1378.24 1.000
pi(T){all} 0.178003 0.000490 0.135590 0.219906 0.177568 1244.78 1372.89 1.000
alpha{1,2} 0.395936 0.209523 0.000113 1.342600 0.230272 1111.53 1161.94 1.001
alpha{3} 0.469960 0.246913 0.000111 1.462212 0.310389 1290.66 1330.53 1.000
pinvar{all} 0.994220 0.000049 0.980838 0.999998 0.996544 1385.80 1417.96 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...*.*
8 -- ..*.*.
9 -- .**...
10 -- .***.*
11 -- ..****
12 -- ..*..*
13 -- .*.*..
14 -- .**.**
15 -- .*.***
16 -- .*..*.
17 -- .*...*
18 -- ...**.
19 -- ....**
20 -- .****.
21 -- ..**..
22 -- .*.*.*
23 -- .**.*.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 477 0.158894 0.005182 0.155230 0.162558 2
8 471 0.156895 0.008009 0.151233 0.162558 2
9 460 0.153231 0.012248 0.144570 0.161892 2
10 447 0.148901 0.009893 0.141905 0.155896 2
11 429 0.142905 0.015546 0.131912 0.153897 2
12 429 0.142905 0.000471 0.142572 0.143238 2
13 427 0.142239 0.008951 0.135909 0.148568 2
14 425 0.141572 0.003298 0.139241 0.143904 2
15 421 0.140240 0.014604 0.129913 0.150566 2
16 417 0.138907 0.007066 0.133911 0.143904 2
17 414 0.137908 0.003769 0.135243 0.140573 2
18 413 0.137575 0.008009 0.131912 0.143238 2
19 402 0.133911 0.000942 0.133245 0.134577 2
20 396 0.131912 0.015075 0.121252 0.142572 2
21 384 0.127915 0.001884 0.126582 0.129247 2
22 296 0.098601 0.002827 0.096602 0.100600 2
23 294 0.097935 0.005653 0.093937 0.101932 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099877 0.009799 0.000002 0.296623 0.069617 1.000 2
length{all}[2] 0.099675 0.009855 0.000016 0.301081 0.070020 1.000 2
length{all}[3] 0.097342 0.009790 0.000010 0.299413 0.066836 1.001 2
length{all}[4] 0.098521 0.009434 0.000024 0.298564 0.068268 1.001 2
length{all}[5] 0.097420 0.009722 0.000013 0.288062 0.067387 1.000 2
length{all}[6] 0.099853 0.009979 0.000029 0.298893 0.069098 1.000 2
length{all}[7] 0.094189 0.009337 0.000142 0.280168 0.063010 0.999 2
length{all}[8] 0.106685 0.011556 0.000066 0.294552 0.078126 0.998 2
length{all}[9] 0.099024 0.009815 0.000139 0.298479 0.071222 0.998 2
length{all}[10] 0.089753 0.008576 0.000270 0.262202 0.060533 0.999 2
length{all}[11] 0.091178 0.008537 0.000301 0.281686 0.064566 0.999 2
length{all}[12] 0.110106 0.011844 0.000493 0.336675 0.077497 0.998 2
length{all}[13] 0.091084 0.007588 0.000473 0.266603 0.061935 0.998 2
length{all}[14] 0.098048 0.011155 0.000285 0.348032 0.064976 0.998 2
length{all}[15] 0.094868 0.008732 0.000038 0.295476 0.066949 1.007 2
length{all}[16] 0.097500 0.010507 0.000128 0.303569 0.066338 1.001 2
length{all}[17] 0.101065 0.012386 0.000162 0.312848 0.069108 1.006 2
length{all}[18] 0.098007 0.008376 0.000031 0.282283 0.072637 0.999 2
length{all}[19] 0.099285 0.008900 0.000402 0.304840 0.072896 1.000 2
length{all}[20] 0.093571 0.008824 0.000016 0.299684 0.062598 0.998 2
length{all}[21] 0.100840 0.009567 0.000133 0.297393 0.067277 0.999 2
length{all}[22] 0.098145 0.007390 0.000675 0.248667 0.076692 0.998 2
length{all}[23] 0.098006 0.008164 0.000027 0.284004 0.071995 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007260
Maximum standard deviation of split frequencies = 0.015546
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.007
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 288
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 43 patterns at 96 / 96 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 43 patterns at 96 / 96 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
41968 bytes for conP
3784 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.086058 0.038414 0.062070 0.052695 0.030616 0.040036 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -413.128351
Iterating by ming2
Initial: fx= 413.128351
x= 0.08606 0.03841 0.06207 0.05270 0.03062 0.04004 0.30000 1.30000
1 h-m-p 0.0000 0.0003 230.3588 +++ 395.872499 m 0.0003 14 | 1/8
2 h-m-p 0.0020 0.1193 34.2497 ------------.. | 1/8
3 h-m-p 0.0000 0.0001 211.2499 ++ 392.177941 m 0.0001 46 | 2/8
4 h-m-p 0.0005 0.1386 32.3269 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 189.0596 ++ 391.562794 m 0.0000 77 | 3/8
6 h-m-p 0.0003 0.1732 26.1383 ----------.. | 3/8
7 h-m-p 0.0000 0.0001 163.5848 ++ 387.955923 m 0.0001 107 | 4/8
8 h-m-p 0.0009 0.2307 19.8858 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 133.6941 ++ 386.169361 m 0.0001 138 | 5/8
10 h-m-p 0.0007 0.3435 13.7266 -----------.. | 5/8
11 h-m-p 0.0000 0.0003 94.4922 +++ 383.873323 m 0.0003 170 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ++ 383.873323 m 8.0000 181 | 6/8
13 h-m-p 0.2865 8.0000 0.0000 +++ 383.873323 m 8.0000 195 | 6/8
14 h-m-p 0.0160 8.0000 0.0355 ----Y 383.873323 0 0.0000 212 | 6/8
15 h-m-p 0.0160 8.0000 0.0032 +++++ 383.873323 m 8.0000 228 | 6/8
16 h-m-p 0.2992 8.0000 0.0868 --------Y 383.873323 0 0.0000 249 | 6/8
17 h-m-p 0.0160 8.0000 0.0006 ---------Y 383.873323 0 0.0000 271 | 6/8
18 h-m-p 0.0160 8.0000 0.0000 Y 383.873323 0 0.0040 284
Out..
