--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:35:43 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2562/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -390.23          -393.72
2       -390.21          -394.36
--------------------------------------
TOTAL     -390.22          -394.09
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.887198    0.085958    0.350301    1.470841    0.859625   1493.65   1497.32    1.000
r(A<->C){all}   0.168950    0.020220    0.000030    0.455639    0.130728    253.77    368.49    1.002
r(A<->G){all}   0.165996    0.019209    0.000103    0.444065    0.131829    253.37    286.19    1.000
r(A<->T){all}   0.168380    0.018865    0.000263    0.442971    0.137501    212.19    318.26    1.000
r(C<->G){all}   0.164096    0.020469    0.000149    0.450937    0.122861    279.80    371.01    1.004
r(C<->T){all}   0.159689    0.018492    0.000005    0.432721    0.125397    180.77    226.66    1.001
r(G<->T){all}   0.172889    0.019064    0.000128    0.443622    0.141696    172.29    277.40    1.004
pi(A){all}      0.191937    0.000521    0.148532    0.236752    0.191364   1393.12   1404.61    1.001
pi(C){all}      0.291382    0.000699    0.237026    0.341496    0.290600   1150.93   1292.22    1.000
pi(G){all}      0.338678    0.000782    0.284179    0.392478    0.338526   1262.61   1378.24    1.000
pi(T){all}      0.178003    0.000490    0.135590    0.219906    0.177568   1244.78   1372.89    1.000
alpha{1,2}      0.395936    0.209523    0.000113    1.342600    0.230272   1111.53   1161.94    1.001
alpha{3}        0.469960    0.246913    0.000111    1.462212    0.310389   1290.66   1330.53    1.000
pinvar{all}     0.994220    0.000049    0.980838    0.999998    0.996544   1385.80   1417.96    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-383.873303
Model 2: PositiveSelection	-383.873257
Model 0: one-ratio	-383.873323
Model 7: beta	-383.873257
Model 8: beta&w>1	-383.873257


Model 0 vs 1	4.0000000012696546E-5

Model 2 vs 1	9.1999999995096E-5

Model 8 vs 7	0.0
>C1
LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
>C2
LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
>C3
LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
>C4
LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
>C5
LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
>C6
LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=96 

C1              LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
C2              LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
C3              LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
C4              LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
C5              LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
C6              LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
                **************************************************

C1              EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
C2              EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
C3              EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
C4              EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
C5              EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
C6              EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
                **********************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   96 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   96 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2880]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [2880]--->[2880]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.453 Mb, Max= 30.620 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
C2              LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
C3              LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
C4              LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
C5              LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
C6              LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
                **************************************************

C1              EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
C2              EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
C3              EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
C4              EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
C5              EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
C6              EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
                **********************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG
C2              TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG
C3              TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG
C4              TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG
C5              TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG
C6              TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG
                **************************************************

C1              CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC
C2              CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC
C3              CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC
C4              CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC
C5              CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC
C6              CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC
                **************************************************

C1              CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC
C2              CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC
C3              CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC
C4              CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC
C5              CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC
C6              CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC
                **************************************************

C1              GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG
C2              GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG
C3              GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG
C4              GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG
C5              GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG
C6              GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG
                **************************************************

C1              CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC
C2              CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC
C3              CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC
C4              CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC
C5              CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC
C6              CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC
                **************************************************

C1              CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG
C2              CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG
C3              CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG
C4              CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG
C5              CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG
C6              CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG
                **************************************



>C1
TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG
CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC
CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC
GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG
CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC
CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG
>C2
TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG
CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC
CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC
GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG
CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC
CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG
>C3
TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG
CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC
CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC
GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG
CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC
CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG
>C4
TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG
CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC
CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC
GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG
CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC
CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG
>C5
TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG
CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC
CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC
GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG
CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC
CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG
>C6
TTGGGGTTCTCGAGCACAGCTGCGGCGGTGTTGGGTGCCGCCGAGCCATG
CGCGCCAGAAGGTCATCGGATCGAGGGCAAACGACACGCGCTGCCGTGGC
CAGCTGATCGAATCCAGCGGCAGCAGCAAGCCTGCCAGCTAAGCATCCTC
GAACAGGCCGCCTTACAGTGGACCACTGTTGCCACCGGGGCTGCCGTTGG
CATAGGACAATTGGCCAGTGGCCCTGCTGAGAGGGCTGATCCATGCCGAC
CTAAGATCTGGGCTCAGGTCGGCATGGGATCGTATTGG
>C1
LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
>C2
LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
>C3
LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
>C4
LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
>C5
LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW
>C6
LGFSSTAAAVLGAAEPCAPEGHRIEGKRHALPWPADRIQRQQQACQLSIL
EQAALQWTTVATGAAVGIGQLASGPAERADPCRPKIWAQVGMGSYW


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 288 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579858440
      Setting output file names to "/data/9res/ML2562/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 171295077
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5759559504
      Seed = 1770209811
      Swapseed = 1579858440
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -644.557807 -- -24.965149
         Chain 2 -- -644.557807 -- -24.965149
         Chain 3 -- -644.557807 -- -24.965149
         Chain 4 -- -644.557807 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -644.557807 -- -24.965149
         Chain 2 -- -644.557807 -- -24.965149
         Chain 3 -- -644.557807 -- -24.965149
         Chain 4 -- -644.557807 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-644.558] (-644.558) (-644.558) (-644.558) * [-644.558] (-644.558) (-644.558) (-644.558) 
        500 -- (-406.856) (-402.007) (-404.974) [-404.982] * (-402.356) [-399.688] (-401.450) (-414.381) -- 0:00:00
       1000 -- [-402.226] (-399.970) (-402.807) (-404.260) * (-397.258) (-400.653) (-401.786) [-399.682] -- 0:00:00
       1500 -- [-395.825] (-400.727) (-409.600) (-397.924) * (-397.670) [-395.251] (-402.329) (-393.619) -- 0:00:00
       2000 -- [-398.209] (-400.276) (-400.581) (-399.211) * (-395.355) (-399.660) [-399.151] (-401.075) -- 0:00:00
       2500 -- (-393.428) (-406.853) [-396.784] (-400.756) * (-397.459) [-406.148] (-401.871) (-400.689) -- 0:00:00
       3000 -- (-396.717) (-398.193) [-396.960] (-395.700) * (-400.440) [-402.787] (-400.406) (-405.321) -- 0:00:00
       3500 -- [-397.343] (-401.524) (-397.886) (-394.516) * [-408.936] (-399.514) (-397.797) (-402.298) -- 0:00:00
       4000 -- (-407.553) (-402.532) (-401.293) [-399.213] * [-396.032] (-399.064) (-401.529) (-401.225) -- 0:00:00
       4500 -- (-404.301) [-396.877] (-412.714) (-403.017) * (-399.953) (-414.820) (-403.911) [-399.377] -- 0:00:00
       5000 -- (-395.690) [-397.460] (-402.750) (-402.922) * (-411.509) (-399.433) [-393.665] (-399.489) -- 0:00:00

      Average standard deviation of split frequencies: 0.071425

       5500 -- (-401.860) [-400.027] (-399.280) (-396.566) * [-396.336] (-399.122) (-404.998) (-410.361) -- 0:00:00
       6000 -- (-397.225) (-405.613) [-389.518] (-399.791) * (-405.563) (-410.240) [-399.168] (-404.681) -- 0:00:00
       6500 -- (-403.333) [-403.760] (-392.566) (-413.909) * [-399.426] (-392.991) (-406.503) (-399.721) -- 0:00:00
       7000 -- (-399.119) (-401.926) (-390.051) [-397.342] * (-404.735) (-389.984) (-396.362) [-404.990] -- 0:00:00
       7500 -- (-395.981) (-412.207) [-392.989] (-395.388) * [-400.046] (-396.732) (-404.356) (-393.904) -- 0:00:00
       8000 -- (-396.176) (-391.923) [-389.629] (-404.428) * (-402.253) [-392.309] (-402.570) (-400.708) -- 0:00:00
       8500 -- (-402.877) [-389.194] (-390.617) (-408.072) * [-401.362] (-392.825) (-408.923) (-398.974) -- 0:00:00
       9000 -- (-394.705) (-390.343) [-388.876] (-403.366) * [-390.647] (-391.519) (-401.718) (-396.240) -- 0:00:00
       9500 -- (-404.834) (-389.898) [-390.575] (-396.311) * (-392.102) (-393.839) [-401.643] (-401.917) -- 0:00:00
      10000 -- (-402.554) (-391.627) [-392.911] (-393.267) * (-390.612) (-391.612) [-397.593] (-394.593) -- 0:00:00

      Average standard deviation of split frequencies: 0.077340

      10500 -- (-397.241) (-395.750) [-391.368] (-391.396) * (-389.861) [-390.972] (-394.775) (-410.840) -- 0:00:00
      11000 -- (-398.326) [-389.822] (-393.749) (-391.655) * (-390.390) (-390.027) [-399.476] (-396.996) -- 0:00:00
      11500 -- (-396.370) (-389.004) [-395.237] (-391.127) * (-392.801) (-390.223) (-395.337) [-395.122] -- 0:00:00
      12000 -- (-405.536) (-389.264) (-392.185) [-389.371] * (-392.079) [-390.306] (-396.038) (-402.425) -- 0:00:00
      12500 -- (-400.832) (-392.012) (-393.233) [-390.948] * (-390.457) [-389.589] (-401.829) (-401.899) -- 0:00:00
      13000 -- (-398.810) (-392.977) [-392.390] (-389.809) * [-390.072] (-390.050) (-394.102) (-403.422) -- 0:01:15
      13500 -- [-400.088] (-392.614) (-393.267) (-389.129) * (-389.632) (-390.346) [-395.888] (-400.338) -- 0:01:13
      14000 -- (-400.938) (-394.553) [-392.036] (-389.810) * (-391.251) [-390.555] (-402.201) (-402.757) -- 0:01:10
      14500 -- (-403.728) [-392.994] (-389.065) (-389.090) * (-392.222) (-389.484) (-391.108) [-398.321] -- 0:01:07
      15000 -- [-398.584] (-392.832) (-391.815) (-389.569) * (-390.458) (-393.206) (-390.269) [-398.115] -- 0:01:05

      Average standard deviation of split frequencies: 0.056120

      15500 -- (-399.232) [-393.170] (-390.149) (-390.201) * (-390.740) (-392.704) [-389.860] (-407.662) -- 0:01:03
      16000 -- (-403.588) (-392.105) (-389.224) [-393.619] * [-391.849] (-392.255) (-392.822) (-410.856) -- 0:01:01
      16500 -- [-400.200] (-389.972) (-391.772) (-389.833) * (-389.056) (-389.654) [-390.188] (-399.755) -- 0:00:59
      17000 -- [-397.943] (-390.049) (-390.011) (-391.659) * (-388.577) (-390.464) (-393.807) [-395.832] -- 0:00:57
      17500 -- (-397.977) (-391.637) (-391.295) [-390.323] * [-389.199] (-391.276) (-395.962) (-399.354) -- 0:00:56
      18000 -- (-396.854) (-391.400) (-389.491) [-393.747] * [-390.708] (-391.054) (-391.414) (-402.067) -- 0:00:54
      18500 -- [-399.231] (-397.612) (-391.302) (-391.125) * (-390.635) [-389.606] (-389.243) (-392.273) -- 0:00:53
      19000 -- (-410.617) [-389.739] (-390.316) (-389.761) * (-392.977) (-393.648) [-389.887] (-390.654) -- 0:00:51
      19500 -- [-395.813] (-391.195) (-389.858) (-394.485) * (-393.562) (-393.906) [-390.498] (-391.106) -- 0:00:50
      20000 -- [-399.105] (-391.270) (-390.176) (-389.765) * (-401.565) [-389.567] (-391.296) (-390.475) -- 0:00:49

      Average standard deviation of split frequencies: 0.044479

      20500 -- (-394.774) (-389.200) (-391.763) [-390.514] * (-396.261) [-391.150] (-394.672) (-396.083) -- 0:00:47
      21000 -- (-403.864) (-390.612) (-390.030) [-391.935] * [-393.226] (-389.249) (-396.277) (-389.078) -- 0:00:46
      21500 -- (-400.555) (-390.788) (-391.405) [-392.384] * (-390.805) [-389.905] (-395.509) (-389.785) -- 0:00:45
      22000 -- (-400.420) (-391.842) (-392.142) [-391.449] * (-391.845) [-391.130] (-391.502) (-391.064) -- 0:00:44
      22500 -- (-410.984) [-389.818] (-398.507) (-390.431) * (-389.222) [-393.083] (-392.292) (-389.905) -- 0:00:43
      23000 -- (-400.999) (-392.131) (-390.915) [-389.214] * (-391.173) [-389.717] (-390.528) (-390.265) -- 0:00:42
      23500 -- (-402.574) [-394.761] (-389.935) (-389.772) * (-395.955) [-389.901] (-390.541) (-390.138) -- 0:00:41
      24000 -- (-409.862) (-389.510) [-391.162] (-389.736) * (-391.129) (-390.098) (-391.828) [-392.587] -- 0:00:40
      24500 -- (-396.212) (-390.050) [-390.194] (-393.432) * (-389.828) [-389.091] (-390.821) (-390.838) -- 0:00:39
      25000 -- [-397.801] (-391.034) (-391.553) (-390.199) * (-391.833) [-390.506] (-391.777) (-392.190) -- 0:00:39

      Average standard deviation of split frequencies: 0.039558

      25500 -- [-403.461] (-389.867) (-396.068) (-390.907) * [-390.360] (-393.072) (-390.650) (-390.059) -- 0:00:38
      26000 -- [-393.440] (-391.479) (-390.714) (-391.796) * (-391.205) (-392.916) [-391.204] (-391.855) -- 0:00:37
      26500 -- [-401.628] (-390.384) (-390.807) (-390.488) * [-389.664] (-390.398) (-392.602) (-393.081) -- 0:00:36
      27000 -- (-396.329) [-389.157] (-391.583) (-393.765) * (-390.706) (-391.851) (-393.334) [-389.670] -- 0:01:12
      27500 -- [-399.225] (-390.006) (-390.819) (-392.645) * (-389.794) [-397.383] (-395.695) (-390.577) -- 0:01:10
      28000 -- [-396.979] (-389.834) (-390.839) (-390.291) * (-390.100) [-390.773] (-390.589) (-392.697) -- 0:01:09
      28500 -- (-402.081) (-389.164) (-392.841) [-391.605] * (-389.741) [-391.751] (-391.427) (-390.463) -- 0:01:08
      29000 -- (-411.114) [-391.779] (-389.458) (-389.686) * [-392.213] (-393.075) (-390.129) (-389.184) -- 0:01:06
      29500 -- (-399.475) [-390.141] (-390.293) (-389.799) * (-393.982) (-390.841) [-390.116] (-390.104) -- 0:01:05
      30000 -- (-407.368) [-394.374] (-391.723) (-389.878) * (-396.604) (-395.171) [-390.315] (-389.179) -- 0:01:04

      Average standard deviation of split frequencies: 0.040992

      30500 -- (-401.420) [-392.256] (-392.564) (-390.953) * (-389.602) [-394.651] (-390.688) (-391.493) -- 0:01:03
      31000 -- (-409.823) [-389.480] (-392.268) (-395.135) * (-391.995) (-391.792) (-390.518) [-394.531] -- 0:01:02
      31500 -- (-415.628) [-390.199] (-390.225) (-389.405) * (-394.695) (-389.753) [-392.245] (-392.759) -- 0:01:01
      32000 -- (-390.931) (-390.448) (-391.766) [-390.681] * (-390.960) [-391.450] (-391.973) (-389.989) -- 0:01:00
      32500 -- [-390.251] (-389.170) (-389.671) (-393.947) * (-391.521) (-392.233) (-392.048) [-390.556] -- 0:00:59
      33000 -- (-390.132) (-388.876) [-390.003] (-392.692) * (-392.047) (-392.694) [-392.992] (-393.965) -- 0:00:58
      33500 -- [-390.152] (-398.830) (-390.367) (-390.736) * (-393.510) (-393.562) [-392.714] (-396.820) -- 0:00:57
      34000 -- (-393.427) (-391.447) [-393.133] (-392.529) * (-392.825) (-393.137) (-391.117) [-393.822] -- 0:00:56
      34500 -- (-389.987) (-389.927) [-389.736] (-389.647) * (-392.447) (-395.197) (-391.600) [-394.268] -- 0:00:55
      35000 -- (-389.888) (-390.736) (-392.409) [-389.594] * (-390.375) (-393.353) [-394.405] (-391.151) -- 0:00:55

      Average standard deviation of split frequencies: 0.036374

      35500 -- (-393.148) (-389.565) (-390.973) [-389.259] * [-390.631] (-395.421) (-390.458) (-395.563) -- 0:00:54
      36000 -- [-393.582] (-393.425) (-391.355) (-389.934) * [-390.923] (-390.454) (-391.090) (-392.282) -- 0:00:53
      36500 -- [-390.884] (-394.241) (-393.971) (-394.129) * (-391.480) (-389.436) [-392.345] (-394.821) -- 0:00:52
      37000 -- (-392.334) (-395.864) [-393.661] (-392.103) * (-391.658) (-391.776) [-389.729] (-398.486) -- 0:00:52
      37500 -- (-391.311) (-391.389) [-390.319] (-390.773) * (-392.180) (-395.905) [-389.355] (-396.562) -- 0:00:51
      38000 -- (-389.617) (-391.429) [-389.945] (-398.774) * [-389.436] (-394.925) (-392.571) (-394.497) -- 0:00:50
      38500 -- [-389.483] (-394.066) (-392.092) (-391.627) * (-395.471) [-394.378] (-390.765) (-392.046) -- 0:00:49
      39000 -- [-390.441] (-393.045) (-393.728) (-394.147) * [-389.750] (-391.575) (-391.270) (-389.500) -- 0:00:49
      39500 -- (-391.735) [-389.074] (-391.580) (-390.456) * (-392.797) (-393.660) (-388.796) [-390.452] -- 0:00:48
      40000 -- (-391.854) (-394.956) [-390.948] (-389.264) * (-391.477) (-392.020) (-392.375) [-389.965] -- 0:00:48

      Average standard deviation of split frequencies: 0.033037

      40500 -- [-392.404] (-394.657) (-391.835) (-391.682) * [-390.434] (-393.079) (-389.394) (-390.107) -- 0:00:47
      41000 -- (-389.824) [-389.735] (-391.325) (-397.894) * [-391.222] (-389.999) (-391.250) (-389.887) -- 0:00:46
      41500 -- (-391.118) [-388.955] (-389.589) (-391.220) * (-394.280) (-390.743) [-391.373] (-394.418) -- 0:00:46
      42000 -- [-390.565] (-389.289) (-397.002) (-393.017) * (-391.780) (-390.150) (-390.569) [-391.125] -- 0:01:08
      42500 -- (-389.802) (-390.271) (-393.852) [-389.092] * (-389.835) [-392.263] (-390.631) (-391.654) -- 0:01:07
      43000 -- (-389.989) (-389.509) [-390.056] (-390.614) * [-391.351] (-391.113) (-391.770) (-392.561) -- 0:01:06
      43500 -- (-391.174) [-393.659] (-392.164) (-389.360) * (-389.800) (-389.068) (-389.990) [-392.993] -- 0:01:05
      44000 -- [-390.179] (-391.353) (-395.151) (-389.350) * (-389.330) (-390.316) [-395.080] (-389.937) -- 0:01:05
      44500 -- (-390.275) (-390.350) [-395.401] (-390.084) * (-388.839) (-394.765) [-391.779] (-391.555) -- 0:01:04
      45000 -- (-390.178) (-391.552) [-390.837] (-391.736) * [-391.634] (-391.279) (-391.726) (-392.914) -- 0:01:03

      Average standard deviation of split frequencies: 0.031720

      45500 -- (-392.325) (-395.664) [-391.577] (-390.403) * (-392.445) (-390.302) (-392.673) [-390.613] -- 0:01:02
      46000 -- (-389.264) (-392.590) [-394.366] (-389.954) * [-389.401] (-389.360) (-389.195) (-390.474) -- 0:01:02
      46500 -- (-389.757) (-389.271) (-393.850) [-391.419] * (-389.738) (-389.495) (-389.234) [-392.684] -- 0:01:01
      47000 -- (-392.567) (-393.413) [-392.643] (-390.364) * [-391.074] (-392.706) (-393.336) (-391.503) -- 0:01:00
      47500 -- [-388.824] (-391.266) (-391.064) (-392.334) * [-391.897] (-392.068) (-389.926) (-393.318) -- 0:01:00
      48000 -- (-390.242) [-393.086] (-392.840) (-388.981) * (-393.062) (-390.714) (-390.088) [-394.717] -- 0:00:59
      48500 -- (-389.968) (-391.383) [-392.578] (-394.100) * [-397.245] (-393.205) (-389.064) (-391.538) -- 0:00:58
      49000 -- (-390.954) [-391.504] (-396.467) (-399.166) * (-391.409) (-393.761) (-388.650) [-393.014] -- 0:00:58
      49500 -- (-390.545) [-392.531] (-394.946) (-390.939) * (-392.790) (-392.273) [-390.928] (-393.531) -- 0:00:57
      50000 -- (-390.753) (-394.924) (-392.916) [-390.731] * [-392.261] (-394.769) (-392.356) (-394.334) -- 0:00:57