lnL = -383.873323
285 lfun, 285 eigenQcodon, 1710 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.058453 0.104474 0.051768 0.082972 0.022028 0.083224 0.307721 0.867879 0.360196
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.880717
np = 9
lnL0 = -421.035739
Iterating by ming2
Initial: fx= 421.035739
x= 0.05845 0.10447 0.05177 0.08297 0.02203 0.08322 0.30772 0.86788 0.36020
1 h-m-p 0.0000 0.0002 221.7853 +++ 409.118518 m 0.0002 15 | 1/9
2 h-m-p 0.0001 0.0005 219.2688 ++ 395.365998 m 0.0005 27 | 2/9
3 h-m-p 0.0000 0.0000 4159.8100 ++ 392.925002 m 0.0000 39 | 3/9
4 h-m-p 0.0001 0.0009 149.0548 ++ 385.742607 m 0.0009 51 | 4/9
5 h-m-p 0.0000 0.0000 3631.0224 ++ 385.696887 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0001 1339.7194 ++ 384.066987 m 0.0001 75 | 6/9
7 h-m-p 0.0059 0.0295 10.3534 ------------.. | 6/9
8 h-m-p 0.0000 0.0000 93.8927 ++ 383.873303 m 0.0000 109 | 7/9
9 h-m-p 0.1386 8.0000 0.0000 Y 383.873303 0 0.2617 121 | 7/9
10 h-m-p 0.6976 8.0000 0.0000 ++ 383.873303 m 8.0000 135 | 7/9
11 h-m-p 0.0160 8.0000 0.0011 +++++ 383.873303 m 8.0000 152 | 7/9
12 h-m-p 0.3613 8.0000 0.0236 +Y 383.873303 0 1.0076 167 | 7/9
13 h-m-p 1.6000 8.0000 0.0000 -----C 383.873303 0 0.0004 186 | 7/9
14 h-m-p 0.0160 8.0000 0.0000 -Y 383.873303 0 0.0010 201
Out..
lnL = -383.873303
202 lfun, 606 eigenQcodon, 2424 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.011812 0.046195 0.060448 0.029576 0.087757 0.039713 0.313349 1.510237 0.285969 0.258180 1.395557
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.204209
np = 11
lnL0 = -408.920787
Iterating by ming2
Initial: fx= 408.920787
x= 0.01181 0.04619 0.06045 0.02958 0.08776 0.03971 0.31335 1.51024 0.28597 0.25818 1.39556
1 h-m-p 0.0000 0.0001 215.2267 ++ 402.689993 m 0.0001 16 | 1/11
2 h-m-p 0.0003 0.0015 80.7701 ++ 394.463188 m 0.0015 30 | 2/11
3 h-m-p 0.0000 0.0001 409.7495 ++ 391.052994 m 0.0001 44 | 3/11
4 h-m-p 0.0001 0.0003 193.5941 ++ 389.220403 m 0.0003 58 | 4/11
5 h-m-p 0.0000 0.0001 1228.4380 ++ 386.980211 m 0.0001 72 | 5/11
6 h-m-p 0.0013 0.0065 8.3114 -----------.. | 5/11
7 h-m-p 0.0000 0.0000 129.9801 ++ 386.601648 m 0.0000 109 | 6/11
8 h-m-p 0.0009 0.3360 2.2785 -----------.. | 6/11
9 h-m-p 0.0000 0.0003 91.7219 +++ 383.873308 m 0.0003 147 | 7/11
10 h-m-p 1.1166 8.0000 0.0000 ++ 383.873308 m 8.0000 161 | 7/11
11 h-m-p 0.0180 8.0000 0.0040 +++++ 383.873308 m 8.0000 182 | 7/11
12 h-m-p 0.0474 0.7986 0.6740 +++ 383.873305 m 0.7986 201 | 8/11
13 h-m-p 1.6000 8.0000 0.0554 C 383.873305 0 1.7211 219 | 8/11
14 h-m-p 1.6000 8.0000 0.0025 Y 383.873305 0 1.1824 236 | 8/11
15 h-m-p 1.6000 8.0000 0.0000 ++ 383.873305 m 8.0000 253 | 8/11
16 h-m-p 0.0160 8.0000 0.0234 ++++C 383.873305 0 3.5871 274 | 8/11
17 h-m-p 1.6000 8.0000 0.0053 ++ 383.873304 m 8.0000 291 | 8/11
18 h-m-p 0.0752 8.0000 0.5640 -------------N 383.873304 0 0.0000 321 | 8/11
19 h-m-p 0.0078 3.9017 0.1109 +++Y 383.873304 0 0.8845 341 | 8/11
20 h-m-p 1.6000 8.0000 0.0020 Y 383.873304 0 0.7920 358 | 8/11
21 h-m-p 1.6000 8.0000 0.0000 --Y 383.873304 0 0.0250 377 | 8/11
22 h-m-p 0.0160 8.0000 0.0111 +++++ 383.873304 m 8.0000 397 | 8/11
23 h-m-p 0.3755 1.8775 0.1442 Y 383.873304 0 0.8452 414 | 8/11
24 h-m-p 1.6000 8.0000 0.0021 ----------------.. | 8/11
25 h-m-p 0.0160 8.0000 0.0000 +++++ 383.873304 m 8.0000 465 | 8/11
26 h-m-p 0.0160 8.0000 1.0287 ----------C 383.873304 0 0.0000 492 | 8/11
27 h-m-p 0.0160 8.0000 0.0000 +++++ 383.873304 m 8.0000 509 | 8/11
28 h-m-p 0.0160 8.0000 0.7457 +++Y 383.873296 0 1.9562 529 | 8/11
29 h-m-p 1.6000 8.0000 0.2080 Y 383.873296 0 1.1143 546 | 8/11
30 h-m-p 1.6000 8.0000 0.0132 Y 383.873296 0 0.9207 563 | 8/11
31 h-m-p 1.6000 8.0000 0.0001 ++ 383.873296 m 8.0000 580 | 8/11
32 h-m-p 0.0428 8.0000 0.0136 +++Y 383.873296 0 1.9680 600 | 8/11
33 h-m-p 1.6000 8.0000 0.0010 ++ 383.873296 m 8.0000 617 | 8/11
34 h-m-p 0.0022 0.9142 3.7140 ++++C 383.873291 0 0.6037 638 | 8/11
35 h-m-p 1.6000 8.0000 0.6382 +Y 383.873289 0 4.7997 653 | 8/11
36 h-m-p 0.5396 2.6980 1.3053 +Y 383.873288 0 1.3655 671 | 8/11
37 h-m-p 1.3569 8.0000 1.3137 ++ 383.873283 m 8.0000 685 | 8/11
38 h-m-p 0.1987 2.2059 52.8840 --------------N 383.873283 0 0.0000 713 | 8/11
39 h-m-p 0.0160 8.0000 4.5853 +++Y 383.873283 0 0.7213 730 | 8/11
40 h-m-p 1.6000 8.0000 0.1289 C 383.873283 0 1.2886 744 | 8/11
41 h-m-p 1.6000 8.0000 0.0014 C 383.873283 0 0.4000 761 | 8/11
42 h-m-p 0.4928 8.0000 0.0012 ++N 383.873283 0 7.8846 780 | 8/11
43 h-m-p 1.6000 8.0000 0.0006 ++ 383.873283 m 8.0000 797 | 8/11
44 h-m-p 0.1373 8.0000 0.0325 ++C 383.873283 0 2.5157 816 | 8/11
45 h-m-p 1.6000 8.0000 0.0022 ++ 383.873283 m 8.0000 833 | 8/11
46 h-m-p 0.0160 8.0000 5.8405 ++++Y 383.873281 0 3.1746 854 | 8/11
47 h-m-p 1.3741 6.8703 3.3476 ++ 383.873267 m 6.8703 868 | 9/11
48 h-m-p 0.4029 2.8276 57.0832 Y 383.873266 0 0.4029 882 | 9/11
49 h-m-p 0.0613 0.3688 375.3463 Y 383.873266 0 0.0613 896 | 9/11
50 h-m-p 1.2842 6.4211 12.9066 ++ 383.873257 m 6.4211 910 | 9/11
51 h-m-p -0.0000 -0.0000 0.2615
h-m-p: -0.00000000e+00 -0.00000000e+00 2.61521546e-01 383.873257
.. | 9/11
52 h-m-p 0.0160 8.0000 0.0000 Y 383.873257 0 0.0160 937
Out..