      Average standard deviation of split frequencies: 0.022526

      50500 -- (-390.645) (-390.348) [-390.548] (-393.580) * (-392.939) (-390.331) (-389.168) [-390.043] -- 0:00:56
      51000 -- (-389.966) (-390.028) [-391.494] (-391.870) * (-392.665) (-390.284) [-389.399] (-395.456) -- 0:00:55
      51500 -- (-391.353) [-391.248] (-389.952) (-391.761) * (-393.446) (-391.521) (-389.614) [-396.758] -- 0:00:55
      52000 -- [-389.973] (-390.034) (-391.497) (-390.144) * [-390.414] (-394.161) (-389.960) (-392.619) -- 0:00:54
      52500 -- [-389.134] (-392.243) (-391.542) (-392.757) * [-392.755] (-394.295) (-388.529) (-390.693) -- 0:00:54
      53000 -- (-394.917) (-391.418) [-393.876] (-394.726) * (-391.039) (-390.412) (-389.409) [-389.898] -- 0:00:53
      53500 -- (-392.067) (-391.420) [-393.038] (-391.014) * [-389.686] (-390.134) (-389.294) (-390.059) -- 0:00:53
      54000 -- (-393.873) [-393.608] (-391.208) (-389.451) * (-390.726) (-391.023) (-389.918) [-390.333] -- 0:00:52
      54500 -- (-392.046) (-390.037) (-393.035) [-392.817] * (-390.028) [-391.999] (-395.623) (-392.979) -- 0:00:52
      55000 -- [-388.906] (-390.421) (-395.505) (-393.221) * (-394.153) [-391.784] (-392.167) (-393.194) -- 0:00:51

      Average standard deviation of split frequencies: 0.021466

      55500 -- (-388.872) [-391.045] (-390.479) (-389.900) * (-394.515) (-393.390) (-389.550) [-391.506] -- 0:00:51
      56000 -- (-389.221) (-391.501) (-393.201) [-390.762] * (-389.657) (-390.377) (-391.939) [-390.962] -- 0:00:50
      56500 -- [-389.473] (-391.802) (-392.256) (-390.452) * (-390.263) (-390.584) [-389.167] (-389.992) -- 0:00:50
      57000 -- [-391.147] (-390.084) (-389.636) (-392.792) * [-391.627] (-390.040) (-393.607) (-389.953) -- 0:00:49
      57500 -- [-391.143] (-390.748) (-390.117) (-390.134) * (-393.524) (-391.278) (-392.654) [-389.157] -- 0:00:49
      58000 -- (-391.264) (-395.205) (-394.384) [-390.477] * [-390.301] (-393.709) (-391.161) (-389.910) -- 0:00:48
      58500 -- [-389.132] (-398.726) (-390.566) (-391.417) * (-390.575) (-390.080) [-390.729] (-391.977) -- 0:00:48
      59000 -- (-392.756) (-388.922) (-393.266) [-392.197] * [-390.949] (-389.054) (-391.785) (-390.946) -- 0:00:47
      59500 -- (-394.302) (-389.036) (-393.342) [-392.772] * (-392.013) [-393.862] (-390.521) (-389.660) -- 0:01:03
      60000 -- (-389.166) [-391.297] (-390.874) (-394.050) * (-389.964) (-396.803) (-392.616) [-390.362] -- 0:01:02

      Average standard deviation of split frequencies: 0.023311

      60500 -- (-392.057) (-392.451) [-390.645] (-392.076) * (-391.511) (-393.327) [-392.895] (-391.027) -- 0:01:02
      61000 -- (-401.030) (-390.615) (-391.896) [-390.508] * [-389.617] (-397.063) (-389.950) (-392.129) -- 0:01:01
      61500 -- [-390.602] (-393.532) (-388.929) (-394.769) * [-390.834] (-392.992) (-390.787) (-390.674) -- 0:01:01
      62000 -- [-388.927] (-391.953) (-388.620) (-392.002) * (-390.522) (-393.809) [-392.178] (-390.365) -- 0:01:00
      62500 -- (-392.812) [-389.893] (-390.550) (-391.320) * (-391.502) (-392.918) (-391.769) [-392.821] -- 0:01:00
      63000 -- (-390.062) (-392.730) [-390.344] (-389.202) * [-390.654] (-391.176) (-391.618) (-391.199) -- 0:00:59
      63500 -- (-391.688) [-395.432] (-389.926) (-393.805) * [-389.311] (-390.921) (-394.110) (-390.612) -- 0:00:58
      64000 -- (-393.596) (-390.644) (-391.739) [-394.576] * [-389.896] (-392.337) (-390.981) (-390.456) -- 0:00:58
      64500 -- (-393.974) (-390.610) (-392.386) [-391.462] * (-391.526) [-389.043] (-391.840) (-390.960) -- 0:00:58
      65000 -- (-391.077) (-391.386) (-394.679) [-389.214] * (-392.499) [-389.803] (-392.791) (-390.261) -- 0:00:57

      Average standard deviation of split frequencies: 0.018181

      65500 -- (-392.933) [-390.619] (-391.850) (-394.939) * (-391.385) (-391.271) (-393.141) [-389.867] -- 0:00:57
      66000 -- (-390.171) (-389.307) (-390.943) [-390.266] * (-390.983) (-391.246) [-391.957] (-393.096) -- 0:00:56
      66500 -- (-390.681) (-389.879) (-390.456) [-391.230] * [-389.488] (-389.666) (-394.507) (-391.179) -- 0:00:56
      67000 -- (-393.437) (-389.483) (-391.403) [-389.087] * [-390.677] (-390.756) (-393.188) (-391.167) -- 0:00:55
      67500 -- (-391.061) [-391.687] (-390.809) (-391.395) * [-389.649] (-392.066) (-390.408) (-391.437) -- 0:00:55
      68000 -- [-390.530] (-395.341) (-389.585) (-390.406) * [-389.104] (-392.665) (-391.825) (-390.754) -- 0:00:54
      68500 -- (-393.519) [-393.031] (-393.561) (-391.881) * (-389.600) (-389.371) (-389.993) [-390.413] -- 0:00:54
      69000 -- (-390.102) [-389.241] (-391.946) (-390.260) * [-391.188] (-391.464) (-391.448) (-390.876) -- 0:00:53
      69500 -- (-391.793) (-388.956) (-390.646) [-389.521] * (-391.007) [-391.571] (-391.864) (-395.768) -- 0:00:53
      70000 -- (-390.036) (-389.820) (-389.379) [-392.317] * (-388.966) (-392.519) (-391.104) [-392.082] -- 0:00:53

      Average standard deviation of split frequencies: 0.021347

      70500 -- (-389.690) (-393.278) [-390.858] (-394.028) * [-391.957] (-391.328) (-392.309) (-391.985) -- 0:00:52
      71000 -- (-389.254) (-389.632) (-397.302) [-390.866] * (-389.594) (-389.559) [-391.845] (-391.977) -- 0:00:52
      71500 -- (-390.452) (-388.825) (-391.515) [-390.208] * (-390.257) [-393.069] (-390.912) (-390.227) -- 0:00:51
      72000 -- (-394.025) [-389.512] (-391.408) (-391.573) * (-391.549) (-391.018) (-390.826) [-390.538] -- 0:00:51
      72500 -- (-389.714) [-389.125] (-393.862) (-391.799) * (-392.440) (-390.732) (-392.857) [-390.499] -- 0:00:51
      73000 -- [-392.548] (-391.129) (-397.638) (-390.007) * [-389.462] (-389.398) (-389.980) (-391.621) -- 0:00:50
      73500 -- (-392.792) (-392.463) [-390.859] (-391.104) * (-395.135) [-389.525] (-391.708) (-394.627) -- 0:00:50
      74000 -- (-395.597) [-388.892] (-390.702) (-389.680) * [-390.710] (-394.381) (-393.447) (-391.293) -- 0:00:50
      74500 -- (-395.011) [-389.907] (-392.920) (-393.079) * (-394.048) (-395.406) [-389.116] (-391.531) -- 0:00:49
      75000 -- [-393.361] (-393.047) (-390.798) (-392.608) * [-389.338] (-394.378) (-393.070) (-395.760) -- 0:00:49

      Average standard deviation of split frequencies: 0.019790

      75500 -- (-391.225) [-389.133] (-394.055) (-390.037) * (-393.310) (-389.007) [-390.752] (-393.967) -- 0:00:48
      76000 -- (-394.482) (-389.321) (-391.602) [-391.392] * (-391.464) [-391.878] (-393.797) (-392.244) -- 0:01:00
      76500 -- [-390.007] (-389.735) (-391.442) (-389.409) * (-389.483) (-389.993) (-388.977) [-390.020] -- 0:01:00
      77000 -- (-393.241) (-389.073) (-394.296) [-389.894] * (-392.966) [-389.956] (-391.676) (-388.713) -- 0:00:59
      77500 -- (-394.421) (-390.496) (-391.771) [-389.993] * (-391.488) (-391.642) (-389.040) [-389.272] -- 0:00:59
      78000 -- [-391.865] (-391.007) (-392.145) (-391.733) * (-391.823) [-392.720] (-391.966) (-388.853) -- 0:00:59
      78500 -- (-391.045) [-391.790] (-390.083) (-394.255) * [-390.596] (-390.342) (-395.670) (-391.128) -- 0:00:58
      79000 -- (-389.711) (-389.961) [-392.822] (-388.951) * (-391.632) [-390.033] (-389.829) (-391.500) -- 0:00:58
      79500 -- [-389.346] (-391.330) (-390.791) (-394.156) * (-392.809) [-392.145] (-390.453) (-390.428) -- 0:00:57
      80000 -- (-391.657) (-393.943) (-390.625) [-393.792] * [-390.596] (-390.019) (-389.586) (-391.031) -- 0:00:57

      Average standard deviation of split frequencies: 0.021038

      80500 -- (-394.704) (-388.976) (-396.198) [-392.188] * (-391.925) (-389.154) (-389.917) [-389.184] -- 0:00:57
      81000 -- (-391.758) (-390.663) (-395.835) [-391.176] * (-391.220) (-390.127) (-390.786) [-391.230] -- 0:00:56
      81500 -- (-394.013) [-390.049] (-392.997) (-390.202) * [-389.711] (-389.204) (-388.832) (-390.764) -- 0:00:56
      82000 -- (-391.110) [-390.160] (-391.057) (-394.174) * (-389.240) (-390.627) [-392.447] (-390.019) -- 0:00:55
      82500 -- (-391.323) [-393.250] (-391.567) (-393.847) * (-390.372) (-390.609) [-391.012] (-389.789) -- 0:00:55
      83000 -- (-395.859) (-391.367) (-394.984) [-393.189] * (-391.615) (-391.018) (-391.512) [-390.735] -- 0:00:55
      83500 -- (-391.756) [-391.571] (-393.619) (-391.192) * [-390.532] (-390.543) (-393.948) (-389.704) -- 0:00:54
      84000 -- (-390.161) [-389.271] (-392.198) (-393.395) * (-390.737) [-389.255] (-393.981) (-389.774) -- 0:00:54
      84500 -- (-389.205) (-393.834) (-393.180) [-390.433] * (-396.453) [-390.732] (-391.028) (-391.536) -- 0:00:54
      85000 -- [-388.931] (-390.574) (-389.842) (-389.778) * (-392.917) (-389.365) [-391.677] (-391.985) -- 0:00:53

      Average standard deviation of split frequencies: 0.016705

      85500 -- [-393.271] (-389.466) (-391.853) (-390.029) * (-389.423) (-391.228) [-389.591] (-389.567) -- 0:00:53
      86000 -- (-392.378) [-394.201] (-389.264) (-392.170) * (-390.946) (-389.588) [-389.351] (-390.181) -- 0:00:53
      86500 -- (-390.972) [-392.535] (-389.825) (-393.254) * (-392.057) (-391.313) [-391.720] (-390.811) -- 0:00:52
      87000 -- (-390.429) (-395.414) [-389.747] (-390.828) * [-390.079] (-390.702) (-388.874) (-390.506) -- 0:00:52
      87500 -- (-389.029) (-392.995) [-391.225] (-393.010) * (-391.272) [-390.979] (-392.357) (-390.037) -- 0:00:52
      88000 -- (-389.874) (-397.395) (-391.417) [-390.012] * (-392.737) (-391.294) [-390.216] (-390.017) -- 0:00:51
      88500 -- (-390.992) (-398.208) (-390.775) [-390.740] * (-395.101) [-393.256] (-391.962) (-389.717) -- 0:00:51
      89000 -- [-393.369] (-391.087) (-391.584) (-392.015) * (-396.031) [-393.049] (-390.452) (-390.780) -- 0:00:51
      89500 -- (-391.058) (-389.787) [-389.190] (-394.857) * [-390.577] (-392.165) (-391.498) (-389.601) -- 0:00:50
      90000 -- (-392.396) (-391.601) (-391.178) [-393.904] * (-389.959) [-393.104] (-392.156) (-390.565) -- 0:00:50

      Average standard deviation of split frequencies: 0.016780

      90500 -- [-389.642] (-393.121) (-392.379) (-390.456) * [-390.506] (-390.217) (-391.074) (-394.120) -- 0:00:50
      91000 -- (-390.070) [-394.861] (-392.558) (-391.636) * (-391.604) (-390.601) (-390.159) [-392.817] -- 0:00:49
      91500 -- [-390.318] (-390.729) (-389.322) (-393.758) * (-389.607) (-392.326) [-389.600] (-392.834) -- 0:00:49
      92000 -- [-391.997] (-390.454) (-390.837) (-392.997) * [-389.920] (-389.993) (-394.726) (-391.307) -- 0:00:59
      92500 -- [-393.861] (-389.659) (-389.857) (-390.635) * [-389.183] (-388.946) (-390.654) (-389.986) -- 0:00:58
      93000 -- (-390.128) [-391.266] (-389.857) (-392.549) * (-388.903) [-389.243] (-389.786) (-391.640) -- 0:00:58
      93500 -- (-388.870) (-390.557) (-390.936) [-390.973] * [-390.213] (-392.499) (-391.689) (-390.170) -- 0:00:58
      94000 -- (-394.061) (-390.870) [-394.405] (-391.651) * (-389.124) (-390.011) [-391.968] (-391.890) -- 0:00:57
      94500 -- (-390.008) [-392.930] (-390.662) (-389.316) * (-393.852) (-392.370) (-392.653) [-391.844] -- 0:00:57
      95000 -- (-390.295) [-389.900] (-390.632) (-390.864) * (-393.900) [-392.336] (-389.618) (-394.973) -- 0:00:57

      Average standard deviation of split frequencies: 0.016282

      95500 -- [-389.262] (-393.098) (-392.120) (-392.159) * (-390.327) [-393.107] (-391.736) (-391.135) -- 0:00:56
      96000 -- (-392.429) (-399.712) (-394.981) [-391.299] * (-389.887) [-390.242] (-393.927) (-391.485) -- 0:00:56
      96500 -- (-396.506) [-394.771] (-389.742) (-391.770) * (-389.037) [-390.444] (-393.296) (-392.661) -- 0:00:56
      97000 -- (-391.003) [-391.332] (-390.319) (-394.132) * [-390.126] (-392.097) (-390.698) (-390.777) -- 0:00:55
      97500 -- (-393.472) (-391.046) (-389.958) [-392.381] * (-392.076) [-389.847] (-390.944) (-393.007) -- 0:00:55
      98000 -- [-390.515] (-391.935) (-391.648) (-390.556) * (-389.086) [-390.459] (-393.420) (-391.636) -- 0:00:55
      98500 -- (-391.022) [-390.254] (-393.093) (-390.564) * (-390.109) (-390.585) (-389.650) [-395.754] -- 0:00:54
      99000 -- (-391.724) [-390.307] (-390.727) (-390.868) * (-391.710) [-389.306] (-389.281) (-391.904) -- 0:00:54
      99500 -- (-392.592) (-390.148) (-391.057) [-389.823] * (-392.473) [-392.257] (-394.645) (-390.335) -- 0:00:54
      100000 -- (-390.971) [-389.056] (-394.808) (-393.452) * (-390.480) (-392.390) (-394.759) [-391.513] -- 0:00:54

      Average standard deviation of split frequencies: 0.018238

      100500 -- (-392.904) (-390.410) [-391.806] (-390.277) * (-390.668) (-389.607) [-389.081] (-391.888) -- 0:00:53
      101000 -- (-395.248) (-391.277) [-392.987] (-390.092) * (-390.599) [-391.699] (-393.618) (-393.396) -- 0:00:53
      101500 -- (-395.613) [-390.049] (-389.854) (-393.062) * (-391.898) (-390.283) (-395.088) [-389.251] -- 0:00:53
      102000 -- (-394.725) (-390.561) [-390.516] (-392.812) * (-391.699) (-389.999) [-390.558] (-389.181) -- 0:00:52
      102500 -- [-392.205] (-389.619) (-391.511) (-393.027) * (-391.851) [-391.484] (-391.245) (-388.893) -- 0:00:52
      103000 -- (-390.598) [-391.899] (-391.154) (-390.545) * (-391.312) (-392.009) (-389.905) [-390.598] -- 0:00:52
      103500 -- (-394.748) (-394.568) (-392.326) [-391.390] * [-388.809] (-389.736) (-391.135) (-392.567) -- 0:00:51
      104000 -- (-392.617) [-391.172] (-392.157) (-389.610) * (-396.557) (-391.399) [-389.469] (-390.835) -- 0:00:51
      104500 -- (-391.056) (-390.581) (-391.102) [-390.225] * (-391.208) (-395.250) (-390.520) [-390.037] -- 0:00:51
      105000 -- (-389.675) (-391.321) [-390.639] (-391.957) * (-389.260) (-393.481) [-390.270] (-390.491) -- 0:00:51

      Average standard deviation of split frequencies: 0.017122

      105500 -- (-389.266) (-393.814) [-391.540] (-392.845) * (-391.312) (-391.759) [-390.167] (-388.842) -- 0:00:50
      106000 -- [-390.572] (-395.133) (-390.453) (-394.622) * (-393.106) (-391.060) [-393.362] (-389.305) -- 0:00:50
      106500 -- (-391.325) (-393.025) [-389.507] (-390.343) * [-391.203] (-392.315) (-395.855) (-388.775) -- 0:00:50
      107000 -- [-390.888] (-390.369) (-395.429) (-390.976) * (-392.016) [-389.693] (-391.238) (-389.312) -- 0:00:50
      107500 -- [-391.549] (-392.746) (-394.289) (-391.619) * (-392.100) (-388.800) [-391.447] (-389.377) -- 0:00:58
      108000 -- (-392.988) [-389.078] (-391.447) (-391.161) * (-391.227) (-388.954) (-390.661) [-393.700] -- 0:00:57
      108500 -- (-391.639) (-390.765) (-389.720) [-394.496] * (-392.201) [-391.787] (-388.717) (-399.040) -- 0:00:57
      109000 -- (-389.424) (-393.094) [-390.741] (-392.324) * (-389.601) (-391.095) [-389.074] (-391.625) -- 0:00:57
      109500 -- (-390.461) (-391.044) (-391.060) [-390.764] * (-391.234) (-389.029) (-393.910) [-388.894] -- 0:00:56
      110000 -- (-390.374) [-390.120] (-390.698) (-391.445) * (-392.395) (-393.707) (-396.726) [-393.273] -- 0:00:56

      Average standard deviation of split frequencies: 0.016815

      110500 -- (-391.744) (-389.640) [-390.402] (-392.253) * (-391.829) (-392.585) [-393.246] (-390.853) -- 0:00:56
      111000 -- (-390.339) [-392.377] (-393.994) (-391.258) * (-396.589) [-389.885] (-393.488) (-388.887) -- 0:00:56
      111500 -- (-393.743) (-391.296) [-398.343] (-390.845) * (-390.392) [-389.245] (-389.753) (-389.631) -- 0:00:55
      112000 -- (-395.164) (-392.495) (-390.800) [-390.220] * (-390.053) [-392.710] (-390.505) (-389.150) -- 0:00:55
      112500 -- (-393.582) (-388.690) [-390.068] (-388.934) * (-391.290) (-390.116) (-389.413) [-390.065] -- 0:00:55
      113000 -- [-390.312] (-390.972) (-390.517) (-391.081) * (-390.785) (-390.277) (-389.656) [-391.030] -- 0:00:54
      113500 -- [-390.852] (-391.292) (-396.606) (-389.711) * [-391.775] (-388.984) (-391.734) (-389.446) -- 0:00:54
      114000 -- (-390.954) (-389.416) [-392.120] (-389.183) * [-389.312] (-390.172) (-390.307) (-391.474) -- 0:00:54
      114500 -- (-390.446) (-390.400) [-391.978] (-389.123) * (-392.578) [-391.316] (-392.515) (-393.354) -- 0:00:54
      115000 -- (-393.536) (-389.128) (-389.725) [-389.476] * [-390.909] (-390.103) (-392.444) (-393.653) -- 0:00:53

      Average standard deviation of split frequencies: 0.016897

      115500 -- (-390.735) (-390.406) (-391.525) [-389.625] * [-389.033] (-392.438) (-388.741) (-396.267) -- 0:00:53
      116000 -- [-391.103] (-394.438) (-389.331) (-393.444) * (-393.446) [-391.851] (-388.668) (-390.209) -- 0:00:53
      116500 -- (-392.978) (-392.975) (-390.826) [-391.610] * [-389.392] (-391.177) (-390.751) (-391.277) -- 0:00:53
      117000 -- (-390.568) (-394.177) (-392.121) [-391.139] * (-389.139) [-389.367] (-389.976) (-391.015) -- 0:00:52
      117500 -- (-390.432) (-396.314) (-389.062) [-389.907] * (-391.212) (-393.746) (-389.291) [-391.640] -- 0:00:52
      118000 -- (-388.937) [-392.260] (-393.002) (-391.105) * [-391.130] (-398.686) (-389.504) (-391.127) -- 0:00:52
      118500 -- (-392.245) [-389.987] (-391.270) (-391.521) * (-391.297) (-391.015) [-388.793] (-390.607) -- 0:00:52
      119000 -- (-388.675) [-389.973] (-390.032) (-391.770) * [-391.249] (-389.711) (-390.530) (-389.725) -- 0:00:51
      119500 -- [-392.690] (-392.065) (-393.716) (-390.603) * (-390.863) (-391.555) [-391.546] (-389.902) -- 0:00:51
      120000 -- (-391.048) (-393.193) [-390.887] (-389.490) * [-389.617] (-391.921) (-393.065) (-389.742) -- 0:00:51

      Average standard deviation of split frequencies: 0.016278

      120500 -- (-389.501) [-392.120] (-394.616) (-389.751) * (-390.373) (-393.167) [-391.862] (-391.590) -- 0:00:51
      121000 -- (-389.023) (-392.002) [-390.963] (-397.807) * [-390.753] (-391.677) (-390.767) (-391.200) -- 0:00:50
      121500 -- [-397.184] (-391.361) (-395.939) (-395.228) * (-390.246) [-390.384] (-392.444) (-389.948) -- 0:00:50
      122000 -- (-393.252) (-391.719) [-393.065] (-391.438) * (-393.644) [-390.225] (-389.559) (-389.584) -- 0:00:50
      122500 -- (-390.566) [-390.994] (-390.892) (-390.314) * (-391.289) (-390.812) (-390.947) [-391.298] -- 0:00:57
      123000 -- (-391.016) (-388.676) (-391.765) [-389.018] * (-394.340) [-390.620] (-392.044) (-391.649) -- 0:00:57
      123500 -- (-390.077) (-389.301) [-389.684] (-390.027) * (-394.414) [-389.105] (-391.952) (-391.832) -- 0:00:56
      124000 -- (-389.868) (-390.439) [-391.562] (-391.222) * [-392.897] (-393.565) (-391.656) (-391.071) -- 0:00:56
      124500 -- (-389.465) (-391.925) (-390.365) [-390.534] * (-392.584) (-396.891) (-399.509) [-392.922] -- 0:00:56
      125000 -- (-389.895) (-392.745) [-390.977] (-391.693) * (-391.360) (-395.071) (-395.324) [-390.257] -- 0:00:56

      Average standard deviation of split frequencies: 0.014571

      125500 -- (-389.937) (-390.818) [-391.660] (-394.737) * (-390.252) (-389.939) (-392.093) [-390.297] -- 0:00:55
      126000 -- (-394.970) [-388.750] (-390.197) (-390.077) * (-395.415) (-392.051) (-395.670) [-392.717] -- 0:00:55
      126500 -- [-391.298] (-395.916) (-389.688) (-389.894) * (-396.534) (-390.357) [-389.450] (-392.374) -- 0:00:55
      127000 -- [-391.174] (-392.353) (-393.943) (-391.314) * [-392.780] (-389.255) (-390.255) (-389.890) -- 0:00:54
      127500 -- (-389.067) (-394.352) [-393.357] (-394.090) * (-392.714) (-392.991) [-389.636] (-390.206) -- 0:00:54
      128000 -- [-390.163] (-389.441) (-393.462) (-395.338) * [-391.519] (-390.905) (-390.488) (-391.849) -- 0:00:54
      128500 -- (-394.100) (-396.399) [-391.300] (-395.073) * (-392.413) (-397.421) [-391.844] (-390.759) -- 0:00:54
      129000 -- [-390.111] (-389.393) (-388.694) (-392.445) * [-390.202] (-389.290) (-392.189) (-393.053) -- 0:00:54
      129500 -- (-390.193) (-390.899) [-389.857] (-391.027) * (-392.419) [-388.998] (-390.582) (-393.159) -- 0:00:53
      130000 -- (-393.639) (-390.298) [-390.325] (-392.095) * (-391.445) (-389.910) [-390.236] (-391.362) -- 0:00:53

      Average standard deviation of split frequencies: 0.015950

      130500 -- (-392.801) [-390.310] (-389.692) (-389.713) * [-390.121] (-391.635) (-390.685) (-394.269) -- 0:00:53
      131000 -- (-391.385) (-390.596) (-391.553) [-390.386] * [-391.187] (-392.981) (-395.513) (-393.249) -- 0:00:53
      131500 -- (-390.996) (-390.723) (-389.266) [-390.375] * (-390.594) [-391.295] (-393.602) (-393.315) -- 0:00:52
      132000 -- (-392.455) (-390.507) [-389.428] (-392.859) * (-392.458) (-389.644) [-391.977] (-391.212) -- 0:00:52
      132500 -- (-389.909) (-394.678) (-390.301) [-390.515] * (-392.769) [-395.382] (-389.933) (-389.949) -- 0:00:52
      133000 -- (-391.427) (-391.514) [-389.438] (-391.129) * (-391.702) [-390.836] (-388.711) (-392.224) -- 0:00:52
      133500 -- [-392.614] (-390.695) (-389.188) (-391.733) * (-391.319) (-391.196) [-389.508] (-390.870) -- 0:00:51
      134000 -- [-390.387] (-389.178) (-392.218) (-392.337) * (-394.819) [-389.964] (-389.710) (-393.157) -- 0:00:51
      134500 -- (-391.489) (-389.135) (-390.354) [-391.468] * (-390.009) (-394.286) [-392.555] (-389.085) -- 0:00:51
      135000 -- (-393.344) (-390.654) [-390.346] (-390.218) * (-389.546) [-391.354] (-390.516) (-390.013) -- 0:00:51

      Average standard deviation of split frequencies: 0.014057

      135500 -- (-388.807) (-391.071) [-394.976] (-390.190) * (-388.949) (-389.526) [-389.628] (-389.430) -- 0:00:51
      136000 -- (-390.773) (-391.842) (-394.289) [-389.797] * (-390.865) (-389.980) [-394.660] (-389.359) -- 0:00:50
      136500 -- (-392.421) (-390.989) (-389.349) [-392.742] * (-390.106) (-390.846) [-390.800] (-392.612) -- 0:00:50
      137000 -- [-392.414] (-391.814) (-390.469) (-391.077) * (-392.507) (-392.218) [-390.712] (-393.719) -- 0:00:50
      137500 -- [-392.547] (-394.238) (-394.170) (-389.251) * (-391.871) (-391.543) (-389.231) [-389.995] -- 0:00:50
      138000 -- [-395.927] (-391.486) (-391.815) (-389.621) * [-389.545] (-391.453) (-390.168) (-389.838) -- 0:00:56
      138500 -- (-390.178) (-395.433) [-390.071] (-389.844) * (-393.030) (-391.972) [-391.769] (-391.897) -- 0:00:55
      139000 -- (-391.199) [-389.411] (-392.145) (-390.360) * [-391.386] (-394.880) (-393.624) (-392.391) -- 0:00:55
      139500 -- [-389.938] (-389.263) (-390.198) (-389.074) * (-391.799) (-396.058) [-393.080] (-391.715) -- 0:00:55
      140000 -- (-390.944) (-392.123) (-394.335) [-390.152] * (-391.309) (-390.460) (-392.595) [-390.243] -- 0:00:55

      Average standard deviation of split frequencies: 0.015573

      140500 -- (-389.456) (-390.803) [-390.569] (-392.810) * [-390.603] (-390.268) (-389.828) (-395.074) -- 0:00:55
      141000 -- (-390.108) (-389.560) [-390.682] (-393.052) * (-391.999) (-390.064) (-389.945) [-393.489] -- 0:00:54
      141500 -- (-396.339) (-393.925) (-400.525) [-389.338] * (-389.514) (-389.731) (-393.039) [-389.824] -- 0:00:54
      142000 -- (-395.652) [-391.487] (-393.067) (-389.768) * (-391.181) (-391.978) [-390.420] (-389.860) -- 0:00:54
      142500 -- (-393.822) (-393.132) [-391.862] (-390.451) * (-391.354) (-392.213) [-391.818] (-390.016) -- 0:00:54
      143000 -- (-391.041) (-394.026) (-391.187) [-389.795] * (-391.187) [-389.522] (-390.912) (-390.939) -- 0:00:53
      143500 -- (-389.517) [-392.560] (-392.726) (-390.249) * (-398.282) (-390.197) [-389.600] (-390.059) -- 0:00:53
      144000 -- (-390.445) (-392.804) (-391.867) [-390.636] * (-396.327) [-390.351] (-389.293) (-390.446) -- 0:00:53
      144500 -- (-390.763) [-390.134] (-389.233) (-389.669) * [-391.466] (-390.858) (-389.524) (-390.178) -- 0:00:53
      145000 -- [-389.952] (-390.961) (-389.553) (-389.575) * (-390.380) [-390.767] (-392.148) (-391.153) -- 0:00:53

      Average standard deviation of split frequencies: 0.016994

      145500 -- (-391.520) (-390.559) (-391.134) [-389.296] * (-390.323) [-388.678] (-392.411) (-392.728) -- 0:00:52
      146000 -- (-389.900) [-390.074] (-389.526) (-391.799) * (-389.268) [-390.177] (-394.181) (-390.008) -- 0:00:52
      146500 -- [-391.325] (-389.997) (-390.833) (-390.212) * (-393.175) (-391.841) (-394.399) [-389.708] -- 0:00:52
      147000 -- (-391.672) (-392.483) [-390.387] (-393.703) * (-388.972) [-389.968] (-394.867) (-390.437) -- 0:00:52
      147500 -- (-393.492) (-391.374) (-390.464) [-390.119] * [-391.570] (-389.916) (-394.966) (-390.738) -- 0:00:52
      148000 -- [-393.338] (-392.262) (-389.281) (-393.347) * [-389.257] (-390.753) (-389.801) (-391.563) -- 0:00:51
      148500 -- (-394.145) (-388.738) (-390.528) [-390.926] * (-389.423) (-391.952) (-389.303) [-391.264] -- 0:00:51
      149000 -- (-390.806) (-389.907) [-392.840] (-391.470) * [-392.393] (-393.185) (-390.151) (-394.503) -- 0:00:51
      149500 -- (-389.901) [-389.238] (-392.388) (-390.162) * (-390.930) (-389.971) [-394.276] (-395.981) -- 0:00:51
      150000 -- (-391.786) (-389.588) [-390.293] (-390.289) * (-390.012) [-391.967] (-395.978) (-396.069) -- 0:00:51

      Average standard deviation of split frequencies: 0.014491

      150500 -- (-390.350) [-391.091] (-390.541) (-390.707) * (-391.042) [-393.952] (-389.520) (-393.323) -- 0:00:50
      151000 -- (-391.239) (-391.207) (-395.789) [-390.320] * [-390.826] (-393.206) (-393.726) (-390.796) -- 0:00:50
      151500 -- (-392.413) [-391.596] (-397.338) (-390.301) * (-390.752) [-388.877] (-391.904) (-389.805) -- 0:00:50
      152000 -- (-391.665) [-388.892] (-391.246) (-392.673) * (-393.718) (-393.858) [-390.493] (-390.947) -- 0:00:50
      152500 -- (-394.398) (-391.683) (-391.273) [-390.496] * (-390.343) (-392.258) (-394.037) [-391.642] -- 0:00:50
      153000 -- (-392.038) (-389.834) (-389.469) [-391.185] * (-394.226) (-391.544) (-389.800) [-390.660] -- 0:00:49
      153500 -- [-389.062] (-389.456) (-391.591) (-392.727) * (-395.140) [-391.160] (-389.136) (-391.295) -- 0:00:49
      154000 -- [-389.771] (-389.153) (-390.571) (-390.092) * (-391.365) (-393.881) (-389.206) [-390.389] -- 0:00:49
      154500 -- [-392.064] (-390.029) (-389.488) (-388.895) * (-392.395) (-391.269) [-388.924] (-389.681) -- 0:00:49
      155000 -- (-390.769) [-390.954] (-394.521) (-391.541) * (-390.251) (-390.824) [-390.012] (-392.896) -- 0:00:54

      Average standard deviation of split frequencies: 0.014941

      155500 -- (-389.487) [-391.462] (-391.352) (-390.638) * [-389.933] (-389.626) (-392.982) (-390.875) -- 0:00:54
      156000 -- (-390.946) (-391.632) [-392.090] (-393.087) * [-390.296] (-390.525) (-390.327) (-395.528) -- 0:00:54
      156500 -- (-393.342) [-390.414] (-390.714) (-393.593) * (-394.043) [-390.847] (-391.558) (-391.461) -- 0:00:53
      157000 -- (-395.694) [-392.837] (-389.166) (-391.821) * [-391.176] (-393.492) (-390.043) (-395.245) -- 0:00:53
      157500 -- (-391.046) [-389.935] (-389.712) (-393.112) * (-391.307) [-389.811] (-392.074) (-390.882) -- 0:00:53
      158000 -- (-391.893) (-393.285) (-392.591) [-391.440] * (-389.443) (-389.504) [-392.375] (-390.226) -- 0:00:53
      158500 -- (-391.095) (-390.813) (-388.929) [-389.460] * (-389.611) (-395.508) [-389.389] (-391.371) -- 0:00:53
      159000 -- (-390.666) (-395.627) [-389.930] (-391.334) * [-389.553] (-390.786) (-390.182) (-391.663) -- 0:00:52
      159500 -- [-389.557] (-390.196) (-391.974) (-392.600) * (-390.943) (-389.929) [-389.413] (-390.225) -- 0:00:52
      160000 -- [-388.689] (-390.701) (-390.922) (-390.523) * (-389.979) [-394.034] (-389.215) (-390.764) -- 0:00:52

      Average standard deviation of split frequencies: 0.016678

      160500 -- (-390.041) (-395.341) [-392.006] (-392.177) * (-390.766) (-389.857) [-390.604] (-390.391) -- 0:00:52
      161000 -- (-391.335) (-389.520) [-390.531] (-393.354) * (-391.216) (-389.337) [-389.319] (-392.047) -- 0:00:52
      161500 -- [-391.719] (-393.472) (-391.376) (-389.778) * (-389.042) (-390.083) (-394.312) [-390.988] -- 0:00:51
      162000 -- (-391.702) (-392.773) [-392.262] (-389.667) * (-391.252) (-390.682) [-389.753] (-390.751) -- 0:00:51
      162500 -- (-391.442) (-392.776) [-398.629] (-391.187) * (-391.176) (-394.715) (-388.964) [-389.173] -- 0:00:51
      163000 -- (-390.936) [-391.583] (-393.426) (-390.881) * (-389.920) [-389.612] (-389.357) (-389.529) -- 0:00:51
      163500 -- (-390.751) (-393.630) (-392.369) [-390.972] * [-392.825] (-390.773) (-391.896) (-392.365) -- 0:00:51
      164000 -- (-390.171) [-391.302] (-391.465) (-388.897) * (-393.492) (-391.334) [-389.783] (-389.162) -- 0:00:50
      164500 -- (-391.651) (-391.784) [-391.174] (-389.201) * [-390.045] (-391.628) (-389.797) (-390.439) -- 0:00:50
      165000 -- (-396.462) (-392.714) [-390.011] (-391.116) * (-389.986) [-389.617] (-390.836) (-393.440) -- 0:00:50

      Average standard deviation of split frequencies: 0.017181

      165500 -- (-391.001) (-392.152) (-393.116) [-392.415] * (-390.695) (-391.574) (-390.225) [-391.062] -- 0:00:50
      166000 -- (-390.156) [-392.571] (-391.513) (-390.211) * (-389.896) (-390.686) (-396.330) [-388.962] -- 0:00:50
      166500 -- (-389.347) [-389.491] (-391.401) (-391.876) * (-391.709) (-391.978) (-392.781) [-392.448] -- 0:00:50
      167000 -- (-394.559) (-391.133) [-389.467] (-394.664) * (-393.197) [-390.439] (-393.330) (-389.998) -- 0:00:49
      167500 -- [-391.201] (-390.375) (-391.152) (-390.087) * (-390.130) [-390.294] (-393.199) (-399.362) -- 0:00:49
      168000 -- (-393.511) (-388.986) [-394.662] (-391.836) * (-390.264) (-391.473) (-391.707) [-390.690] -- 0:00:49
      168500 -- [-388.964] (-390.111) (-394.362) (-391.390) * (-390.986) (-390.602) [-393.126] (-390.088) -- 0:00:49
      169000 -- (-389.038) (-391.167) [-390.724] (-391.864) * [-391.358] (-390.028) (-394.039) (-389.317) -- 0:00:49
      169500 -- [-389.710] (-391.464) (-392.786) (-389.097) * (-389.217) [-390.521] (-393.112) (-390.375) -- 0:00:48
      170000 -- (-389.495) (-391.288) (-390.755) [-390.156] * [-390.660] (-389.530) (-392.966) (-390.482) -- 0:00:48

      Average standard deviation of split frequencies: 0.017647

      170500 -- (-395.285) (-392.404) [-389.162] (-391.997) * [-390.638] (-391.682) (-390.036) (-394.181) -- 0:00:48
      171000 -- (-397.863) (-390.321) [-390.106] (-392.423) * (-391.886) [-390.391] (-390.893) (-393.383) -- 0:00:48
      171500 -- (-390.241) [-390.762] (-390.108) (-392.563) * (-389.886) (-395.897) (-398.600) [-389.469] -- 0:00:48
      172000 -- (-390.455) (-396.118) [-388.813] (-394.309) * (-390.897) [-390.318] (-393.418) (-389.563) -- 0:00:52
      172500 -- [-391.386] (-389.856) (-391.050) (-390.424) * (-395.649) (-390.367) (-390.063) [-389.360] -- 0:00:52
      173000 -- (-395.081) [-389.773] (-389.833) (-390.100) * (-394.101) (-391.195) [-390.860] (-390.925) -- 0:00:52
      173500 -- (-389.369) (-389.503) [-389.356] (-395.867) * (-389.450) [-391.530] (-390.315) (-392.152) -- 0:00:52
      174000 -- (-393.499) [-391.922] (-388.978) (-393.580) * [-390.913] (-393.777) (-391.439) (-390.014) -- 0:00:52
      174500 -- [-394.054] (-390.162) (-390.706) (-390.532) * [-389.972] (-391.743) (-393.846) (-390.261) -- 0:00:52
      175000 -- [-390.138] (-394.918) (-395.786) (-389.730) * (-396.258) (-397.016) (-393.608) [-390.166] -- 0:00:51