lnL = -383.873257
938 lfun, 3752 eigenQcodon, 16884 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -383.888603 S = -383.873565 -0.005761
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 43 patterns 0:06
did 20 / 43 patterns 0:06
did 30 / 43 patterns 0:06
did 40 / 43 patterns 0:06
did 43 / 43 patterns 0:06
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.085534 0.061652 0.095192 0.012700 0.020055 0.028289 0.000100 1.141770 1.129589
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 13.892094
np = 9
lnL0 = -411.785048
Iterating by ming2
Initial: fx= 411.785048
x= 0.08553 0.06165 0.09519 0.01270 0.02006 0.02829 0.00011 1.14177 1.12959
1 h-m-p 0.0000 0.0000 220.6627 ++ 410.915490 m 0.0000 14 | 1/9
2 h-m-p 0.0002 0.0555 21.8388 ----------.. | 1/9
3 h-m-p 0.0000 0.0001 220.9984 ++ 404.954637 m 0.0001 46 | 2/9
4 h-m-p 0.0012 0.0619 19.6596 -----------.. | 2/9
5 h-m-p 0.0000 0.0001 203.4050 ++ 401.623179 m 0.0001 79 | 3/9
6 h-m-p 0.0009 0.0767 16.0796 -----------.. | 3/9
7 h-m-p 0.0000 0.0001 182.5444 ++ 398.624970 m 0.0001 112 | 4/9
8 h-m-p 0.0011 0.0933 13.4045 -----------.. | 4/9
9 h-m-p 0.0000 0.0004 158.4270 +++ 389.352631 m 0.0004 146 | 5/9
10 h-m-p 0.0052 0.1446 9.0284 ------------.. | 5/9
11 h-m-p 0.0000 0.0003 131.6650 +++ 384.806348 m 0.0003 181 | 6/9
12 h-m-p 0.0053 0.3352 4.5335 ------------.. | 6/9
13 h-m-p 0.0000 0.0001 94.1090 ++ 383.873313 m 0.0001 215 | 7/9
14 h-m-p 1.6000 8.0000 0.0000 ++ 383.873313 m 8.0000 227 | 6/9
15 h-m-p 0.1100 8.0000 0.0000 ++++ 383.873313 m 8.0000 243 | 6/9
16 h-m-p 0.0316 8.0000 0.0070 ++++ 383.873313 m 8.0000 260 | 6/9
17 h-m-p 0.0300 0.8127 1.8768 ++Y 383.873312 0 0.4795 277 | 6/9
18 h-m-p 1.6000 8.0000 0.0726 --------C 383.873312 0 0.0000 297 | 6/9
19 h-m-p 0.0424 8.0000 0.0000 --------------.. | 6/9
20 h-m-p 0.0160 8.0000 0.0000 +++++ 383.873312 m 8.0000 342 | 6/9
21 h-m-p 0.0003 0.1524 4.1642 --------C 383.873312 0 0.0000 365 | 6/9
22 h-m-p 0.0160 8.0000 0.0008 +++++ 383.873312 m 8.0000 380 | 6/9
23 h-m-p 0.0046 0.7485 1.4328 ++++ 383.873298 m 0.7485 397 | 7/9
24 h-m-p 0.5910 2.9548 0.4912 +YY 383.873268 1 2.3638 411 | 7/9
25 h-m-p 0.4159 8.0000 2.7918 --------------Y 383.873268 0 0.0000 439 | 7/9
26 h-m-p 0.0160 8.0000 0.0001 +++++ 383.873268 m 8.0000 454 | 7/9
27 h-m-p 0.0004 0.1935 1.8095 ----------.. | 7/9
28 h-m-p 0.0160 8.0000 0.0001 +++++ 383.873268 m 8.0000 491 | 7/9
29 h-m-p 0.0088 2.1536 0.0651 ++++ 383.873257 m 2.1536 507 | 8/9
30 h-m-p 0.2204 8.0000 0.0011 --------N 383.873257 0 0.0000 529 | 8/9
31 h-m-p 0.0160 8.0000 1.8910 ++
QuantileBeta(0.15, 0.00500, 2.20341) = 1.191787e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 8.01267) = 2.740264e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 15.39526) = 1.383082e-161 2000 rounds
+ 383.873257 m 8.0000 545
QuantileBeta(0.15, 0.00500, 15.39526) = 1.383082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.39526) = 1.383082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.39526) = 1.383082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.39526) = 1.383082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.39526) = 1.383082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.39526) = 1.383082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.39526) = 1.383082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.39526) = 1.431365e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.39527) = 1.383081e-161 2000 rounds
| 8/9
32 h-m-p 1.6000 8.0000 0.5758
QuantileBeta(0.15, 0.00500, 14.47393) = 1.474218e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.16493) = 1.404793e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 15.33768) = 1.388447e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 15.38087) = 1.384419e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 15.39167) = 1.383416e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 15.39436) = 1.383166e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 15.39504) = 1.383103e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 15.39521) = 1.383087e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.39524) = 1.383085e-161 2000 rounds
N 383.873257 0 0.0000 563
QuantileBeta(0.15, 0.00500, 15.39524) = 1.383085e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.39524) = 1.383085e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.39524) = 1.383085e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.39524) = 1.383085e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.39524) = 1.383085e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.39524) = 1.383085e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.39524) = 1.383085e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.39524) = 1.431368e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.39560) = 1.383051e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.39487) = 1.383118e-161 2000 rounds
| 8/9
33 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 15.39524) = 1.383085e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.39524) = 1.383085e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 15.39524) = 1.383085e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 15.39524) = 1.383085e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 15.39524) = 1.383085e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 15.39524) = 1.383085e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.39524) = 1.383085e-161 2000 rounds
Y 383.873257 0 0.0016 580
QuantileBeta(0.15, 0.00500, 15.39524) = 1.383085e-161 2000 rounds
Out..
lnL = -383.873257
581 lfun, 6391 eigenQcodon, 34860 P(t)
QuantileBeta(0.15, 0.00500, 15.39524) = 1.383085e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.39524) = 1.383085e-161 2000 rounds
Time used: 0:15
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.066103 0.080446 0.024765 0.013809 0.073997 0.018332 0.000100 0.900000 0.302140 1.719824 1.325003
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 19.087270
np = 11
lnL0 = -408.164056
Iterating by ming2
Initial: fx= 408.164056
x= 0.06610 0.08045 0.02477 0.01381 0.07400 0.01833 0.00011 0.90000 0.30214 1.71982 1.32500
1 h-m-p 0.0000 0.0000 202.5830 ++ 407.944829 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0012 81.8366 ++++ 401.102841 m 0.0012 32 | 2/11
3 h-m-p 0.0000 0.0001 115.1352 ++ 399.020739 m 0.0001 46 | 3/11
4 h-m-p 0.0003 0.0017 43.0964 ++ 397.241080 m 0.0017 60 | 4/11
5 h-m-p 0.0002 0.0012 109.0024 ++ 387.346379 m 0.0012 74 | 5/11
6 h-m-p 0.0002 0.0012 78.1221 ++ 386.104734 m 0.0012 88 | 6/11
7 h-m-p 0.0007 0.0036 8.1713 -----------.. | 6/11
8 h-m-p 0.0000 0.0001 129.4202 ++ 384.978534 m 0.0001 125 | 7/11
9 h-m-p 0.0010 0.0356 6.1293 -----------.. | 7/11
10 h-m-p 0.0000 0.0001 92.4774 ++ 383.873302 m 0.0001 162 | 8/11
11 h-m-p 0.8598 8.0000 0.0000 ++ 383.873302 m 8.0000 176 | 8/11
12 h-m-p 0.0160 8.0000 0.0066 -------------.. | 8/11
13 h-m-p 0.0160 8.0000 0.0001 +++++ 383.873302 m 8.0000 224 | 8/11
14 h-m-p 0.0065 3.2428 0.2440 ---------C 383.873302 0 0.0000 250 | 8/11
15 h-m-p 0.0160 8.0000 0.0011 +++++ 383.873301 m 8.0000 270 | 8/11
16 h-m-p 0.0381 3.4271 0.2376 -------------Y 383.873301 0 0.0000 300 | 8/11
17 h-m-p 0.0160 8.0000 0.0001 +++++ 383.873301 m 8.0000 320 | 8/11
18 h-m-p 0.0024 1.2111 1.4595 ------------.. | 8/11
19 h-m-p 0.0160 8.0000 0.0001 +++++ 383.873301 m 8.0000 364 | 8/11
20 h-m-p 0.0045 2.2598 0.3542 ----------Y 383.873301 0 0.0000 391 | 8/11
21 h-m-p 0.0160 8.0000 0.0008 +++++ 383.873301 m 8.0000 411 | 8/11
22 h-m-p 0.0214 3.1622 0.2877 -----------N 383.873301 0 0.0000 439 | 8/11
23 h-m-p 0.0160 8.0000 0.0001 +++++ 383.873300 m 8.0000 459 | 8/11
24 h-m-p 0.0064 3.2038 0.2869 ------------.. | 8/11
25 h-m-p 0.0160 8.0000 0.0001 +++++ 383.873300 m 8.0000 506 | 8/11
26 h-m-p 0.0069 3.4264 0.2357 ------------Y 383.873300 0 0.0000 535 | 8/11
27 h-m-p 0.0160 8.0000 0.0002 +++++ 383.873300 m 8.0000 555 | 8/11
28 h-m-p 0.0081 3.9327 0.2370 ----------C 383.873300 0 0.0000 582 | 8/11
29 h-m-p 0.0160 8.0000 0.0001 +++++ 383.873300 m 8.0000 602 | 8/11
30 h-m-p 0.0077 3.8613 0.2854 ------------N 383.873300 0 0.0000 631 | 8/11
31 h-m-p 0.0160 8.0000 0.0001 +++++ 383.873300 m 8.0000 651 | 8/11
32 h-m-p 0.0079 3.9260 0.2477 ----------Y 383.873300 0 0.0000 678 | 8/11
33 h-m-p 0.0160 8.0000 0.0001 +++++ 383.873300 m 8.0000 698 | 8/11
34 h-m-p 0.0078 3.9003 0.2340 ----------Y 383.873300 0 0.0000 725 | 8/11
35 h-m-p 0.0160 8.0000 0.0001 +++++ 383.873300 m 8.0000 745 | 8/11
36 h-m-p 0.0077 3.8410 0.2304 ----------Y 383.873300 0 0.0000 772 | 8/11
37 h-m-p 0.0160 8.0000 0.0001 +++++ 383.873300 m 8.0000 792 | 8/11
38 h-m-p 0.0077 3.8435 0.2269 -----------C 383.873300 0 0.0000 820 | 8/11
39 h-m-p 0.0160 8.0000 0.0000 -------Y 383.873300 0 0.0000 844 | 8/11
40 h-m-p 0.0160 8.0000 0.0001 +++++ 383.873300 m 8.0000 864 | 8/11
41 h-m-p 0.0079 3.9582 0.4698 ----------Y 383.873300 0 0.0000 891 | 8/11
42 h-m-p 0.0160 8.0000 0.0005 +++++ 383.873300 m 8.0000 911 | 8/11
43 h-m-p 0.0085 3.9750 0.4725 ------------C 383.873300 0 0.0000 940 | 8/11
44 h-m-p 0.0160 8.0000 0.0000 +++++ 383.873300 m 8.0000 960 | 8/11
45 h-m-p 0.0077 3.8402 0.4777 ----------N 383.873300 0 0.0000 987 | 8/11
46 h-m-p 0.0160 8.0000 0.0000 ----N 383.873300 0 0.0000 1008 | 8/11
47 h-m-p 0.0160 8.0000 0.0001 -------------.. | 8/11
48 h-m-p 0.0160 8.0000 0.0001 +++++ 383.873299 m 8.0000 1056 | 8/11
49 h-m-p 0.0071 3.5274 0.2309 ---------Y 383.873299 0 0.0000 1082 | 8/11
50 h-m-p 0.0160 8.0000 0.0003 +++++ 383.873299 m 8.0000 1102 | 8/11
51 h-m-p 0.0067 3.2163 0.3245 ----------N 383.873299 0 0.0000 1129 | 8/11
52 h-m-p 0.0001 0.0606 4.0574 +++++ 383.873257 m 0.0606 1149 | 9/11
53 h-m-p 1.6000 8.0000 0.0001 --Y 383.873257 0 0.0250 1165 | 9/11
54 h-m-p 1.6000 8.0000 0.0000 N 383.873257 0 1.6000 1181 | 9/11
55 h-m-p 0.3652 8.0000 0.0000 Y 383.873257 0 0.3652 1197 | 9/11
56 h-m-p 0.2123 8.0000 0.0000 -----------Y 383.873257 0 0.0000 1224
Out..