      Average standard deviation of split frequencies: 0.015475

      175500 -- [-390.899] (-390.396) (-399.353) (-391.997) * (-391.106) [-392.402] (-396.071) (-390.025) -- 0:00:51
      176000 -- (-392.254) (-392.940) (-393.101) [-390.557] * [-390.633] (-390.824) (-396.050) (-389.892) -- 0:00:51
      176500 -- (-389.726) [-391.137] (-393.085) (-390.805) * (-391.436) [-391.306] (-390.516) (-393.784) -- 0:00:51
      177000 -- [-389.969] (-398.508) (-391.484) (-391.879) * [-390.077] (-393.070) (-391.977) (-391.049) -- 0:00:51
      177500 -- (-393.171) [-392.487] (-391.522) (-393.309) * (-391.019) (-395.319) (-396.990) [-390.227] -- 0:00:50
      178000 -- (-390.426) [-390.884] (-391.072) (-391.777) * [-392.780] (-393.009) (-390.426) (-392.553) -- 0:00:50
      178500 -- (-392.424) [-389.629] (-389.190) (-391.804) * [-389.465] (-389.325) (-397.393) (-390.565) -- 0:00:50
      179000 -- [-389.867] (-391.180) (-391.257) (-392.578) * [-392.027] (-392.752) (-390.807) (-392.429) -- 0:00:50
      179500 -- [-389.973] (-389.659) (-389.814) (-392.767) * (-390.277) (-388.628) [-390.129] (-389.462) -- 0:00:50
      180000 -- (-394.705) (-391.402) [-389.590] (-392.155) * (-390.664) (-389.527) (-394.965) [-390.341] -- 0:00:50

      Average standard deviation of split frequencies: 0.014931

      180500 -- (-394.408) [-390.657] (-391.300) (-392.994) * [-393.183] (-392.295) (-393.129) (-389.834) -- 0:00:49
      181000 -- (-389.644) (-389.351) [-390.310] (-389.615) * [-396.714] (-394.465) (-392.517) (-391.620) -- 0:00:49
      181500 -- (-389.818) [-390.166] (-389.730) (-392.757) * (-395.720) (-395.457) [-392.849] (-391.974) -- 0:00:49
      182000 -- (-391.180) [-391.388] (-392.793) (-389.396) * (-394.589) (-394.131) [-389.815] (-394.960) -- 0:00:49
      182500 -- (-391.581) (-391.380) [-390.093] (-392.199) * [-390.772] (-391.443) (-391.836) (-396.140) -- 0:00:49
      183000 -- (-390.050) (-391.613) (-390.211) [-390.093] * [-390.871] (-392.788) (-392.950) (-392.710) -- 0:00:49
      183500 -- [-392.586] (-393.860) (-392.205) (-388.826) * [-393.944] (-392.573) (-398.884) (-390.890) -- 0:00:48
      184000 -- [-391.320] (-391.219) (-389.441) (-391.252) * (-390.226) [-391.527] (-389.486) (-390.518) -- 0:00:48
      184500 -- (-391.901) (-391.315) [-389.892] (-388.707) * (-389.641) (-390.978) [-389.794] (-388.981) -- 0:00:48
      185000 -- (-390.674) (-390.012) [-389.682] (-391.628) * (-389.239) (-389.659) (-391.039) [-389.272] -- 0:00:48

      Average standard deviation of split frequencies: 0.013376

      185500 -- [-390.820] (-389.395) (-390.200) (-394.118) * (-389.600) (-388.878) [-390.721] (-395.065) -- 0:00:48
      186000 -- (-390.454) (-392.151) [-389.251] (-392.147) * [-390.229] (-389.107) (-392.394) (-391.404) -- 0:00:48
      186500 -- (-392.174) (-392.222) (-389.726) [-389.599] * (-390.031) (-390.260) (-396.811) [-393.828] -- 0:00:47
      187000 -- (-392.694) (-393.927) (-395.305) [-390.285] * (-389.540) [-390.821] (-392.378) (-391.962) -- 0:00:47
      187500 -- [-392.924] (-393.028) (-393.587) (-390.140) * (-389.836) (-389.536) [-389.895] (-389.023) -- 0:00:47
      188000 -- (-392.463) (-392.016) (-391.811) [-388.916] * (-391.260) (-389.043) (-390.693) [-390.045] -- 0:00:47
      188500 -- (-391.503) (-394.017) [-393.327] (-391.414) * (-389.949) (-394.466) [-393.109] (-389.851) -- 0:00:47
      189000 -- [-389.282] (-389.784) (-389.722) (-391.582) * [-389.937] (-392.050) (-389.389) (-391.706) -- 0:00:51
      189500 -- (-390.099) (-390.198) (-390.002) [-390.320] * (-390.744) (-391.267) [-392.406] (-394.105) -- 0:00:51
      190000 -- [-393.544] (-392.289) (-391.852) (-391.350) * (-390.934) [-390.819] (-390.752) (-391.164) -- 0:00:51

      Average standard deviation of split frequencies: 0.013049

      190500 -- (-392.146) (-390.102) [-393.344] (-392.770) * (-392.141) [-393.479] (-390.507) (-390.390) -- 0:00:50
      191000 -- (-390.894) [-388.692] (-390.905) (-391.764) * (-394.342) (-390.493) (-390.015) [-391.973] -- 0:00:50
      191500 -- (-389.650) (-389.915) (-391.463) [-389.797] * (-393.089) (-390.607) [-390.872] (-389.917) -- 0:00:50
      192000 -- [-389.579] (-389.592) (-389.913) (-393.282) * (-390.055) [-394.131] (-396.105) (-391.400) -- 0:00:50
      192500 -- (-392.048) (-388.801) [-391.084] (-391.348) * (-389.235) (-397.438) (-389.051) [-393.360] -- 0:00:50
      193000 -- [-391.888] (-390.398) (-391.770) (-389.793) * (-389.601) (-390.184) (-389.772) [-390.509] -- 0:00:50
      193500 -- (-393.317) (-389.750) (-389.143) [-389.562] * (-390.553) (-392.256) [-390.354] (-390.824) -- 0:00:50
      194000 -- (-390.177) (-391.557) (-389.845) [-392.030] * [-390.222] (-396.789) (-389.605) (-391.040) -- 0:00:49
      194500 -- [-390.839] (-393.002) (-391.287) (-390.048) * (-391.465) (-390.200) [-392.128] (-389.121) -- 0:00:49
      195000 -- (-390.401) [-392.186] (-390.850) (-391.146) * (-395.055) (-389.881) (-390.347) [-389.984] -- 0:00:49

      Average standard deviation of split frequencies: 0.015366

      195500 -- (-391.553) (-391.182) (-390.182) [-390.826] * (-389.597) [-389.452] (-392.585) (-392.232) -- 0:00:49
      196000 -- (-388.953) (-391.078) (-390.517) [-390.566] * (-389.718) (-394.298) [-390.112] (-392.718) -- 0:00:49
      196500 -- (-391.705) [-390.945] (-391.084) (-393.278) * [-391.167] (-390.740) (-390.230) (-390.344) -- 0:00:49
      197000 -- (-391.802) (-392.047) (-390.015) [-392.075] * [-391.370] (-390.969) (-392.841) (-389.049) -- 0:00:48
      197500 -- (-391.135) (-391.882) [-389.656] (-392.651) * (-391.321) (-389.583) (-392.678) [-389.875] -- 0:00:48
      198000 -- (-390.842) (-389.577) [-389.538] (-390.872) * (-389.672) (-390.098) [-389.062] (-389.196) -- 0:00:48
      198500 -- (-391.863) (-394.312) (-393.926) [-388.937] * (-391.949) (-392.342) [-389.616] (-391.546) -- 0:00:48
      199000 -- (-391.842) (-389.986) (-394.633) [-389.498] * (-390.479) [-392.124] (-388.582) (-391.840) -- 0:00:48
      199500 -- (-391.052) (-390.903) (-393.427) [-390.253] * (-390.627) (-390.827) [-390.147] (-391.087) -- 0:00:48
      200000 -- (-389.271) (-390.597) [-393.286] (-393.597) * [-392.776] (-392.314) (-391.002) (-390.316) -- 0:00:48

      Average standard deviation of split frequencies: 0.016705

      200500 -- (-389.093) [-390.080] (-390.864) (-393.701) * (-391.215) (-393.315) (-391.865) [-393.407] -- 0:00:47
      201000 -- (-391.476) (-390.010) [-392.464] (-390.870) * (-394.010) (-393.014) (-392.419) [-394.553] -- 0:00:47
      201500 -- (-396.613) (-389.038) (-390.002) [-390.699] * (-392.689) (-393.567) (-395.090) [-390.131] -- 0:00:47
      202000 -- (-391.307) (-389.015) [-390.530] (-393.837) * (-390.652) [-391.019] (-391.752) (-393.925) -- 0:00:47
      202500 -- (-391.533) [-392.618] (-388.866) (-393.395) * (-390.176) [-394.159] (-391.172) (-390.585) -- 0:00:47
      203000 -- (-395.685) (-389.006) [-389.376] (-391.546) * (-394.449) (-393.476) (-391.380) [-391.135] -- 0:00:47
      203500 -- (-392.857) [-393.281] (-390.919) (-390.887) * (-390.565) (-390.846) (-392.885) [-391.579] -- 0:00:46
      204000 -- [-391.819] (-391.322) (-391.865) (-391.589) * (-390.750) [-389.195] (-392.939) (-390.073) -- 0:00:46
      204500 -- [-389.802] (-394.352) (-392.590) (-389.409) * (-390.350) (-391.072) [-392.375] (-392.899) -- 0:00:46
      205000 -- (-390.917) [-393.776] (-390.676) (-389.247) * (-390.004) (-389.818) (-391.475) [-393.101] -- 0:00:46

      Average standard deviation of split frequencies: 0.015537

      205500 -- [-392.256] (-392.745) (-390.528) (-390.502) * (-394.631) [-390.219] (-391.355) (-390.843) -- 0:00:46
      206000 -- (-394.872) (-389.789) [-389.112] (-391.971) * (-391.404) (-390.063) [-390.162] (-394.478) -- 0:00:50
      206500 -- (-392.081) [-390.304] (-389.681) (-389.063) * (-391.173) (-392.768) (-392.843) [-391.272] -- 0:00:49
      207000 -- [-391.880] (-392.566) (-391.592) (-389.994) * [-389.255] (-391.202) (-389.716) (-393.541) -- 0:00:49
      207500 -- (-395.657) [-390.515] (-391.825) (-394.229) * [-391.251] (-392.815) (-391.677) (-390.010) -- 0:00:49
      208000 -- (-391.410) (-394.165) (-395.689) [-391.676] * (-392.072) (-394.991) (-394.215) [-390.222] -- 0:00:49
      208500 -- [-389.025] (-390.691) (-392.270) (-389.627) * (-390.832) [-390.766] (-389.966) (-391.405) -- 0:00:49
      209000 -- (-389.183) [-390.433] (-393.654) (-390.939) * [-389.249] (-391.505) (-390.964) (-391.572) -- 0:00:49
      209500 -- (-394.384) (-391.887) [-392.302] (-390.283) * (-392.173) [-389.990] (-391.880) (-393.533) -- 0:00:49
      210000 -- (-391.395) (-391.995) [-391.342] (-389.587) * (-391.456) (-390.639) [-391.358] (-392.767) -- 0:00:48

      Average standard deviation of split frequencies: 0.015401

      210500 -- (-391.995) (-390.504) (-390.349) [-390.939] * [-390.566] (-392.246) (-394.165) (-392.087) -- 0:00:48
      211000 -- [-392.496] (-390.577) (-393.154) (-391.766) * (-390.466) [-391.105] (-391.123) (-394.926) -- 0:00:48
      211500 -- (-392.898) [-394.573] (-390.414) (-392.784) * (-390.374) (-391.047) (-389.785) [-391.159] -- 0:00:48
      212000 -- [-390.430] (-395.215) (-391.608) (-392.049) * (-391.559) (-389.919) (-389.130) [-391.820] -- 0:00:48
      212500 -- (-391.731) (-393.522) [-389.081] (-393.368) * (-391.722) (-389.894) (-390.274) [-393.977] -- 0:00:48
      213000 -- [-390.967] (-392.070) (-389.897) (-390.198) * (-389.496) (-390.292) [-390.892] (-390.361) -- 0:00:48
      213500 -- (-388.935) (-391.742) [-390.479] (-389.679) * (-392.605) [-389.759] (-392.001) (-393.413) -- 0:00:47
      214000 -- (-390.675) [-389.669] (-392.684) (-389.976) * (-392.953) (-389.947) [-391.278] (-388.839) -- 0:00:47
      214500 -- (-391.648) (-394.415) [-391.543] (-389.704) * (-394.821) (-390.896) [-390.833] (-389.693) -- 0:00:47
      215000 -- (-394.481) [-391.273] (-390.417) (-390.442) * (-391.286) (-389.867) [-390.301] (-393.191) -- 0:00:47

      Average standard deviation of split frequencies: 0.016176

      215500 -- [-391.495] (-391.078) (-389.767) (-391.492) * (-390.000) (-394.096) (-391.276) [-389.794] -- 0:00:47
      216000 -- (-394.823) (-390.548) (-389.686) [-390.859] * [-391.061] (-389.368) (-390.267) (-390.875) -- 0:00:47
      216500 -- (-391.356) (-390.215) (-392.482) [-389.785] * (-388.897) [-389.461] (-393.721) (-389.599) -- 0:00:47
      217000 -- (-389.752) [-390.080] (-393.484) (-389.968) * (-391.590) (-389.574) (-393.465) [-391.433] -- 0:00:46
      217500 -- (-389.548) [-389.512] (-391.844) (-396.344) * (-389.226) [-390.496] (-392.624) (-389.097) -- 0:00:46
      218000 -- [-392.626] (-390.111) (-388.968) (-396.877) * (-390.108) [-391.431] (-390.619) (-389.310) -- 0:00:46
      218500 -- (-390.225) [-391.105] (-390.357) (-393.223) * (-392.253) (-400.860) [-389.737] (-389.904) -- 0:00:46
      219000 -- (-393.528) [-390.028] (-388.990) (-398.224) * (-390.239) (-390.616) (-391.779) [-389.872] -- 0:00:46
      219500 -- (-395.151) [-391.846] (-388.879) (-394.657) * [-390.561] (-395.385) (-392.174) (-392.953) -- 0:00:46
      220000 -- (-395.136) (-390.876) [-392.612] (-389.946) * (-393.388) (-391.015) (-391.812) [-394.763] -- 0:00:46

      Average standard deviation of split frequencies: 0.016713

      220500 -- (-389.581) (-394.521) [-390.201] (-390.166) * (-391.679) (-391.878) [-392.816] (-389.740) -- 0:00:45
      221000 -- (-390.363) (-390.628) [-391.952] (-393.770) * [-392.283] (-390.536) (-394.661) (-391.561) -- 0:00:45
      221500 -- [-389.803] (-396.402) (-392.816) (-393.734) * [-394.311] (-389.471) (-390.122) (-392.946) -- 0:00:45
      222000 -- (-394.032) (-392.270) [-389.458] (-391.527) * (-389.575) (-389.347) (-391.563) [-390.821] -- 0:00:45
      222500 -- (-389.565) [-392.192] (-393.711) (-390.360) * (-394.836) (-389.222) [-391.669] (-390.300) -- 0:00:45
      223000 -- [-389.922] (-391.238) (-389.260) (-389.617) * (-396.153) [-390.799] (-389.302) (-388.951) -- 0:00:48
      223500 -- (-390.076) (-389.245) [-388.958] (-392.214) * (-390.623) (-389.739) (-391.904) [-391.480] -- 0:00:48
      224000 -- [-389.716] (-392.813) (-389.013) (-394.235) * (-392.465) (-391.047) [-389.809] (-392.063) -- 0:00:48
      224500 -- (-391.970) (-390.891) (-390.049) [-390.469] * (-388.990) (-390.604) [-391.863] (-390.504) -- 0:00:48
      225000 -- (-391.295) (-392.593) (-392.530) [-389.440] * (-392.310) [-390.953] (-389.085) (-391.064) -- 0:00:48

      Average standard deviation of split frequencies: 0.016919

      225500 -- [-390.694] (-390.824) (-391.513) (-389.590) * (-391.598) [-390.713] (-390.043) (-391.434) -- 0:00:48
      226000 -- [-389.964] (-393.233) (-390.675) (-391.311) * [-390.432] (-390.242) (-391.544) (-393.769) -- 0:00:47
      226500 -- (-393.367) (-391.033) (-389.868) [-392.620] * (-391.261) [-394.903] (-393.625) (-389.331) -- 0:00:47
      227000 -- (-394.398) [-391.011] (-391.222) (-393.836) * (-389.039) (-390.501) (-389.757) [-390.479] -- 0:00:47
      227500 -- (-394.517) (-390.102) (-389.680) [-390.417] * (-391.138) [-392.521] (-389.217) (-390.825) -- 0:00:47
      228000 -- (-390.838) (-392.914) (-395.090) [-389.296] * (-393.732) [-392.518] (-388.675) (-391.450) -- 0:00:47
      228500 -- [-391.736] (-390.760) (-393.858) (-394.866) * [-390.356] (-389.966) (-389.678) (-391.419) -- 0:00:47
      229000 -- (-390.799) [-389.758] (-388.927) (-393.204) * (-394.252) [-390.489] (-391.161) (-394.131) -- 0:00:47
      229500 -- (-392.977) (-390.356) (-389.623) [-390.816] * (-391.040) [-389.698] (-392.454) (-391.873) -- 0:00:47
      230000 -- [-390.336] (-390.142) (-390.457) (-390.102) * (-393.209) (-390.542) (-391.206) [-391.268] -- 0:00:46

      Average standard deviation of split frequencies: 0.015704

      230500 -- (-391.373) (-392.210) [-391.657] (-392.138) * (-390.623) (-391.290) [-391.146] (-390.734) -- 0:00:46
      231000 -- (-388.920) (-392.018) (-396.244) [-389.132] * (-389.849) (-389.722) (-394.921) [-390.637] -- 0:00:46
      231500 -- (-395.476) (-390.612) (-394.240) [-388.805] * [-394.633] (-391.308) (-390.718) (-392.846) -- 0:00:46
      232000 -- (-392.083) (-391.009) (-389.301) [-390.236] * (-395.138) (-397.300) (-391.070) [-390.331] -- 0:00:46
      232500 -- (-389.744) [-389.952] (-389.455) (-395.566) * (-390.878) (-393.331) [-390.166] (-393.693) -- 0:00:46
      233000 -- (-389.332) (-389.535) [-394.195] (-390.014) * (-392.726) (-392.372) [-390.737] (-391.833) -- 0:00:46
      233500 -- (-390.138) (-390.684) (-389.585) [-391.337] * (-391.363) (-391.890) [-395.078] (-389.773) -- 0:00:45
      234000 -- (-389.488) (-390.684) (-388.988) [-392.379] * (-390.203) (-391.054) [-393.055] (-390.124) -- 0:00:45
      234500 -- [-390.092] (-390.915) (-389.132) (-394.229) * (-390.320) (-392.574) [-390.220] (-390.599) -- 0:00:45
      235000 -- (-391.548) (-390.587) [-388.886] (-389.633) * (-390.665) (-391.737) (-390.547) [-390.260] -- 0:00:45

      Average standard deviation of split frequencies: 0.015510

      235500 -- [-391.674] (-395.557) (-390.543) (-390.496) * [-390.509] (-391.325) (-392.870) (-390.863) -- 0:00:45
      236000 -- (-388.963) [-390.190] (-391.014) (-391.759) * (-391.086) (-391.164) (-390.346) [-391.704] -- 0:00:45
      236500 -- (-390.474) (-392.013) [-392.481] (-391.208) * (-390.937) [-391.359] (-390.472) (-390.521) -- 0:00:45
      237000 -- [-389.233] (-392.579) (-393.426) (-393.611) * (-389.674) (-391.708) [-390.917] (-392.192) -- 0:00:45
      237500 -- (-391.592) [-393.627] (-390.584) (-390.993) * (-393.562) [-392.455] (-390.704) (-393.515) -- 0:00:44
      238000 -- (-388.901) (-392.874) [-390.038] (-390.262) * (-393.048) [-389.820] (-393.412) (-390.377) -- 0:00:44
      238500 -- (-392.514) (-390.673) (-392.251) [-389.745] * (-390.223) (-392.678) [-390.759] (-389.743) -- 0:00:44
      239000 -- (-389.571) [-391.016] (-388.623) (-390.800) * (-390.053) (-390.188) (-388.741) [-392.711] -- 0:00:44
      239500 -- (-395.329) (-389.817) [-390.244] (-390.417) * (-393.405) (-389.711) (-389.564) [-389.455] -- 0:00:47
      240000 -- (-393.548) [-389.741] (-391.411) (-392.101) * (-391.745) [-389.372] (-389.053) (-390.165) -- 0:00:47