lnL = -383.873257
1225 lfun, 14700 eigenQcodon, 80850 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -383.893181 S = -383.873565 -0.008626
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 43 patterns 0:35
did 20 / 43 patterns 0:36
did 30 / 43 patterns 0:36
did 40 / 43 patterns 0:36
did 43 / 43 patterns 0:36
Time used: 0:36
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=96
NC_011896_1_WP_010908957_1_2741_MLBR_RS13035 LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
NC_002677_1_NP_302638_1_1510_ML2562 LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
NZ_LVXE01000019_1_WP_010908957_1_715_A3216_RS07000 LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
NZ_LYPH01000024_1_WP_010908957_1_998_A8144_RS04760 LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
NZ_CP029543_1_WP_010908957_1_2769_DIJ64_RS14100 LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
NZ_AP014567_1_WP_010908957_1_2838_JK2ML_RS14445 LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
**************************************************
NC_011896_1_WP_010908957_1_2741_MLBR_RS13035 EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
NC_002677_1_NP_302638_1_1510_ML2562 EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
NZ_LVXE01000019_1_WP_010908957_1_715_A3216_RS07000 EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
NZ_LYPH01000024_1_WP_010908957_1_998_A8144_RS04760 EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
NZ_CP029543_1_WP_010908957_1_2769_DIJ64_RS14100 EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
NZ_AP014567_1_WP_010908957_1_2838_JK2ML_RS14445 EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
**********************************************
>NC_011896_1_WP_010908957_1_2741_MLBR_RS13035 TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG >NC_002677_1_NP_302638_1_1510_ML2562 TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG >NZ_LVXE01000019_1_WP_010908957_1_715_A3216_RS07000 TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG >NZ_LYPH01000024_1_WP_010908957_1_998_A8144_RS04760 TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG >NZ_CP029543_1_WP_010908957_1_2769_DIJ64_RS14100 TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG >NZ_AP014567_1_WP_010908957_1_2838_JK2ML_RS14445 TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG
>NC_011896_1_WP_010908957_1_2741_MLBR_RS13035 LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW >NC_002677_1_NP_302638_1_1510_ML2562 LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW >NZ_LVXE01000019_1_WP_010908957_1_715_A3216_RS07000 LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW >NZ_LYPH01000024_1_WP_010908957_1_998_A8144_RS04760 LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW >NZ_CP029543_1_WP_010908957_1_2769_DIJ64_RS14100 LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW >NZ_AP014567_1_WP_010908957_1_2838_JK2ML_RS14445 LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
#NEXUS
[ID: 5759559504]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908957_1_2741_MLBR_RS13035
NC_002677_1_NP_302638_1_1510_ML2562
NZ_LVXE01000019_1_WP_010908957_1_715_A3216_RS07000
NZ_LYPH01000024_1_WP_010908957_1_998_A8144_RS04760
NZ_CP029543_1_WP_010908957_1_2769_DIJ64_RS14100
NZ_AP014567_1_WP_010908957_1_2838_JK2ML_RS14445
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908957_1_2741_MLBR_RS13035,
2 NC_002677_1_NP_302638_1_1510_ML2562,
3 NZ_LVXE01000019_1_WP_010908957_1_715_A3216_RS07000,
4 NZ_LYPH01000024_1_WP_010908957_1_998_A8144_RS04760,
5 NZ_CP029543_1_WP_010908957_1_2769_DIJ64_RS14100,
6 NZ_AP014567_1_WP_010908957_1_2838_JK2ML_RS14445
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06961736,2:0.07002033,3:0.06683629,4:0.06826817,5:0.06738658,6:0.06909829);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06961736,2:0.07002033,3:0.06683629,4:0.06826817,5:0.06738658,6:0.06909829);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -390.23 -393.72
2 -390.21 -394.36
--------------------------------------
TOTAL -390.22 -394.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.887198 0.085958 0.350301 1.470841 0.859625 1493.65 1497.32 1.000
r(A<->C){all} 0.168950 0.020220 0.000030 0.455639 0.130728 253.77 368.49 1.002
r(A<->G){all} 0.165996 0.019209 0.000103 0.444065 0.131829 253.37 286.19 1.000
r(A<->T){all} 0.168380 0.018865 0.000263 0.442971 0.137501 212.19 318.26 1.000
r(C<->G){all} 0.164096 0.020469 0.000149 0.450937 0.122861 279.80 371.01 1.004
r(C<->T){all} 0.159689 0.018492 0.000005 0.432721 0.125397 180.77 226.66 1.001
r(G<->T){all} 0.172889 0.019064 0.000128 0.443622 0.141696 172.29 277.40 1.004
pi(A){all} 0.191937 0.000521 0.148532 0.236752 0.191364 1393.12 1404.61 1.001
pi(C){all} 0.291382 0.000699 0.237026 0.341496 0.290600 1150.93 1292.22 1.000