      Average standard deviation of split frequencies: 0.016541

      240500 -- (-390.283) (-392.883) [-389.421] (-391.321) * (-391.182) [-390.760] (-396.466) (-390.619) -- 0:00:47
      241000 -- (-389.609) [-391.312] (-392.035) (-390.889) * (-390.426) (-389.694) (-395.652) [-391.514] -- 0:00:47
      241500 -- (-389.427) (-390.004) (-390.601) [-390.636] * [-389.875] (-390.915) (-394.350) (-390.027) -- 0:00:47
      242000 -- [-389.887] (-390.555) (-395.853) (-389.672) * (-392.419) (-392.261) (-390.242) [-391.832] -- 0:00:46
      242500 -- (-390.533) (-389.477) [-393.028] (-391.657) * (-392.535) (-389.462) (-391.921) [-391.495] -- 0:00:46
      243000 -- (-390.476) (-389.337) (-390.322) [-389.154] * (-395.009) (-389.326) (-390.470) [-392.076] -- 0:00:46
      243500 -- (-391.673) (-388.967) (-393.588) [-390.266] * (-389.458) (-389.961) (-391.747) [-391.461] -- 0:00:46
      244000 -- (-391.115) [-390.029] (-396.605) (-391.106) * [-391.840] (-390.052) (-390.403) (-392.809) -- 0:00:46
      244500 -- (-393.737) [-390.434] (-392.673) (-389.834) * (-390.401) (-392.811) [-388.958] (-388.792) -- 0:00:46
      245000 -- (-393.219) (-391.011) [-391.264] (-390.370) * (-390.283) (-393.460) (-391.466) [-388.971] -- 0:00:46

      Average standard deviation of split frequencies: 0.015935

      245500 -- (-390.903) [-390.957] (-395.489) (-389.802) * (-391.187) (-392.622) [-393.538] (-390.517) -- 0:00:46
      246000 -- (-389.623) [-392.166] (-393.172) (-390.281) * (-389.589) [-396.544] (-393.553) (-392.186) -- 0:00:45
      246500 -- (-390.551) (-389.053) [-389.504] (-390.346) * (-389.688) (-393.679) [-391.327] (-389.232) -- 0:00:45
      247000 -- [-390.626] (-390.638) (-391.677) (-391.704) * (-390.813) [-390.797] (-389.687) (-399.538) -- 0:00:45
      247500 -- (-391.905) [-394.676] (-392.304) (-392.443) * (-389.877) (-390.719) [-389.607] (-390.182) -- 0:00:45
      248000 -- (-391.234) [-391.026] (-388.945) (-391.810) * [-391.642] (-394.671) (-388.931) (-388.882) -- 0:00:45
      248500 -- (-391.495) (-393.726) (-389.408) [-389.002] * [-391.221] (-392.621) (-389.527) (-390.049) -- 0:00:45
      249000 -- (-391.443) (-390.568) (-390.431) [-390.347] * [-391.379] (-390.548) (-389.347) (-392.234) -- 0:00:45
      249500 -- [-390.276] (-389.381) (-391.310) (-392.161) * (-391.224) (-390.651) (-391.605) [-388.674] -- 0:00:45
      250000 -- (-390.115) (-389.855) (-391.221) [-390.257] * (-391.484) (-392.063) (-389.195) [-391.543] -- 0:00:45

      Average standard deviation of split frequencies: 0.016716

      250500 -- (-390.048) (-390.138) [-389.892] (-391.256) * [-389.616] (-389.248) (-392.705) (-390.153) -- 0:00:44
      251000 -- (-391.194) (-392.938) [-389.758] (-389.364) * [-389.046] (-391.512) (-392.835) (-389.630) -- 0:00:44
      251500 -- (-392.072) (-390.425) (-393.314) [-391.016] * (-389.364) (-391.743) [-389.547] (-390.278) -- 0:00:44
      252000 -- [-395.213] (-390.038) (-392.978) (-389.498) * [-393.362] (-390.856) (-391.088) (-393.708) -- 0:00:44
      252500 -- (-393.274) (-390.998) [-391.023] (-388.927) * (-395.032) (-390.970) [-392.135] (-392.415) -- 0:00:44
      253000 -- (-391.537) (-392.296) [-391.451] (-389.427) * (-392.699) (-389.878) (-394.138) [-392.367] -- 0:00:44
      253500 -- [-393.820] (-390.192) (-390.459) (-390.950) * (-393.070) (-391.078) (-394.392) [-391.236] -- 0:00:44
      254000 -- [-394.002] (-389.327) (-391.328) (-393.070) * (-390.464) [-391.665] (-393.397) (-391.235) -- 0:00:44
      254500 -- (-390.643) [-389.047] (-393.384) (-389.950) * [-390.483] (-391.170) (-390.881) (-390.946) -- 0:00:43
      255000 -- (-390.194) (-389.660) [-389.129] (-390.641) * (-389.254) (-389.992) (-389.147) [-389.319] -- 0:00:43

      Average standard deviation of split frequencies: 0.016464

      255500 -- (-389.518) (-394.151) (-390.728) [-390.443] * [-392.675] (-394.424) (-392.366) (-391.406) -- 0:00:43
      256000 -- (-389.889) (-392.329) [-391.392] (-390.871) * (-390.992) (-394.790) [-392.005] (-389.446) -- 0:00:43
      256500 -- (-394.084) [-390.459] (-389.243) (-389.812) * (-391.959) [-392.390] (-391.719) (-393.100) -- 0:00:46
      257000 -- (-390.905) (-391.695) (-392.094) [-389.872] * (-390.636) (-392.131) (-392.156) [-391.177] -- 0:00:46
      257500 -- (-390.068) (-389.429) (-392.051) [-388.768] * (-392.851) [-391.445] (-391.097) (-395.750) -- 0:00:46
      258000 -- (-399.062) (-389.367) [-390.839] (-390.034) * (-391.041) (-389.481) [-392.144] (-391.285) -- 0:00:46
      258500 -- [-391.217] (-391.816) (-391.368) (-390.429) * [-389.767] (-391.133) (-392.612) (-391.254) -- 0:00:45
      259000 -- (-393.659) (-390.676) [-389.825] (-388.960) * (-389.351) [-389.738] (-398.237) (-390.745) -- 0:00:45
      259500 -- [-389.956] (-392.525) (-392.309) (-393.478) * (-390.505) [-390.002] (-391.358) (-389.995) -- 0:00:45
      260000 -- (-392.042) (-395.470) [-392.764] (-393.808) * (-392.032) [-392.216] (-390.304) (-390.378) -- 0:00:45

      Average standard deviation of split frequencies: 0.015975

      260500 -- (-392.324) [-392.372] (-391.885) (-394.773) * [-393.220] (-393.014) (-389.890) (-393.091) -- 0:00:45
      261000 -- (-393.114) [-390.083] (-390.823) (-392.277) * [-392.953] (-391.985) (-391.585) (-389.612) -- 0:00:45
      261500 -- (-390.441) [-389.454] (-391.649) (-389.125) * (-390.622) [-391.588] (-391.221) (-389.597) -- 0:00:45
      262000 -- [-389.597] (-390.123) (-392.699) (-391.531) * (-389.535) (-393.266) (-390.251) [-392.409] -- 0:00:45
      262500 -- (-392.812) (-392.922) (-391.125) [-390.608] * [-389.971] (-391.260) (-394.882) (-390.044) -- 0:00:44
      263000 -- (-391.297) (-395.395) (-390.748) [-389.017] * (-392.693) [-390.101] (-391.158) (-390.072) -- 0:00:44
      263500 -- (-392.884) (-391.026) [-389.829] (-390.352) * [-391.633] (-391.232) (-391.323) (-391.110) -- 0:00:44
      264000 -- (-392.807) (-390.725) [-389.197] (-389.088) * (-390.330) (-390.061) [-390.857] (-397.407) -- 0:00:44
      264500 -- (-389.682) [-391.082] (-390.372) (-390.467) * (-389.635) (-391.329) (-394.176) [-400.019] -- 0:00:44
      265000 -- [-389.255] (-390.473) (-389.621) (-389.142) * (-391.452) (-390.141) (-391.016) [-393.091] -- 0:00:44

      Average standard deviation of split frequencies: 0.017162

      265500 -- (-389.020) (-391.913) (-389.055) [-390.717] * (-392.787) [-390.975] (-391.961) (-395.143) -- 0:00:44
      266000 -- (-394.021) [-392.823] (-388.891) (-392.268) * [-389.239] (-392.547) (-392.832) (-393.319) -- 0:00:44
      266500 -- [-390.285] (-398.530) (-391.625) (-396.581) * [-390.341] (-389.282) (-391.317) (-390.151) -- 0:00:44
      267000 -- (-394.021) (-390.902) [-391.878] (-394.267) * (-389.781) (-392.599) (-390.807) [-391.181] -- 0:00:43
      267500 -- (-396.133) [-389.674] (-390.247) (-393.805) * (-390.274) (-388.633) [-395.741] (-392.121) -- 0:00:43
      268000 -- (-392.251) (-389.654) (-390.271) [-392.105] * (-390.340) (-393.093) (-392.813) [-390.800] -- 0:00:43
      268500 -- (-391.684) (-393.757) [-392.631] (-389.131) * (-391.996) [-391.207] (-391.580) (-389.947) -- 0:00:43
      269000 -- [-391.146] (-390.249) (-392.636) (-390.726) * (-389.996) [-391.900] (-390.065) (-389.350) -- 0:00:43
      269500 -- (-393.763) (-389.203) [-389.417] (-394.685) * [-395.263] (-389.702) (-390.107) (-392.665) -- 0:00:43
      270000 -- [-391.436] (-391.452) (-389.222) (-391.092) * (-389.091) (-390.150) (-390.279) [-389.898] -- 0:00:43

      Average standard deviation of split frequencies: 0.017050

      270500 -- (-389.768) [-392.151] (-389.965) (-390.927) * [-389.880] (-389.677) (-390.887) (-390.439) -- 0:00:43
      271000 -- [-390.606] (-389.747) (-391.047) (-390.437) * (-389.901) [-391.987] (-390.783) (-390.536) -- 0:00:43
      271500 -- (-400.061) [-388.964] (-392.017) (-395.801) * (-396.643) (-398.163) [-390.013] (-392.168) -- 0:00:42
      272000 -- (-391.518) [-392.159] (-392.831) (-390.492) * (-391.003) (-391.800) [-390.276] (-392.479) -- 0:00:42
      272500 -- (-390.355) (-389.706) [-392.063] (-392.891) * [-390.571] (-392.702) (-391.657) (-388.879) -- 0:00:42
      273000 -- (-393.024) (-390.614) (-391.863) [-390.325] * (-390.676) [-388.835] (-388.943) (-389.138) -- 0:00:42
      273500 -- (-392.973) (-391.186) (-392.924) [-389.504] * (-392.759) (-391.217) (-392.763) [-391.171] -- 0:00:45
      274000 -- [-389.744] (-389.611) (-392.568) (-390.750) * (-390.812) (-390.410) [-389.621] (-390.409) -- 0:00:45
      274500 -- (-390.897) (-391.459) (-390.673) [-389.111] * [-390.674] (-390.066) (-391.744) (-395.399) -- 0:00:44
      275000 -- (-393.031) [-389.752] (-394.693) (-388.999) * (-392.144) [-390.894] (-388.687) (-394.589) -- 0:00:44

      Average standard deviation of split frequencies: 0.017839

      275500 -- (-393.193) [-389.192] (-394.880) (-390.298) * (-391.337) (-388.769) [-391.780] (-393.298) -- 0:00:44
      276000 -- [-390.882] (-390.263) (-388.794) (-389.711) * (-390.197) (-391.045) [-390.717] (-392.509) -- 0:00:44
      276500 -- (-390.961) [-388.980] (-389.746) (-390.589) * (-390.270) (-389.798) [-390.589] (-392.448) -- 0:00:44
      277000 -- [-396.549] (-390.039) (-389.949) (-391.367) * (-392.808) (-391.755) [-393.488] (-390.274) -- 0:00:44
      277500 -- (-390.513) (-390.061) (-390.638) [-393.064] * (-389.995) (-392.411) [-392.033] (-392.374) -- 0:00:44
      278000 -- (-390.647) (-391.681) [-390.977] (-389.238) * [-390.160] (-391.814) (-390.828) (-391.841) -- 0:00:44
      278500 -- (-390.433) (-390.992) (-393.532) [-392.329] * (-390.266) (-392.118) [-389.081] (-394.016) -- 0:00:44
      279000 -- (-390.123) [-391.717] (-390.619) (-393.937) * (-389.297) (-389.751) (-391.446) [-390.619] -- 0:00:43
      279500 -- (-389.639) (-391.578) (-390.097) [-391.728] * (-389.978) (-389.772) (-391.821) [-390.773] -- 0:00:43
      280000 -- (-394.353) [-389.571] (-389.315) (-391.091) * [-391.806] (-389.214) (-400.012) (-390.643) -- 0:00:43

      Average standard deviation of split frequencies: 0.018569

      280500 -- [-390.813] (-389.597) (-389.715) (-390.649) * (-392.920) [-389.572] (-395.335) (-389.459) -- 0:00:43
      281000 -- (-395.062) (-390.581) [-395.297] (-393.905) * (-392.292) [-390.107] (-392.868) (-390.017) -- 0:00:43
      281500 -- (-391.121) (-390.660) (-391.365) [-391.228] * [-391.102] (-390.888) (-398.074) (-389.882) -- 0:00:43
      282000 -- (-390.891) [-389.190] (-395.562) (-391.064) * (-392.667) (-392.194) [-390.052] (-390.226) -- 0:00:43
      282500 -- (-391.341) (-394.698) (-393.117) [-388.902] * (-392.636) (-391.307) (-391.212) [-391.916] -- 0:00:43
      283000 -- (-393.377) (-391.927) [-393.940] (-390.666) * (-391.246) [-390.011] (-390.508) (-393.766) -- 0:00:43
      283500 -- (-394.463) [-391.460] (-392.213) (-390.750) * (-395.919) (-389.953) [-389.568] (-390.981) -- 0:00:42
      284000 -- (-391.619) [-392.838] (-393.602) (-389.006) * [-392.148] (-389.308) (-392.170) (-389.782) -- 0:00:42
      284500 -- (-391.171) (-390.304) (-389.524) [-389.316] * (-391.783) [-389.949] (-395.215) (-394.677) -- 0:00:42
      285000 -- (-392.106) [-389.319] (-393.382) (-393.029) * [-389.423] (-392.258) (-395.346) (-390.651) -- 0:00:42

      Average standard deviation of split frequencies: 0.018589

      285500 -- (-389.694) (-392.993) (-390.458) [-392.163] * (-389.867) (-388.896) [-389.341] (-392.645) -- 0:00:42
      286000 -- (-389.222) (-389.015) [-391.033] (-399.911) * (-390.943) [-389.138] (-392.037) (-396.501) -- 0:00:42
      286500 -- [-392.498] (-391.539) (-389.995) (-397.594) * (-389.943) (-391.748) [-391.744] (-393.077) -- 0:00:42
      287000 -- (-389.724) [-389.520] (-390.570) (-391.356) * (-390.924) (-394.398) [-389.195] (-389.788) -- 0:00:42
      287500 -- [-389.951] (-392.533) (-397.294) (-393.801) * (-388.874) [-392.486] (-389.611) (-391.452) -- 0:00:42
      288000 -- [-391.981] (-391.189) (-392.480) (-392.903) * [-389.676] (-393.693) (-388.897) (-398.951) -- 0:00:42
      288500 -- (-391.571) (-389.298) [-391.879] (-392.536) * (-390.952) [-390.375] (-394.549) (-392.535) -- 0:00:41
      289000 -- (-392.170) (-391.220) [-394.610] (-394.795) * (-391.066) (-390.345) (-389.451) [-393.919] -- 0:00:41
      289500 -- (-392.055) (-390.475) [-389.944] (-390.149) * (-390.176) [-389.922] (-391.637) (-394.756) -- 0:00:41
      290000 -- (-389.488) (-390.310) (-392.437) [-391.043] * [-391.049] (-391.628) (-390.820) (-389.707) -- 0:00:41

      Average standard deviation of split frequencies: 0.018561

      290500 -- (-392.360) [-394.695] (-389.812) (-389.848) * (-394.670) [-390.912] (-392.319) (-388.968) -- 0:00:43
      291000 -- (-392.305) (-390.580) [-390.638] (-389.631) * [-393.848] (-390.138) (-390.022) (-391.729) -- 0:00:43
      291500 -- (-391.410) (-394.903) [-392.833] (-390.328) * (-391.891) (-392.575) (-390.385) [-393.318] -- 0:00:43
      292000 -- (-394.809) (-392.022) (-394.315) [-390.548] * [-389.448] (-395.239) (-391.007) (-392.623) -- 0:00:43
      292500 -- (-391.534) (-389.128) [-390.281] (-389.247) * [-389.223] (-392.069) (-391.068) (-395.414) -- 0:00:43
      293000 -- [-391.046] (-389.132) (-392.457) (-389.302) * (-392.425) (-389.359) [-390.711] (-391.914) -- 0:00:43
      293500 -- [-389.238] (-391.546) (-390.345) (-392.946) * (-390.247) (-394.321) [-393.136] (-390.412) -- 0:00:43
      294000 -- (-393.525) (-391.407) (-392.760) [-390.761] * (-390.430) (-391.089) [-391.271] (-390.476) -- 0:00:43
      294500 -- (-390.623) (-390.468) (-391.944) [-391.227] * (-389.994) [-388.952] (-397.714) (-389.720) -- 0:00:43
      295000 -- [-391.162] (-394.529) (-389.806) (-393.835) * [-390.278] (-389.828) (-394.236) (-388.890) -- 0:00:43

      Average standard deviation of split frequencies: 0.017854

      295500 -- (-393.551) [-390.039] (-390.788) (-392.270) * (-391.715) (-393.003) (-391.406) [-392.275] -- 0:00:42
      296000 -- (-389.492) [-389.447] (-392.186) (-392.162) * (-391.637) [-391.066] (-391.549) (-392.500) -- 0:00:42
      296500 -- (-389.994) (-390.372) [-390.632] (-395.534) * (-392.559) (-393.620) [-395.067] (-390.539) -- 0:00:42
      297000 -- [-391.312] (-392.414) (-391.946) (-393.253) * (-391.642) [-393.608] (-391.179) (-389.926) -- 0:00:42
      297500 -- (-389.983) (-393.215) (-392.757) [-392.019] * (-390.389) (-395.210) (-389.871) [-390.862] -- 0:00:42
      298000 -- (-391.539) (-397.382) (-390.470) [-390.815] * (-389.791) (-392.480) (-390.507) [-390.103] -- 0:00:42
      298500 -- (-390.387) [-391.676] (-394.422) (-395.968) * (-388.646) (-390.527) (-390.255) [-390.687] -- 0:00:42
      299000 -- (-390.432) (-393.624) (-392.152) [-389.502] * (-388.799) (-393.128) (-393.943) [-391.052] -- 0:00:42
      299500 -- (-390.368) (-390.020) (-393.555) [-396.526] * (-389.717) [-390.982] (-390.532) (-394.605) -- 0:00:42
      300000 -- [-390.631] (-392.258) (-390.853) (-392.896) * (-394.798) (-390.197) [-389.895] (-389.733) -- 0:00:42

      Average standard deviation of split frequencies: 0.016724

      300500 -- (-392.435) [-390.388] (-389.317) (-390.054) * (-390.275) (-389.789) [-390.257] (-391.696) -- 0:00:41
      301000 -- (-392.240) [-390.409] (-389.610) (-390.523) * (-389.216) [-393.331] (-391.064) (-389.909) -- 0:00:41
      301500 -- (-397.638) [-390.406] (-390.853) (-393.504) * (-390.278) (-390.639) (-391.631) [-390.701] -- 0:00:41
      302000 -- [-392.015] (-390.972) (-390.119) (-389.954) * (-389.819) (-392.566) (-391.250) [-394.750] -- 0:00:41
      302500 -- (-398.199) (-389.685) [-390.323] (-395.027) * (-390.571) (-391.757) (-391.573) [-390.422] -- 0:00:41
      303000 -- (-391.329) (-390.244) (-391.532) [-389.302] * (-390.387) [-389.827] (-391.135) (-391.827) -- 0:00:41
      303500 -- (-392.536) (-390.507) (-390.213) [-396.051] * (-389.072) (-390.634) (-394.263) [-389.773] -- 0:00:41
      304000 -- (-390.426) (-390.581) [-389.479] (-392.062) * (-389.898) [-391.432] (-394.119) (-391.421) -- 0:00:41
      304500 -- [-391.437] (-393.033) (-388.768) (-390.762) * [-389.230] (-392.313) (-389.834) (-392.165) -- 0:00:41
      305000 -- (-390.550) [-389.832] (-390.465) (-391.572) * [-390.706] (-390.842) (-389.511) (-394.008) -- 0:00:41