pi(G){all} 0.338678 0.000782 0.284179 0.392478 0.338526 1262.61 1378.24 1.000
pi(T){all} 0.178003 0.000490 0.135590 0.219906 0.177568 1244.78 1372.89 1.000
alpha{1,2} 0.395936 0.209523 0.000113 1.342600 0.230272 1111.53 1161.94 1.001
alpha{3} 0.469960 0.246913 0.000111 1.462212 0.310389 1290.66 1330.53 1.000
pinvar{all} 0.994220 0.000049 0.980838 0.999998 0.996544 1385.80 1417.96 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2562/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 96
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 1 1 1 1 1 1 | TCC 0 0 0 0 0 0 | TAC 0 0 0 0 0 0 | TGC 3 3 3 3 3 3
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 2 2 2 2 2 2 | His CAT 1 1 1 1 1 1 | Arg CGT 0 0 0 0 0 0
CTC 1 1 1 1 1 1 | CCC 0 0 0 0 0 0 | CAC 1 1 1 1 1 1 | CGC 0 0 0 0 0 0
CTA 1 1 1 1 1 1 | CCA 4 4 4 4 4 4 | Gln CAA 2 2 2 2 2 2 | CGA 3 3 3 3 3 3
CTG 1 1 1 1 1 1 | CCG 1 1 1 1 1 1 | CAG 7 7 7 7 7 7 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 1 1 1 1 1 1 | Asn AAT 0 0 0 0 0 0 | Ser AGT 1 1 1 1 1 1
ATC 4 4 4 4 4 4 | ACC 2 2 2 2 2 2 | AAC 0 0 0 0 0 0 | AGC 2 2 2 2 2 2
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 1 1 1 1 1 1 | ACG 0 0 0 0 0 0 | AAG 1 1 1 1 1 1 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 6 6 6 6 6 6 | Asp GAT 2 2 2 2 2 2 | Gly GGT 2 2 2 2 2 2
GTC 1 1 1 1 1 1 | GCC 8 8 8 8 8 8 | GAC 0 0 0 0 0 0 | GGC 4 4 4 4 4 4
GTA 0 0 0 0 0 0 | GCA 0 0 0 0 0 0 | Glu GAA 2 2 2 2 2 2 | GGA 2 2 2 2 2 2
GTG 1 1 1 1 1 1 | GCG 4 4 4 4 4 4 | GAG 3 3 3 3 3 3 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908957_1_2741_MLBR_RS13035
position 1: T:0.15625 C:0.27083 A:0.16667 G:0.40625
position 2: T:0.18750 C:0.32292 A:0.21875 G:0.27083
position 3: T:0.18750 C:0.28125 A:0.18750 G:0.34375
Average T:0.17708 C:0.29167 A:0.19097 G:0.34028
#2: NC_002677_1_NP_302638_1_1510_ML2562
position 1: T:0.15625 C:0.27083 A:0.16667 G:0.40625
position 2: T:0.18750 C:0.32292 A:0.21875 G:0.27083
position 3: T:0.18750 C:0.28125 A:0.18750 G:0.34375
Average T:0.17708 C:0.29167 A:0.19097 G:0.34028
#3: NZ_LVXE01000019_1_WP_010908957_1_715_A3216_RS07000
position 1: T:0.15625 C:0.27083 A:0.16667 G:0.40625
position 2: T:0.18750 C:0.32292 A:0.21875 G:0.27083
position 3: T:0.18750 C:0.28125 A:0.18750 G:0.34375
Average T:0.17708 C:0.29167 A:0.19097 G:0.34028
#4: NZ_LYPH01000024_1_WP_010908957_1_998_A8144_RS04760
position 1: T:0.15625 C:0.27083 A:0.16667 G:0.40625
position 2: T:0.18750 C:0.32292 A:0.21875 G:0.27083
position 3: T:0.18750 C:0.28125 A:0.18750 G:0.34375
Average T:0.17708 C:0.29167 A:0.19097 G:0.34028
#5: NZ_CP029543_1_WP_010908957_1_2769_DIJ64_RS14100
position 1: T:0.15625 C:0.27083 A:0.16667 G:0.40625
position 2: T:0.18750 C:0.32292 A:0.21875 G:0.27083
position 3: T:0.18750 C:0.28125 A:0.18750 G:0.34375
Average T:0.17708 C:0.29167 A:0.19097 G:0.34028
#6: NZ_AP014567_1_WP_010908957_1_2838_JK2ML_RS14445
position 1: T:0.15625 C:0.27083 A:0.16667 G:0.40625
position 2: T:0.18750 C:0.32292 A:0.21875 G:0.27083
position 3: T:0.18750 C:0.28125 A:0.18750 G:0.34375
Average T:0.17708 C:0.29167 A:0.19097 G:0.34028
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 6 | TCC 0 | TAC 0 | TGC 18
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 12 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 12 | His H CAT 6 | Arg R CGT 0
CTC 6 | CCC 0 | CAC 6 | CGC 0
CTA 6 | CCA 24 | Gln Q CAA 12 | CGA 18
CTG 6 | CCG 6 | CAG 42 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 6 | Asn N AAT 0 | Ser S AGT 6
ATC 24 | ACC 12 | AAC 0 | AGC 12
ATA 6 | ACA 6 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 6 | ACG 0 | AAG 6 | AGG 6
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 36 | Asp D GAT 12 | Gly G GGT 12
GTC 6 | GCC 48 | GAC 0 | GGC 24
GTA 0 | GCA 0 | Glu E GAA 12 | GGA 12
GTG 6 | GCG 24 | GAG 18 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15625 C:0.27083 A:0.16667 G:0.40625
position 2: T:0.18750 C:0.32292 A:0.21875 G:0.27083
position 3: T:0.18750 C:0.28125 A:0.18750 G:0.34375
Average T:0.17708 C:0.29167 A:0.19097 G:0.34028
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -383.873323 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.307721 1.325003
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908957_1_2741_MLBR_RS13035: 0.000004, NC_002677_1_NP_302638_1_1510_ML2562: 0.000004, NZ_LVXE01000019_1_WP_010908957_1_715_A3216_RS07000: 0.000004, NZ_LYPH01000024_1_WP_010908957_1_998_A8144_RS04760: 0.000004, NZ_CP029543_1_WP_010908957_1_2769_DIJ64_RS14100: 0.000004, NZ_AP014567_1_WP_010908957_1_2838_JK2ML_RS14445: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30772
omega (dN/dS) = 1.32500
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 206.5 81.5 1.3250 0.0000 0.0000 0.0 0.0
7..2 0.000 206.5 81.5 1.3250 0.0000 0.0000 0.0 0.0
7..3 0.000 206.5 81.5 1.3250 0.0000 0.0000 0.0 0.0
7..4 0.000 206.5 81.5 1.3250 0.0000 0.0000 0.0 0.0
7..5 0.000 206.5 81.5 1.3250 0.0000 0.0000 0.0 0.0
7..6 0.000 206.5 81.5 1.3250 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -383.873303 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.313349 0.706338 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908957_1_2741_MLBR_RS13035: 0.000004, NC_002677_1_NP_302638_1_1510_ML2562: 0.000004, NZ_LVXE01000019_1_WP_010908957_1_715_A3216_RS07000: 0.000004, NZ_LYPH01000024_1_WP_010908957_1_998_A8144_RS04760: 0.000004, NZ_CP029543_1_WP_010908957_1_2769_DIJ64_RS14100: 0.000004, NZ_AP014567_1_WP_010908957_1_2838_JK2ML_RS14445: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.31335
MLEs of dN/dS (w) for site classes (K=2)
p: 0.70634 0.29366
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 206.5 81.5 0.2937 0.0000 0.0000 0.0 0.0
7..2 0.000 206.5 81.5 0.2937 0.0000 0.0000 0.0 0.0
7..3 0.000 206.5 81.5 0.2937 0.0000 0.0000 0.0 0.0
7..4 0.000 206.5 81.5 0.2937 0.0000 0.0000 0.0 0.0
7..5 0.000 206.5 81.5 0.2937 0.0000 0.0000 0.0 0.0
7..6 0.000 206.5 81.5 0.2937 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -383.873257 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999960 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908957_1_2741_MLBR_RS13035: 0.000004, NC_002677_1_NP_302638_1_1510_ML2562: 0.000004, NZ_LVXE01000019_1_WP_010908957_1_715_A3216_RS07000: 0.000004, NZ_LYPH01000024_1_WP_010908957_1_998_A8144_RS04760: 0.000004, NZ_CP029543_1_WP_010908957_1_2769_DIJ64_RS14100: 0.000004, NZ_AP014567_1_WP_010908957_1_2838_JK2ML_RS14445: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.99996 0.00000 0.00004
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 209.5 78.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 209.5 78.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 209.5 78.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 209.5 78.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 209.5 78.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 209.5 78.5 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908957_1_2741_MLBR_RS13035)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:06
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -383.873257 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 15.395236
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908957_1_2741_MLBR_RS13035: 0.000004, NC_002677_1_NP_302638_1_1510_ML2562: 0.000004, NZ_LVXE01000019_1_WP_010908957_1_715_A3216_RS07000: 0.000004, NZ_LYPH01000024_1_WP_010908957_1_998_A8144_RS04760: 0.000004, NZ_CP029543_1_WP_010908957_1_2769_DIJ64_RS14100: 0.000004, NZ_AP014567_1_WP_010908957_1_2838_JK2ML_RS14445: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 15.39524
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 209.5 78.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 209.5 78.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 209.5 78.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 209.5 78.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 209.5 78.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 209.5 78.5 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:15
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -383.873257 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.690426 1.329835
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908957_1_2741_MLBR_RS13035: 0.000004, NC_002677_1_NP_302638_1_1510_ML2562: 0.000004, NZ_LVXE01000019_1_WP_010908957_1_715_A3216_RS07000: 0.000004, NZ_LYPH01000024_1_WP_010908957_1_998_A8144_RS04760: 0.000004, NZ_CP029543_1_WP_010908957_1_2769_DIJ64_RS14100: 0.000004, NZ_AP014567_1_WP_010908957_1_2838_JK2ML_RS14445: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.69043
(p1 = 0.00001) w = 1.32984
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.32984
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 209.5 78.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 209.5 78.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 209.5 78.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 209.5 78.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 209.5 78.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 209.5 78.5 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908957_1_2741_MLBR_RS13035)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.098 0.099 0.099 0.099 0.100 0.100 0.101 0.101 0.101 0.102
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Time used: 0:36
Model 1: NearlyNeutral -383.873303 Model 2: PositiveSelection -383.873257 Model 0: one-ratio -383.873323 Model 7: beta -383.873257 Model 8: beta&w>1 -383.873257 Model 0 vs 1 4.0000000012696546E-5 Model 2 vs 1 9.1999999995096E-5 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