      Average standard deviation of split frequencies: 0.017108

      305500 -- (-390.013) (-390.136) [-390.349] (-390.524) * (-390.818) [-388.676] (-389.473) (-392.365) -- 0:00:40
      306000 -- (-390.496) (-389.822) [-390.135] (-390.225) * (-392.032) (-390.177) [-390.648] (-390.515) -- 0:00:40
      306500 -- [-391.564] (-392.160) (-391.120) (-391.022) * (-400.705) [-391.328] (-391.101) (-391.147) -- 0:00:40
      307000 -- (-395.262) (-389.576) (-391.188) [-390.045] * [-393.041] (-391.511) (-392.728) (-390.668) -- 0:00:42
      307500 -- (-394.780) [-390.521] (-390.006) (-390.695) * (-391.318) [-391.575] (-392.280) (-389.550) -- 0:00:42
      308000 -- [-393.390] (-389.153) (-391.552) (-391.582) * [-391.668] (-390.485) (-391.363) (-391.625) -- 0:00:42
      308500 -- (-394.873) (-390.984) [-390.587] (-390.461) * (-390.737) (-388.896) (-391.395) [-392.408] -- 0:00:42
      309000 -- (-391.421) [-391.205] (-390.128) (-395.260) * (-390.279) [-390.608] (-389.281) (-390.612) -- 0:00:42
      309500 -- (-391.763) (-393.478) (-389.956) [-390.678] * (-392.528) (-394.078) [-389.389] (-392.531) -- 0:00:42
      310000 -- (-394.782) [-389.225] (-389.098) (-391.036) * (-391.728) (-390.221) [-389.952] (-391.189) -- 0:00:42

      Average standard deviation of split frequencies: 0.017730

      310500 -- (-389.845) [-391.062] (-390.843) (-392.557) * (-391.140) (-395.457) (-391.421) [-389.569] -- 0:00:42
      311000 -- (-390.708) [-388.848] (-390.397) (-394.102) * (-391.481) (-390.335) (-395.637) [-389.820] -- 0:00:42
      311500 -- (-392.859) (-390.822) [-391.596] (-394.722) * (-393.378) (-390.154) (-391.053) [-394.105] -- 0:00:41
      312000 -- (-392.728) (-392.260) [-388.934] (-390.742) * [-391.963] (-391.836) (-389.123) (-392.374) -- 0:00:41
      312500 -- (-394.936) (-391.913) (-388.967) [-389.212] * [-390.092] (-392.457) (-392.358) (-391.495) -- 0:00:41
      313000 -- (-391.220) (-389.768) [-389.962] (-390.046) * (-390.605) (-390.514) [-393.837] (-395.946) -- 0:00:41
      313500 -- [-390.391] (-391.619) (-389.070) (-391.739) * [-394.450] (-396.163) (-392.440) (-391.933) -- 0:00:41
      314000 -- [-389.137] (-391.267) (-389.393) (-390.441) * [-390.161] (-393.762) (-392.937) (-395.596) -- 0:00:41
      314500 -- (-389.475) (-391.588) (-393.292) [-389.868] * (-389.109) (-391.709) [-392.157] (-390.204) -- 0:00:41
      315000 -- [-391.185] (-389.954) (-394.483) (-391.642) * (-390.510) (-389.088) [-390.249] (-389.416) -- 0:00:41

      Average standard deviation of split frequencies: 0.017980

      315500 -- (-390.555) (-391.509) [-392.640] (-389.271) * (-389.099) [-388.995] (-388.700) (-390.463) -- 0:00:41
      316000 -- (-389.099) (-391.591) [-393.181] (-390.115) * (-390.053) (-391.384) (-389.492) [-390.701] -- 0:00:41
      316500 -- [-389.675] (-394.414) (-389.612) (-389.741) * (-390.893) (-391.929) (-389.468) [-389.045] -- 0:00:41
      317000 -- (-395.548) (-389.376) [-389.713] (-391.983) * (-388.670) (-392.985) (-390.406) [-396.245] -- 0:00:40
      317500 -- [-389.284] (-388.750) (-389.217) (-390.570) * (-391.141) [-392.565] (-390.226) (-400.919) -- 0:00:40
      318000 -- (-390.428) (-390.214) [-390.073] (-390.747) * (-392.486) [-391.418] (-395.842) (-391.885) -- 0:00:40
      318500 -- (-390.440) (-390.357) (-396.489) [-394.728] * [-391.950] (-391.053) (-393.508) (-389.970) -- 0:00:40
      319000 -- [-390.274] (-392.080) (-388.781) (-392.130) * [-390.494] (-390.476) (-389.646) (-390.599) -- 0:00:40
      319500 -- [-391.153] (-389.483) (-390.990) (-390.608) * (-391.510) [-393.052] (-391.991) (-390.113) -- 0:00:40
      320000 -- (-392.840) (-389.351) (-389.259) [-391.876] * [-389.232] (-389.768) (-389.647) (-389.424) -- 0:00:40

      Average standard deviation of split frequencies: 0.018028

      320500 -- (-393.986) (-392.335) (-390.929) [-389.503] * (-389.217) (-390.697) (-390.622) [-389.330] -- 0:00:40
      321000 -- [-390.267] (-395.208) (-392.356) (-392.909) * (-391.436) [-390.298] (-389.937) (-389.123) -- 0:00:40
      321500 -- (-394.881) (-396.713) [-389.971] (-391.025) * (-389.666) (-390.848) (-403.105) [-390.993] -- 0:00:40
      322000 -- (-390.541) (-394.018) [-390.014] (-390.184) * [-389.132] (-390.307) (-391.747) (-390.754) -- 0:00:40
      322500 -- (-390.821) (-390.933) (-390.421) [-390.647] * [-391.565] (-390.504) (-391.346) (-389.611) -- 0:00:39
      323000 -- (-394.314) (-395.357) [-389.895] (-389.210) * [-390.560] (-393.789) (-391.551) (-391.413) -- 0:00:39
      323500 -- [-390.293] (-394.073) (-390.384) (-389.270) * [-391.918] (-390.197) (-390.210) (-389.447) -- 0:00:39
      324000 -- [-390.430] (-393.700) (-392.954) (-389.083) * (-389.920) (-390.437) (-391.512) [-390.241] -- 0:00:41
      324500 -- (-391.297) [-391.958] (-389.426) (-393.840) * (-392.864) (-392.313) [-395.872] (-390.308) -- 0:00:41
      325000 -- (-392.566) [-391.815] (-389.940) (-393.271) * (-393.718) [-390.655] (-393.640) (-395.351) -- 0:00:41

      Average standard deviation of split frequencies: 0.017352

      325500 -- (-390.777) (-392.625) (-392.163) [-390.583] * (-389.311) [-389.862] (-391.501) (-397.587) -- 0:00:41
      326000 -- (-389.285) (-389.766) [-390.393] (-390.690) * (-390.616) (-392.672) [-390.617] (-395.096) -- 0:00:41
      326500 -- (-389.408) (-389.566) [-390.636] (-390.473) * (-391.594) (-392.479) (-391.014) [-391.178] -- 0:00:41
      327000 -- [-391.361] (-393.085) (-392.095) (-390.951) * (-393.873) (-390.844) [-391.435] (-390.953) -- 0:00:41
      327500 -- (-391.007) (-392.856) [-391.619] (-389.547) * (-397.959) [-389.655] (-395.070) (-389.032) -- 0:00:41
      328000 -- (-389.454) (-391.783) [-396.523] (-394.359) * (-391.298) [-390.711] (-391.080) (-389.008) -- 0:00:40
      328500 -- [-389.877] (-390.556) (-391.022) (-389.756) * (-391.069) (-390.595) (-392.731) [-391.423] -- 0:00:40
      329000 -- (-395.905) (-390.983) (-389.363) [-392.149] * (-393.539) (-391.423) (-393.049) [-389.493] -- 0:00:40
      329500 -- (-392.892) [-389.060] (-389.095) (-391.475) * (-393.318) [-389.265] (-389.970) (-394.769) -- 0:00:40
      330000 -- [-398.722] (-390.135) (-390.213) (-389.920) * (-392.190) [-389.375] (-395.057) (-397.162) -- 0:00:40

      Average standard deviation of split frequencies: 0.017257

      330500 -- (-392.905) (-390.729) [-390.268] (-391.068) * (-390.792) (-389.940) [-391.284] (-396.512) -- 0:00:40
      331000 -- (-394.350) (-394.243) [-389.314] (-391.605) * (-389.840) (-390.846) [-390.462] (-394.468) -- 0:00:40
      331500 -- (-391.240) (-391.765) [-388.937] (-391.061) * (-389.812) (-393.870) [-389.941] (-390.161) -- 0:00:40
      332000 -- (-390.170) (-391.740) [-389.908] (-395.935) * [-390.597] (-394.412) (-393.029) (-392.361) -- 0:00:40
      332500 -- (-394.334) (-390.427) (-392.895) [-391.625] * (-392.308) [-390.193] (-390.804) (-389.592) -- 0:00:40
      333000 -- (-390.375) (-389.692) [-395.757] (-391.292) * (-391.527) (-390.569) (-392.733) [-389.710] -- 0:00:40
      333500 -- [-389.592] (-396.253) (-391.393) (-394.081) * (-389.263) [-392.643] (-390.301) (-391.000) -- 0:00:39
      334000 -- (-390.293) (-390.902) [-392.769] (-393.030) * [-395.936] (-390.083) (-389.495) (-397.205) -- 0:00:39
      334500 -- [-390.477] (-390.946) (-394.434) (-390.557) * (-389.617) [-390.694] (-389.887) (-391.209) -- 0:00:39
      335000 -- (-389.575) (-390.669) (-389.840) [-396.071] * (-389.790) (-389.938) [-393.747] (-390.341) -- 0:00:39

      Average standard deviation of split frequencies: 0.016212

      335500 -- (-390.194) [-389.706] (-389.681) (-390.153) * (-389.794) (-390.166) (-390.590) [-392.093] -- 0:00:39
      336000 -- (-389.548) (-390.851) [-392.654] (-390.426) * (-393.372) [-389.997] (-391.416) (-390.532) -- 0:00:39
      336500 -- (-391.413) (-390.302) [-391.769] (-390.736) * (-392.942) (-393.751) [-393.624] (-390.207) -- 0:00:39
      337000 -- (-391.437) (-389.109) [-392.157] (-395.293) * (-392.117) (-394.293) [-389.420] (-392.255) -- 0:00:39
      337500 -- (-390.704) (-391.352) (-395.009) [-390.742] * (-392.829) (-392.212) (-393.410) [-392.126] -- 0:00:39
      338000 -- (-390.075) (-389.400) [-389.042] (-392.408) * (-390.926) (-391.137) [-391.210] (-391.438) -- 0:00:39
      338500 -- (-390.644) (-391.937) [-390.889] (-393.236) * [-391.297] (-392.660) (-389.659) (-389.809) -- 0:00:39
      339000 -- (-395.825) (-390.831) [-389.196] (-392.555) * [-394.757] (-391.391) (-391.036) (-389.878) -- 0:00:38
      339500 -- (-389.725) (-389.786) [-391.925] (-391.244) * (-390.963) (-391.432) (-392.056) [-391.282] -- 0:00:38
      340000 -- (-392.310) (-390.879) [-389.159] (-392.474) * (-391.618) [-391.093] (-390.387) (-392.773) -- 0:00:38

      Average standard deviation of split frequencies: 0.015140

      340500 -- (-391.271) (-390.410) [-393.255] (-391.601) * (-392.807) [-389.563] (-389.747) (-389.424) -- 0:00:40
      341000 -- (-391.326) [-391.046] (-390.930) (-390.551) * (-389.403) [-392.197] (-393.082) (-394.997) -- 0:00:40
      341500 -- (-389.141) [-389.237] (-390.267) (-392.065) * (-391.849) (-389.944) [-393.333] (-393.050) -- 0:00:40
      342000 -- (-393.736) (-389.317) (-390.702) [-390.289] * [-390.422] (-392.184) (-389.696) (-391.838) -- 0:00:40
      342500 -- [-389.717] (-388.905) (-390.403) (-393.896) * (-392.135) (-390.052) (-390.227) [-394.018] -- 0:00:40
      343000 -- (-394.699) [-391.019] (-390.609) (-390.554) * [-392.004] (-390.601) (-390.432) (-392.238) -- 0:00:40
      343500 -- (-390.123) [-390.302] (-388.766) (-391.101) * (-393.201) [-389.034] (-392.239) (-391.176) -- 0:00:40
      344000 -- (-390.561) (-390.041) [-389.605] (-389.602) * (-389.029) (-390.603) (-389.646) [-389.614] -- 0:00:40
      344500 -- (-392.143) [-391.249] (-392.306) (-389.728) * [-388.886] (-391.674) (-390.897) (-389.510) -- 0:00:39
      345000 -- (-389.049) (-400.004) [-390.810] (-391.135) * [-390.134] (-393.160) (-397.534) (-395.224) -- 0:00:39

      Average standard deviation of split frequencies: 0.015290

      345500 -- [-391.577] (-393.681) (-389.370) (-392.258) * [-389.924] (-393.718) (-393.196) (-391.661) -- 0:00:39
      346000 -- (-390.328) (-391.627) (-389.217) [-392.763] * (-391.552) (-394.979) (-392.117) [-389.089] -- 0:00:39
      346500 -- [-390.032] (-390.573) (-389.574) (-389.895) * (-393.346) [-389.964] (-389.798) (-391.987) -- 0:00:39
      347000 -- [-389.912] (-389.976) (-389.311) (-390.598) * (-390.380) (-394.177) [-389.325] (-390.160) -- 0:00:39
      347500 -- (-395.164) (-389.791) (-391.124) [-389.224] * (-393.145) (-390.390) (-388.896) [-390.350] -- 0:00:39
      348000 -- (-391.258) (-389.303) (-389.861) [-392.419] * [-395.856] (-390.465) (-388.886) (-390.777) -- 0:00:39
      348500 -- (-390.553) [-388.798] (-389.874) (-392.556) * (-389.803) (-389.515) (-391.246) [-390.164] -- 0:00:39
      349000 -- (-389.638) (-389.920) (-392.701) [-391.925] * (-391.609) (-390.338) [-391.794] (-390.166) -- 0:00:39
      349500 -- (-389.753) [-391.698] (-390.305) (-389.810) * (-389.808) [-391.057] (-390.096) (-394.047) -- 0:00:39
      350000 -- [-388.857] (-392.896) (-391.843) (-390.038) * [-389.963] (-389.565) (-395.163) (-392.366) -- 0:00:39

      Average standard deviation of split frequencies: 0.015385

      350500 -- [-389.787] (-391.922) (-394.783) (-389.796) * (-390.087) (-389.746) (-393.584) [-392.203] -- 0:00:38
      351000 -- (-391.215) (-390.786) (-397.554) [-391.350] * (-391.286) (-391.290) (-392.713) [-388.807] -- 0:00:38
      351500 -- (-395.892) [-389.697] (-395.175) (-392.329) * (-390.888) [-389.972] (-392.275) (-390.069) -- 0:00:38
      352000 -- (-395.127) (-389.831) (-391.281) [-389.008] * (-395.032) (-389.044) (-391.381) [-390.823] -- 0:00:38
      352500 -- (-391.333) [-391.284] (-391.787) (-390.219) * (-395.781) (-390.180) [-390.186] (-394.283) -- 0:00:38
      353000 -- [-389.234] (-390.483) (-390.956) (-389.927) * [-399.366] (-389.170) (-390.677) (-388.909) -- 0:00:38
      353500 -- (-390.088) [-389.689] (-392.890) (-391.210) * [-392.068] (-390.070) (-389.748) (-389.842) -- 0:00:38
      354000 -- (-391.838) (-391.732) (-392.183) [-390.069] * (-392.277) (-391.044) (-392.382) [-388.828] -- 0:00:38
      354500 -- (-390.174) (-392.978) [-391.771] (-390.021) * (-391.086) (-392.254) [-390.699] (-391.914) -- 0:00:38
      355000 -- (-391.035) (-388.718) [-390.954] (-390.886) * [-394.534] (-389.445) (-390.488) (-388.788) -- 0:00:38

      Average standard deviation of split frequencies: 0.015743

      355500 -- [-391.693] (-391.145) (-391.543) (-390.543) * (-391.495) [-391.729] (-391.528) (-391.142) -- 0:00:38
      356000 -- (-389.164) [-390.117] (-396.673) (-390.495) * (-391.634) (-389.510) [-392.117] (-390.538) -- 0:00:37
      356500 -- [-389.572] (-389.453) (-392.509) (-392.147) * [-390.029] (-390.326) (-391.665) (-389.976) -- 0:00:37
      357000 -- (-390.947) (-390.322) [-390.646] (-393.019) * (-389.628) (-392.048) [-389.608] (-390.062) -- 0:00:37
      357500 -- (-390.717) [-391.154] (-388.655) (-390.820) * [-389.675] (-390.815) (-391.527) (-391.318) -- 0:00:39
      358000 -- [-390.204] (-392.672) (-389.766) (-389.404) * (-389.643) (-390.067) (-390.071) [-390.428] -- 0:00:39
      358500 -- [-392.408] (-392.569) (-391.166) (-396.760) * (-392.474) (-395.459) (-390.302) [-393.119] -- 0:00:39
      359000 -- (-391.303) (-394.698) (-392.365) [-389.334] * [-391.039] (-393.948) (-394.217) (-395.595) -- 0:00:39
      359500 -- (-391.128) (-392.858) (-391.959) [-394.903] * (-390.582) (-394.034) (-393.001) [-393.569] -- 0:00:39
      360000 -- (-390.680) [-390.323] (-389.879) (-395.527) * (-391.602) (-392.691) [-389.359] (-389.473) -- 0:00:39

      Average standard deviation of split frequencies: 0.015321

      360500 -- (-390.877) (-388.537) [-390.261] (-391.977) * (-393.173) (-391.504) [-391.318] (-389.940) -- 0:00:39
      361000 -- [-393.251] (-390.692) (-393.212) (-389.878) * (-393.564) [-392.077] (-391.183) (-393.222) -- 0:00:38
      361500 -- (-390.775) [-390.489] (-392.275) (-391.451) * (-393.929) (-389.561) [-392.458] (-394.655) -- 0:00:38
      362000 -- (-390.899) (-392.048) (-391.214) [-390.737] * [-388.725] (-389.795) (-390.451) (-393.249) -- 0:00:38
      362500 -- [-390.426] (-389.958) (-390.659) (-392.042) * (-389.027) [-391.021] (-391.901) (-391.312) -- 0:00:38
      363000 -- (-391.691) (-390.645) [-389.822] (-389.349) * (-390.534) (-390.408) [-390.877] (-392.119) -- 0:00:38
      363500 -- (-389.637) [-389.339] (-390.754) (-390.038) * (-392.670) (-392.205) [-389.369] (-393.553) -- 0:00:38
      364000 -- [-392.340] (-390.366) (-393.315) (-391.975) * (-391.233) (-394.335) (-392.532) [-390.569] -- 0:00:38
      364500 -- (-389.651) [-390.333] (-390.412) (-390.755) * (-391.919) (-390.495) (-389.991) [-392.839] -- 0:00:38
      365000 -- (-389.517) (-390.651) [-390.642] (-389.362) * (-393.990) [-392.340] (-391.588) (-389.048) -- 0:00:38

      Average standard deviation of split frequencies: 0.015313

      365500 -- (-393.096) [-391.076] (-394.294) (-390.115) * (-392.566) (-390.577) [-389.450] (-389.448) -- 0:00:38
      366000 -- (-394.192) [-390.971] (-394.479) (-389.292) * [-390.359] (-398.220) (-390.204) (-390.986) -- 0:00:38
      366500 -- [-390.051] (-390.993) (-392.347) (-391.825) * (-392.872) (-390.659) (-390.144) [-392.191] -- 0:00:38
      367000 -- (-395.181) (-393.183) (-391.875) [-391.548] * (-390.990) [-392.090] (-391.027) (-390.689) -- 0:00:37
      367500 -- (-390.286) (-391.369) [-391.619] (-391.430) * [-389.200] (-394.798) (-391.682) (-393.412) -- 0:00:37
      368000 -- (-391.463) [-391.129] (-392.913) (-389.485) * (-389.209) (-394.928) (-390.299) [-388.881] -- 0:00:37
      368500 -- (-392.641) (-390.010) [-390.150] (-389.676) * [-392.824] (-389.320) (-389.059) (-392.232) -- 0:00:37
      369000 -- (-392.476) (-394.798) [-392.579] (-398.503) * (-389.247) (-392.712) (-390.410) [-390.186] -- 0:00:37
      369500 -- [-392.528] (-392.176) (-393.980) (-395.059) * [-388.876] (-390.017) (-395.544) (-392.076) -- 0:00:37
      370000 -- (-390.402) (-390.881) [-389.390] (-389.848) * (-393.034) (-389.770) (-390.320) [-389.378] -- 0:00:37

      Average standard deviation of split frequencies: 0.015561

      370500 -- (-389.877) (-390.457) (-389.492) [-389.239] * (-391.909) (-396.286) (-392.492) [-389.275] -- 0:00:37
      371000 -- (-390.050) (-389.565) [-389.870] (-389.195) * (-390.352) (-391.994) [-388.935] (-391.380) -- 0:00:37
      371500 -- (-390.135) [-389.194] (-389.667) (-389.428) * (-390.509) [-397.398] (-390.273) (-391.296) -- 0:00:37
      372000 -- (-392.482) (-391.479) [-391.668] (-391.990) * (-390.071) (-389.419) [-389.191] (-392.607) -- 0:00:37
      372500 -- [-390.913] (-390.263) (-394.127) (-391.152) * (-392.801) (-389.952) (-391.851) [-390.542] -- 0:00:37
      373000 -- (-392.073) (-392.340) [-391.079] (-389.339) * (-391.924) (-392.828) (-392.281) [-388.689] -- 0:00:36
      373500 -- (-389.969) (-394.769) (-388.872) [-389.152] * (-389.614) (-393.073) (-389.959) [-389.216] -- 0:00:36
      374000 -- (-391.483) (-391.264) [-390.406] (-389.514) * (-390.570) [-389.180] (-391.726) (-390.886) -- 0:00:36
      374500 -- (-388.885) [-390.890] (-395.099) (-389.736) * (-392.996) (-389.562) (-391.200) [-389.563] -- 0:00:38
      375000 -- (-391.963) (-391.627) (-388.705) [-394.436] * [-394.099] (-389.768) (-390.717) (-389.829) -- 0:00:38

      Average standard deviation of split frequencies: 0.014529

      375500 -- [-390.875] (-389.633) (-390.964) (-390.309) * (-398.244) [-390.022] (-389.860) (-389.079) -- 0:00:38
      376000 -- [-390.014] (-393.158) (-398.815) (-389.079) * (-393.537) [-388.821] (-394.292) (-391.989) -- 0:00:38
      376500 -- (-391.008) [-391.004] (-388.989) (-389.607) * [-392.853] (-392.594) (-391.491) (-390.162) -- 0:00:38
      377000 -- (-392.320) (-394.093) [-390.151] (-391.643) * (-390.870) [-395.793] (-389.507) (-390.007) -- 0:00:38
      377500 -- (-392.804) (-392.861) [-391.144] (-390.339) * [-389.456] (-395.308) (-388.973) (-390.186) -- 0:00:37
      378000 -- (-392.145) [-391.806] (-390.581) (-389.860) * (-391.389) (-394.022) [-389.861] (-389.524) -- 0:00:37
      378500 -- (-394.389) [-390.525] (-389.982) (-390.048) * (-389.189) [-390.380] (-390.974) (-390.088) -- 0:00:37
      379000 -- (-390.140) (-393.070) [-394.190] (-391.467) * (-389.441) (-391.847) [-393.425] (-391.346) -- 0:00:37
      379500 -- (-390.115) (-392.410) [-392.589] (-390.141) * (-389.285) (-393.193) [-394.767] (-390.111) -- 0:00:37
      380000 -- (-390.132) (-389.583) [-390.910] (-392.659) * [-390.983] (-391.777) (-392.737) (-389.972) -- 0:00:37

      Average standard deviation of split frequencies: 0.015006

      380500 -- [-390.484] (-389.163) (-389.096) (-392.587) * (-390.392) (-393.685) [-392.404] (-395.281) -- 0:00:37
      381000 -- (-391.049) (-389.796) (-393.259) [-390.791] * (-391.565) (-393.357) (-392.158) [-392.948] -- 0:00:37
      381500 -- (-390.707) (-391.135) [-395.877] (-391.516) * [-388.969] (-390.145) (-390.450) (-390.984) -- 0:00:37
      382000 -- [-390.700] (-391.713) (-394.934) (-389.875) * (-391.309) (-389.672) (-392.033) [-391.042] -- 0:00:37
      382500 -- (-392.510) [-389.761] (-392.521) (-391.162) * (-391.362) [-390.341] (-396.507) (-391.517) -- 0:00:37
      383000 -- [-389.610] (-390.331) (-391.855) (-393.277) * (-391.718) [-390.740] (-394.649) (-389.570) -- 0:00:37
      383500 -- [-389.524] (-390.128) (-390.616) (-395.389) * (-390.771) [-390.522] (-393.775) (-394.290) -- 0:00:36
      384000 -- (-394.237) (-392.169) [-392.960] (-392.555) * (-391.414) (-392.065) (-394.385) [-390.381] -- 0:00:36
      384500 -- (-389.702) (-391.797) [-390.283] (-391.077) * [-390.786] (-391.035) (-391.660) (-392.388) -- 0:00:36
      385000 -- (-390.299) (-390.845) (-393.609) [-393.727] * (-390.428) (-390.186) (-391.176) [-389.980] -- 0:00:36

      Average standard deviation of split frequencies: 0.015158

      385500 -- [-390.508] (-396.215) (-391.088) (-388.883) * [-393.548] (-391.996) (-391.393) (-389.441) -- 0:00:36
      386000 -- [-389.132] (-389.805) (-393.370) (-390.043) * (-392.008) (-391.006) (-391.556) [-393.615] -- 0:00:36
      386500 -- (-390.944) (-389.775) [-392.149] (-391.178) * (-389.516) (-390.081) [-389.268] (-391.967) -- 0:00:36
      387000 -- (-392.948) [-388.965] (-389.566) (-394.076) * (-391.193) (-395.391) [-389.054] (-390.391) -- 0:00:36
      387500 -- (-389.691) (-389.564) [-391.482] (-390.244) * (-392.489) (-393.830) (-388.955) [-390.629] -- 0:00:36
      388000 -- (-391.753) (-388.663) [-389.839] (-390.928) * [-391.018] (-390.743) (-390.840) (-389.914) -- 0:00:36
      388500 -- (-392.446) (-390.625) (-389.842) [-389.624] * [-389.409] (-389.137) (-391.570) (-389.302) -- 0:00:36
      389000 -- (-394.641) (-390.642) [-392.485] (-391.096) * (-394.681) (-390.484) [-391.682] (-389.997) -- 0:00:36
      389500 -- (-391.621) [-391.503] (-391.542) (-390.614) * (-391.203) (-389.574) [-389.545] (-390.982) -- 0:00:36
      390000 -- (-390.971) (-390.785) [-389.663] (-391.323) * (-391.645) [-390.865] (-391.584) (-391.670) -- 0:00:35

      Average standard deviation of split frequencies: 0.014631

      390500 -- (-392.689) (-393.565) [-390.864] (-389.796) * (-396.463) (-392.719) [-389.151] (-391.559) -- 0:00:35
      391000 -- (-390.275) (-390.345) (-389.746) [-391.385] * (-392.235) (-389.312) [-390.274] (-389.713) -- 0:00:35
      391500 -- [-390.355] (-393.114) (-391.595) (-392.064) * (-390.621) (-391.616) (-390.338) [-390.015] -- 0:00:37
      392000 -- [-391.344] (-391.503) (-388.899) (-389.691) * (-389.515) [-389.530] (-390.461) (-392.195) -- 0:00:37
      392500 -- (-392.917) (-393.863) (-388.776) [-390.533] * (-395.126) (-394.296) (-390.595) [-390.951] -- 0:00:37
      393000 -- (-392.110) [-388.977] (-389.943) (-393.346) * (-401.105) [-392.021] (-393.946) (-390.598) -- 0:00:37
      393500 -- (-392.086) (-389.563) (-390.521) [-392.550] * (-390.018) (-393.986) [-391.690] (-389.993) -- 0:00:36
      394000 -- (-390.867) (-390.814) [-389.935] (-391.842) * (-390.534) (-389.584) (-390.311) [-390.192] -- 0:00:36
      394500 -- (-390.877) (-390.612) (-390.852) [-389.427] * (-393.265) [-392.650] (-393.189) (-390.005) -- 0:00:36
      395000 -- [-393.008] (-392.367) (-390.532) (-389.968) * (-392.944) [-389.497] (-390.705) (-389.585) -- 0:00:36

      Average standard deviation of split frequencies: 0.014495

      395500 -- (-390.047) (-392.048) (-391.702) [-389.674] * (-390.613) [-390.170] (-389.360) (-388.782) -- 0:00:36
      396000 -- [-391.523] (-389.582) (-393.130) (-392.553) * [-392.066] (-393.669) (-389.548) (-392.576) -- 0:00:36
      396500 -- [-392.092] (-391.063) (-390.707) (-389.642) * (-390.677) (-392.020) [-389.856] (-391.684) -- 0:00:36
      397000 -- (-389.437) (-390.661) [-391.799] (-391.694) * [-390.603] (-393.680) (-392.627) (-390.907) -- 0:00:36
      397500 -- (-392.089) (-392.764) [-393.659] (-394.527) * [-390.732] (-390.868) (-393.730) (-393.872) -- 0:00:36
      398000 -- (-389.670) (-391.998) (-394.429) [-392.787] * [-391.098] (-391.661) (-393.118) (-389.505) -- 0:00:36
      398500 -- (-389.564) [-389.392] (-390.140) (-391.647) * (-388.868) (-390.642) (-389.768) [-391.131] -- 0:00:36
      399000 -- (-389.252) [-392.042] (-389.813) (-391.990) * (-391.519) [-390.425] (-392.519) (-390.193) -- 0:00:36
      399500 -- (-396.405) (-390.510) (-391.118) [-395.061] * (-389.178) (-391.432) (-388.659) [-392.509] -- 0:00:36
      400000 -- [-390.793] (-390.786) (-390.609) (-390.306) * (-391.637) (-394.792) (-389.911) [-391.127] -- 0:00:36

      Average standard deviation of split frequencies: 0.014465

      400500 -- (-392.948) (-393.343) (-392.522) [-390.477] * (-390.431) (-391.857) [-392.603] (-393.305) -- 0:00:35
      401000 -- [-392.187] (-390.241) (-392.975) (-390.780) * (-391.391) [-389.539] (-391.129) (-393.840) -- 0:00:35
      401500 -- (-395.939) (-391.117) (-393.736) [-390.813] * (-392.245) [-390.615] (-391.602) (-391.288) -- 0:00:35
      402000 -- (-391.663) (-391.114) (-392.214) [-391.486] * (-390.971) (-390.487) [-390.419] (-395.002) -- 0:00:35
      402500 -- (-389.966) (-390.586) (-391.348) [-390.694] * (-389.177) (-392.443) (-396.035) [-391.701] -- 0:00:35
      403000 -- (-389.894) (-390.725) [-390.504] (-391.110) * (-392.101) (-389.624) (-389.535) [-396.139] -- 0:00:35
      403500 -- [-391.963] (-392.130) (-392.545) (-390.580) * [-390.175] (-392.125) (-389.558) (-392.026) -- 0:00:35
      404000 -- (-392.173) (-396.777) [-390.816] (-392.472) * (-390.179) (-393.013) (-391.209) [-389.187] -- 0:00:35
      404500 -- [-391.309] (-389.105) (-390.235) (-390.977) * (-392.792) (-391.084) (-389.341) [-392.681] -- 0:00:35
      405000 -- (-389.927) (-397.678) [-388.839] (-393.877) * (-391.180) [-389.953] (-393.651) (-391.833) -- 0:00:35

      Average standard deviation of split frequencies: 0.014343

      405500 -- (-389.933) (-390.034) (-390.660) [-389.617] * [-390.758] (-389.373) (-389.801) (-390.567) -- 0:00:35
      406000 -- (-391.017) (-388.868) (-390.169) [-391.407] * (-395.579) (-390.321) [-391.915] (-389.850) -- 0:00:35
      406500 -- [-390.585] (-391.144) (-390.418) (-390.145) * [-393.295] (-390.314) (-390.846) (-389.724) -- 0:00:35
      407000 -- (-394.355) (-391.989) (-391.884) [-390.135] * (-391.352) (-389.439) (-390.133) [-392.776] -- 0:00:36
      407500 -- (-392.359) (-396.405) [-391.413] (-392.505) * [-390.872] (-393.683) (-390.402) (-392.337) -- 0:00:36
      408000 -- (-394.537) (-389.808) [-390.195] (-394.418) * (-391.320) (-389.394) [-389.856] (-389.711) -- 0:00:36
      408500 -- (-389.704) [-391.731] (-395.290) (-393.410) * (-390.409) [-392.300] (-389.155) (-389.081) -- 0:00:36
      409000 -- (-390.584) [-390.743] (-391.334) (-391.614) * (-389.968) (-390.387) (-391.691) [-392.439] -- 0:00:36
      409500 -- [-392.254] (-390.647) (-391.754) (-391.706) * (-390.084) [-391.227] (-391.063) (-390.828) -- 0:00:36
      410000 -- (-389.569) [-390.229] (-391.773) (-392.694) * (-390.772) [-391.554] (-391.466) (-389.993) -- 0:00:35

      Average standard deviation of split frequencies: 0.013910

      410500 -- (-391.038) (-391.967) (-389.400) [-389.423] * (-390.535) (-391.331) (-391.674) [-391.961] -- 0:00:35
      411000 -- [-389.465] (-395.633) (-391.030) (-389.889) * (-390.915) [-390.363] (-390.271) (-391.334) -- 0:00:35
      411500 -- (-391.094) (-390.867) (-395.032) [-390.151] * [-391.082] (-392.124) (-392.247) (-393.422) -- 0:00:35
      412000 -- (-392.063) (-389.967) (-391.096) [-389.762] * (-390.046) [-391.559] (-389.497) (-391.423) -- 0:00:35
      412500 -- (-391.328) [-394.348] (-393.359) (-390.815) * (-390.575) (-391.223) [-393.030] (-391.135) -- 0:00:35
      413000 -- [-390.460] (-389.900) (-389.098) (-389.707) * (-390.275) (-393.188) [-390.422] (-391.382) -- 0:00:35
      413500 -- [-389.160] (-390.900) (-389.115) (-392.324) * (-394.263) [-391.009] (-392.098) (-390.025) -- 0:00:35
      414000 -- (-391.994) (-392.951) [-391.395] (-392.556) * (-391.704) (-394.103) [-388.980] (-389.916) -- 0:00:35
      414500 -- (-389.471) [-392.514] (-389.975) (-391.269) * (-393.171) (-390.043) (-391.143) [-391.455] -- 0:00:35
      415000 -- [-391.116] (-391.206) (-389.556) (-389.778) * (-391.834) (-391.011) [-392.575] (-389.595) -- 0:00:35

      Average standard deviation of split frequencies: 0.014198

      415500 -- (-389.729) (-395.210) (-388.999) [-388.871] * (-391.758) (-389.043) (-392.368) [-391.468] -- 0:00:35
      416000 -- (-390.019) [-396.634] (-389.322) (-393.213) * (-390.484) [-389.205] (-396.226) (-391.971) -- 0:00:35
      416500 -- [-392.860] (-393.554) (-391.015) (-393.032) * (-390.275) (-392.580) [-390.033] (-392.832) -- 0:00:35
      417000 -- (-390.900) (-389.784) [-391.206] (-388.949) * (-389.423) (-390.837) (-390.823) [-389.539] -- 0:00:34
      417500 -- (-391.740) (-388.869) (-391.600) [-389.199] * (-389.030) (-390.887) (-393.582) [-391.144] -- 0:00:34
      418000 -- (-390.982) (-390.558) (-392.237) [-391.977] * (-390.740) (-390.303) (-392.478) [-389.793] -- 0:00:34
      418500 -- (-395.320) (-391.658) [-389.559] (-390.600) * (-389.987) (-391.461) (-390.873) [-389.660] -- 0:00:34
      419000 -- (-393.652) [-391.657] (-395.928) (-394.447) * (-389.586) [-391.709] (-389.668) (-390.484) -- 0:00:34
      419500 -- (-390.798) [-389.407] (-392.867) (-392.635) * [-390.474] (-393.369) (-390.064) (-389.037) -- 0:00:34
      420000 -- (-392.353) [-391.633] (-394.560) (-394.497) * (-392.272) [-390.498] (-391.258) (-391.760) -- 0:00:34

      Average standard deviation of split frequencies: 0.013711

      420500 -- (-391.414) (-390.899) (-393.322) [-391.511] * (-390.247) (-390.663) (-396.472) [-390.936] -- 0:00:35
      421000 -- (-389.655) (-390.412) [-389.594] (-392.451) * (-390.298) (-392.164) [-389.895] (-390.215) -- 0:00:35
      421500 -- (-390.401) [-389.111] (-392.918) (-390.373) * [-390.593] (-390.127) (-390.101) (-390.953) -- 0:00:35
      422000 -- (-393.640) [-392.411] (-389.873) (-391.344) * (-390.670) (-392.997) (-392.394) [-390.568] -- 0:00:35
      422500 -- (-391.186) (-390.189) [-389.410] (-391.836) * [-389.294] (-391.105) (-391.304) (-390.757) -- 0:00:35
      423000 -- (-392.345) (-390.044) [-392.864] (-391.541) * (-389.762) (-390.978) (-390.597) [-389.974] -- 0:00:35
      423500 -- (-388.708) (-390.561) [-391.163] (-391.214) * (-394.046) [-389.558] (-392.327) (-389.450) -- 0:00:35
      424000 -- (-391.213) [-390.151] (-389.575) (-388.837) * (-389.758) (-390.056) [-390.228] (-389.073) -- 0:00:35
      424500 -- (-391.841) (-392.830) (-389.150) [-390.539] * (-391.788) (-394.403) (-390.968) [-388.924] -- 0:00:35
      425000 -- [-395.341] (-394.146) (-391.814) (-390.700) * (-391.097) (-392.442) (-391.453) [-390.383] -- 0:00:35

      Average standard deviation of split frequencies: 0.014386

      425500 -- (-389.179) (-390.259) (-391.329) [-392.176] * [-389.063] (-390.725) (-391.536) (-391.019) -- 0:00:35
      426000 -- [-396.606] (-390.086) (-393.291) (-392.033) * (-389.335) (-390.521) (-393.934) [-391.229] -- 0:00:35
      426500 -- [-392.420] (-389.993) (-395.275) (-390.371) * (-393.854) [-391.775] (-395.975) (-391.466) -- 0:00:34
      427000 -- (-389.640) (-390.825) [-391.191] (-389.534) * (-392.884) (-389.762) [-391.189] (-392.606) -- 0:00:34
      427500 -- (-389.585) [-389.916] (-392.181) (-389.608) * [-392.394] (-390.052) (-390.707) (-390.490) -- 0:00:34
      428000 -- (-389.803) (-389.775) [-389.002] (-392.427) * [-389.513] (-389.139) (-390.233) (-390.855) -- 0:00:34
      428500 -- (-396.388) (-388.811) [-390.612] (-394.188) * (-393.040) (-393.485) [-393.744] (-389.461) -- 0:00:34
      429000 -- (-389.896) [-394.222] (-390.122) (-389.618) * (-391.900) [-391.694] (-394.202) (-389.799) -- 0:00:34
      429500 -- (-391.504) [-388.980] (-389.969) (-391.529) * (-391.175) (-396.085) (-390.155) [-388.960] -- 0:00:34
      430000 -- [-389.971] (-389.446) (-396.798) (-390.775) * (-395.998) (-393.415) (-390.742) [-390.039] -- 0:00:34

      Average standard deviation of split frequencies: 0.013650

      430500 -- (-390.612) (-389.911) [-391.208] (-394.219) * (-394.543) (-397.050) (-390.284) [-390.839] -- 0:00:34
      431000 -- (-392.499) [-393.090] (-391.404) (-389.286) * (-392.459) (-390.585) [-390.256] (-395.382) -- 0:00:34
      431500 -- (-391.355) (-393.426) [-394.780] (-393.132) * [-390.179] (-392.701) (-390.028) (-391.335) -- 0:00:35
      432000 -- (-390.585) (-391.728) [-393.898] (-397.047) * (-389.943) [-389.251] (-392.559) (-390.443) -- 0:00:35
      432500 -- (-394.448) (-391.683) (-391.790) [-392.150] * (-390.339) [-389.435] (-392.233) (-392.380) -- 0:00:35
      433000 -- [-391.715] (-389.365) (-393.221) (-391.713) * (-392.362) [-391.612] (-392.843) (-394.728) -- 0:00:35
      433500 -- (-392.354) (-393.849) (-390.236) [-389.418] * (-391.151) (-390.065) [-391.586] (-389.643) -- 0:00:35
      434000 -- (-389.119) (-398.851) [-389.368] (-389.413) * [-389.835] (-391.656) (-394.855) (-389.375) -- 0:00:35
      434500 -- [-392.773] (-390.491) (-393.314) (-390.298) * (-392.462) (-390.422) [-395.677] (-389.807) -- 0:00:35
      435000 -- [-390.723] (-393.418) (-390.546) (-393.286) * (-393.694) (-390.018) (-390.799) [-390.079] -- 0:00:35

      Average standard deviation of split frequencies: 0.013718

      435500 -- (-391.498) [-392.900] (-390.738) (-391.595) * (-391.803) [-389.869] (-393.092) (-394.664) -- 0:00:34
      436000 -- (-389.300) (-392.786) (-390.561) [-389.808] * (-399.471) [-393.471] (-393.482) (-394.412) -- 0:00:34
      436500 -- (-395.506) (-389.393) [-389.488] (-391.145) * [-390.196] (-392.271) (-393.640) (-390.999) -- 0:00:34
      437000 -- [-390.391] (-391.837) (-390.712) (-392.477) * (-393.431) (-392.642) [-392.549] (-392.857) -- 0:00:34
      437500 -- (-390.448) (-390.479) [-393.710] (-389.470) * (-393.661) (-390.919) (-391.684) [-393.262] -- 0:00:34
      438000 -- (-393.414) (-390.986) (-393.304) [-390.265] * (-390.706) (-391.209) [-392.513] (-396.292) -- 0:00:34
      438500 -- (-390.603) (-390.248) (-392.645) [-391.650] * (-391.887) (-391.084) (-389.246) [-389.636] -- 0:00:34
      439000 -- (-392.935) (-391.980) (-389.258) [-389.730] * [-391.127] (-393.827) (-394.900) (-389.089) -- 0:00:34
      439500 -- (-390.010) [-391.694] (-390.945) (-388.677) * (-389.277) (-392.700) [-391.721] (-392.248) -- 0:00:34
      440000 -- (-389.610) (-390.515) (-389.310) [-389.597] * (-389.571) (-393.246) [-389.054] (-390.872) -- 0:00:34

      Average standard deviation of split frequencies: 0.014107

      440500 -- [-390.010] (-392.608) (-390.317) (-390.061) * [-389.286] (-390.853) (-393.467) (-390.715) -- 0:00:34
      441000 -- (-391.609) [-391.019] (-392.398) (-391.428) * (-389.997) [-395.781] (-389.916) (-389.684) -- 0:00:34
      441500 -- (-392.495) (-390.783) [-389.618] (-395.363) * (-391.155) (-391.369) [-389.320] (-390.390) -- 0:00:34
      442000 -- [-392.629] (-389.727) (-391.402) (-393.984) * [-389.346] (-390.504) (-389.507) (-393.324) -- 0:00:34
      442500 -- (-393.586) [-391.448] (-390.407) (-391.168) * (-393.119) [-391.236] (-391.036) (-389.474) -- 0:00:34
      443000 -- [-391.785] (-390.532) (-391.013) (-390.067) * (-390.760) (-389.569) (-389.866) [-390.275] -- 0:00:33
      443500 -- (-390.657) (-390.644) (-390.610) [-390.512] * [-391.993] (-392.197) (-389.417) (-391.625) -- 0:00:35
      444000 -- (-395.669) (-390.563) [-392.690] (-393.487) * (-391.423) (-390.451) [-390.915] (-392.240) -- 0:00:35
      444500 -- (-401.430) (-392.987) [-392.375] (-392.121) * (-389.195) [-390.247] (-391.612) (-392.411) -- 0:00:34
      445000 -- (-396.488) [-389.268] (-391.810) (-393.429) * (-393.467) [-392.604] (-399.467) (-390.222) -- 0:00:34

      Average standard deviation of split frequencies: 0.013212

      445500 -- (-389.795) (-390.454) (-392.573) [-393.257] * (-394.514) (-390.702) (-392.288) [-393.483] -- 0:00:34
      446000 -- (-392.505) (-394.592) (-389.274) [-390.671] * (-392.306) (-389.432) (-394.609) [-392.060] -- 0:00:34
      446500 -- (-394.252) [-393.777] (-389.994) (-391.375) * (-389.852) (-390.825) [-390.347] (-391.708) -- 0:00:34
      447000 -- (-392.030) (-389.414) (-388.977) [-390.776] * (-394.630) [-389.935] (-389.511) (-390.693) -- 0:00:34
      447500 -- [-391.177] (-390.863) (-394.985) (-391.778) * (-391.757) (-394.275) (-390.568) [-389.466] -- 0:00:34
      448000 -- (-392.041) [-392.661] (-395.233) (-390.553) * (-390.928) [-391.418] (-392.989) (-392.787) -- 0:00:34
      448500 -- (-393.869) [-389.830] (-392.645) (-393.526) * (-393.605) (-390.388) [-390.787] (-390.925) -- 0:00:34
      449000 -- [-391.602] (-391.326) (-390.005) (-391.069) * [-390.012] (-389.925) (-393.927) (-389.243) -- 0:00:34
      449500 -- [-393.112] (-390.939) (-389.922) (-391.169) * (-390.748) (-391.831) (-389.552) [-389.891] -- 0:00:34
      450000 -- (-391.215) (-389.354) (-391.022) [-388.949] * [-394.021] (-391.424) (-389.598) (-389.464) -- 0:00:34

      Average standard deviation of split frequencies: 0.011898

      450500 -- [-390.869] (-391.702) (-394.165) (-390.486) * (-394.198) [-390.835] (-395.503) (-390.864) -- 0:00:34
      451000 -- (-393.230) (-391.135) (-394.711) [-390.041] * (-389.999) [-391.923] (-394.215) (-392.616) -- 0:00:34
      451500 -- [-393.068] (-395.557) (-390.943) (-393.448) * (-393.827) (-390.913) (-389.522) [-392.397] -- 0:00:34
      452000 -- (-393.702) [-390.278] (-390.218) (-395.586) * (-392.936) (-391.648) [-392.484] (-391.954) -- 0:00:33
      452500 -- (-392.419) [-388.579] (-388.675) (-398.171) * (-393.494) (-390.652) (-391.217) [-391.053] -- 0:00:33
      453000 -- (-394.824) [-389.640] (-389.888) (-391.091) * (-396.675) [-391.442] (-394.755) (-393.067) -- 0:00:33
      453500 -- (-392.569) [-389.574] (-389.589) (-389.738) * (-389.490) [-389.959] (-392.429) (-394.998) -- 0:00:33
      454000 -- [-392.890] (-392.768) (-391.431) (-391.605) * [-389.193] (-389.790) (-390.011) (-389.973) -- 0:00:33
      454500 -- (-389.738) (-393.054) (-390.682) [-389.500] * (-390.512) [-389.742] (-390.096) (-392.029) -- 0:00:33
      455000 -- (-390.462) (-390.847) (-391.829) [-390.715] * [-389.964] (-391.809) (-390.132) (-392.716) -- 0:00:33

      Average standard deviation of split frequencies: 0.011049

      455500 -- [-394.596] (-390.131) (-391.396) (-399.613) * (-389.907) [-389.760] (-390.887) (-389.485) -- 0:00:33
      456000 -- (-392.791) (-388.916) (-391.800) [-390.708] * [-391.835] (-391.294) (-390.081) (-395.869) -- 0:00:33
      456500 -- (-391.566) [-389.858] (-389.489) (-391.673) * (-395.448) [-392.304] (-389.091) (-397.081) -- 0:00:34
      457000 -- [-390.328] (-392.488) (-391.352) (-390.140) * (-392.263) [-390.151] (-390.677) (-389.292) -- 0:00:34
      457500 -- (-391.539) (-391.825) [-389.872] (-392.405) * (-393.779) (-392.380) [-390.094] (-390.203) -- 0:00:34
      458000 -- [-390.307] (-391.944) (-393.475) (-390.578) * (-396.087) (-392.340) [-391.061] (-392.038) -- 0:00:34
      458500 -- (-389.474) (-391.515) [-396.381] (-393.854) * (-390.506) (-393.962) (-391.392) [-390.466] -- 0:00:34
      459000 -- (-390.478) (-391.158) [-389.393] (-390.119) * (-389.652) (-389.761) (-391.889) [-389.381] -- 0:00:34
      459500 -- (-390.382) (-390.866) [-393.282] (-389.391) * [-391.183] (-392.206) (-391.134) (-390.264) -- 0:00:34
      460000 -- (-393.767) (-390.452) (-394.748) [-392.631] * (-399.956) (-392.509) [-389.271] (-391.749) -- 0:00:34

      Average standard deviation of split frequencies: 0.010809

      460500 -- (-395.083) (-389.688) [-390.169] (-394.136) * (-389.684) [-390.874] (-390.558) (-388.691) -- 0:00:33
      461000 -- (-391.122) (-391.631) (-389.495) [-389.977] * (-391.025) (-391.893) (-391.788) [-388.607] -- 0:00:33
      461500 -- (-392.481) (-393.167) (-391.878) [-389.779] * (-391.187) (-393.154) (-390.786) [-389.987] -- 0:00:33
      462000 -- (-389.233) (-392.045) (-389.106) [-389.628] * (-390.684) (-391.596) [-389.905] (-390.429) -- 0:00:33
      462500 -- (-395.062) (-391.460) (-389.250) [-392.822] * (-388.910) [-390.629] (-389.855) (-391.147) -- 0:00:33
      463000 -- (-393.374) [-390.796] (-391.738) (-394.786) * (-390.085) [-390.400] (-390.108) (-392.235) -- 0:00:33
      463500 -- (-389.916) (-389.366) [-390.252] (-390.996) * [-390.362] (-392.725) (-393.270) (-395.602) -- 0:00:33
      464000 -- (-390.464) (-389.305) (-390.737) [-394.280] * [-390.640] (-391.542) (-391.311) (-394.114) -- 0:00:33
      464500 -- (-392.357) (-390.657) [-390.001] (-390.859) * [-390.247] (-389.702) (-392.507) (-397.890) -- 0:00:33
      465000 -- (-390.482) (-391.501) [-389.541] (-392.765) * (-392.954) (-389.303) [-390.445] (-395.138) -- 0:00:33

      Average standard deviation of split frequencies: 0.010495

      465500 -- [-392.545] (-389.527) (-389.610) (-390.347) * (-395.959) (-389.192) [-390.754] (-393.562) -- 0:00:33
      466000 -- [-391.000] (-390.446) (-391.370) (-393.330) * (-392.694) (-394.133) [-391.143] (-396.074) -- 0:00:33
      466500 -- [-391.522] (-393.476) (-396.052) (-391.670) * (-391.147) (-393.319) [-391.575] (-390.265) -- 0:00:33
      467000 -- (-393.405) [-390.835] (-390.769) (-394.919) * (-390.565) (-390.135) (-390.332) [-390.285] -- 0:00:33
      467500 -- (-392.909) (-390.833) (-391.257) [-394.036] * (-394.340) (-396.004) [-391.411] (-389.664) -- 0:00:33
      468000 -- (-392.093) (-393.628) (-390.865) [-391.655] * (-394.087) (-394.731) (-392.249) [-389.948] -- 0:00:32
      468500 -- (-390.477) (-389.835) (-390.556) [-389.320] * (-392.155) (-390.932) [-389.532] (-392.661) -- 0:00:32
      469000 -- (-389.578) (-388.712) [-390.399] (-395.753) * (-389.162) (-389.613) [-391.291] (-394.657) -- 0:00:32
      469500 -- (-392.319) (-388.712) [-393.297] (-390.294) * (-390.598) (-392.508) (-390.646) [-391.764] -- 0:00:32
      470000 -- (-391.182) (-391.637) [-391.016] (-390.810) * (-394.129) [-392.922] (-392.266) (-389.712) -- 0:00:32

      Average standard deviation of split frequencies: 0.011205

      470500 -- (-390.465) [-389.986] (-395.166) (-393.401) * (-389.644) [-391.897] (-394.316) (-390.004) -- 0:00:32
      471000 -- (-390.077) (-390.322) [-389.887] (-398.580) * (-389.782) [-390.150] (-390.963) (-389.230) -- 0:00:32
      471500 -- (-391.903) [-393.465] (-393.076) (-389.504) * [-389.573] (-390.762) (-389.419) (-390.137) -- 0:00:32
      472000 -- [-394.935] (-391.974) (-392.299) (-389.484) * (-393.160) (-391.120) [-388.816] (-391.791) -- 0:00:33
      472500 -- (-391.432) [-390.667] (-391.168) (-389.791) * (-391.686) (-389.205) [-394.717] (-390.360) -- 0:00:33
      473000 -- (-393.996) [-391.037] (-390.476) (-388.855) * [-391.175] (-397.453) (-390.854) (-390.559) -- 0:00:33
      473500 -- (-393.823) (-391.082) (-389.993) [-391.626] * [-393.212] (-397.741) (-390.018) (-389.941) -- 0:00:33
      474000 -- (-389.499) (-396.465) (-391.579) [-389.363] * [-390.293] (-390.400) (-391.618) (-390.330) -- 0:00:33
      474500 -- (-389.209) (-391.594) (-392.048) [-389.416] * (-392.672) [-389.139] (-390.545) (-393.590) -- 0:00:33
      475000 -- (-391.646) (-391.110) (-392.724) [-391.075] * (-398.285) [-389.781] (-389.229) (-390.224) -- 0:00:33

      Average standard deviation of split frequencies: 0.011575

      475500 -- [-397.034] (-397.677) (-390.779) (-393.223) * (-390.867) [-389.812] (-389.772) (-390.876) -- 0:00:33
      476000 -- (-390.974) [-391.054] (-389.684) (-389.898) * (-394.208) (-389.276) [-392.829] (-390.575) -- 0:00:33
      476500 -- (-390.735) [-390.708] (-390.701) (-391.965) * (-391.373) (-389.575) [-391.436] (-391.611) -- 0:00:32
      477000 -- (-391.519) (-393.610) (-390.173) [-392.588] * (-391.787) (-391.263) [-391.235] (-390.579) -- 0:00:32
      477500 -- (-391.310) [-389.432] (-390.402) (-392.176) * (-390.170) [-390.070] (-390.802) (-391.570) -- 0:00:32
      478000 -- [-390.532] (-390.869) (-395.840) (-393.430) * (-392.188) (-389.339) [-389.583] (-391.674) -- 0:00:32
      478500 -- (-390.926) [-390.417] (-389.524) (-396.530) * (-391.930) (-391.649) (-389.929) [-390.830] -- 0:00:32
      479000 -- [-390.857] (-388.972) (-390.278) (-390.353) * [-391.287] (-393.122) (-392.415) (-392.999) -- 0:00:32
      479500 -- (-391.521) [-389.455] (-390.148) (-389.912) * (-394.362) (-390.701) (-391.942) [-390.963] -- 0:00:32
      480000 -- (-392.683) [-391.828] (-390.747) (-389.680) * (-392.312) (-392.099) [-389.385] (-392.938) -- 0:00:32

      Average standard deviation of split frequencies: 0.010849

      480500 -- (-391.210) (-391.465) [-392.306] (-391.878) * (-392.752) (-391.164) (-388.887) [-391.529] -- 0:00:32
      481000 -- [-390.922] (-391.389) (-396.575) (-391.604) * (-388.956) (-394.295) (-393.579) [-389.157] -- 0:00:32
      481500 -- (-390.330) (-392.252) (-391.953) [-391.721] * (-391.746) (-393.857) [-390.064] (-390.861) -- 0:00:32
      482000 -- (-391.346) (-393.388) [-397.366] (-393.388) * (-391.983) [-391.252] (-392.311) (-391.347) -- 0:00:32
      482500 -- (-391.633) (-389.869) (-393.987) [-391.410] * [-390.104] (-390.281) (-392.705) (-390.818) -- 0:00:32
      483000 -- (-393.727) (-390.442) (-392.089) [-389.600] * (-390.712) (-390.650) (-390.215) [-389.504] -- 0:00:32
      483500 -- (-393.333) (-392.144) (-392.398) [-389.999] * (-392.100) [-390.734] (-393.396) (-388.817) -- 0:00:32
      484000 -- [-390.360] (-393.234) (-392.723) (-390.612) * (-389.440) (-390.346) [-391.266] (-390.014) -- 0:00:31
      484500 -- (-389.986) (-389.047) (-390.638) [-388.784] * (-394.674) (-390.480) (-393.345) [-390.469] -- 0:00:31
      485000 -- (-393.463) (-389.280) [-389.941] (-390.264) * (-390.380) [-389.652] (-388.983) (-389.212) -- 0:00:31

      Average standard deviation of split frequencies: 0.010367

      485500 -- (-390.912) (-391.659) (-392.873) [-395.061] * [-391.659] (-388.772) (-389.072) (-391.380) -- 0:00:31
      486000 -- (-391.041) (-389.192) (-392.959) [-389.886] * [-400.092] (-393.103) (-390.622) (-390.491) -- 0:00:31
      486500 -- (-392.796) [-389.345] (-395.630) (-393.047) * [-391.407] (-399.182) (-390.270) (-391.518) -- 0:00:31
      487000 -- (-391.069) (-390.803) [-393.137] (-390.860) * (-392.568) (-391.360) [-391.187] (-392.015) -- 0:00:31
      487500 -- (-389.041) (-393.510) [-392.307] (-390.049) * [-389.523] (-390.527) (-395.299) (-389.696) -- 0:00:32
      488000 -- (-392.259) (-391.751) (-393.375) [-390.690] * [-390.262] (-393.733) (-389.744) (-390.586) -- 0:00:32
      488500 -- (-391.586) (-390.015) (-394.111) [-388.877] * (-394.266) (-390.219) (-389.265) [-391.161] -- 0:00:32
      489000 -- (-390.969) [-390.401] (-390.949) (-391.603) * (-388.985) (-391.659) [-391.625] (-388.914) -- 0:00:32
      489500 -- (-390.307) [-391.220] (-392.116) (-391.230) * [-389.570] (-397.502) (-391.379) (-390.512) -- 0:00:32
      490000 -- (-391.049) (-391.689) [-392.088] (-390.963) * [-392.998] (-394.498) (-392.193) (-394.844) -- 0:00:32

      Average standard deviation of split frequencies: 0.009547

      490500 -- (-390.572) (-393.278) (-391.431) [-389.025] * (-392.384) [-390.422] (-393.653) (-396.307) -- 0:00:32
      491000 -- (-389.597) (-390.225) (-390.747) [-389.659] * (-392.792) [-394.429] (-391.390) (-392.156) -- 0:00:32
      491500 -- [-390.310] (-393.884) (-390.352) (-389.599) * (-392.535) (-389.403) (-391.338) [-390.247] -- 0:00:32
      492000 -- (-391.677) (-392.949) [-391.906] (-391.076) * (-389.123) (-390.492) [-395.649] (-392.511) -- 0:00:32
      492500 -- (-395.750) [-394.647] (-394.697) (-392.879) * [-390.433] (-389.123) (-390.783) (-391.321) -- 0:00:31
      493000 -- (-389.663) (-388.777) [-390.773] (-390.324) * [-393.820] (-391.492) (-392.790) (-390.370) -- 0:00:31
      493500 -- (-392.024) [-390.373] (-393.124) (-389.887) * (-388.996) [-389.971] (-392.391) (-389.280) -- 0:00:31
      494000 -- [-389.568] (-394.966) (-390.992) (-395.051) * (-389.698) (-392.938) [-391.596] (-389.777) -- 0:00:31
      494500 -- (-391.385) [-388.713] (-390.993) (-392.819) * [-390.420] (-391.932) (-390.862) (-391.694) -- 0:00:31
      495000 -- (-392.410) [-389.225] (-398.157) (-389.135) * (-391.395) (-391.902) [-391.198] (-391.283) -- 0:00:31

      Average standard deviation of split frequencies: 0.010217

      495500 -- [-393.744] (-393.807) (-390.504) (-394.988) * (-389.368) [-392.112] (-389.959) (-394.091) -- 0:00:31
      496000 -- (-393.776) (-392.263) [-390.853] (-391.813) * [-390.680] (-389.922) (-391.374) (-389.483) -- 0:00:31
      496500 -- (-394.056) (-393.215) [-393.041] (-388.914) * [-391.204] (-391.356) (-389.591) (-393.855) -- 0:00:31
      497000 -- (-390.753) (-390.794) [-389.929] (-390.565) * (-391.697) (-392.296) (-391.525) [-392.609] -- 0:00:31
      497500 -- (-392.698) (-391.503) [-390.001] (-389.379) * [-389.961] (-390.780) (-390.976) (-389.859) -- 0:00:31
      498000 -- (-389.629) (-393.540) [-389.143] (-389.704) * (-392.602) (-391.917) [-392.090] (-390.360) -- 0:00:31
      498500 -- [-389.192] (-390.295) (-392.009) (-390.257) * [-389.268] (-390.761) (-390.423) (-391.028) -- 0:00:31
      499000 -- (-391.201) (-390.228) (-389.876) [-391.258] * (-389.518) (-390.399) [-389.157] (-390.227) -- 0:00:31
      499500 -- (-391.861) (-389.764) (-395.808) [-390.272] * (-391.408) (-389.414) (-389.680) [-395.947] -- 0:00:31
      500000 -- (-390.723) (-389.642) [-389.270] (-389.532) * (-389.142) (-389.328) (-390.132) [-389.436] -- 0:00:31

      Average standard deviation of split frequencies: 0.010004

      500500 -- [-392.945] (-389.242) (-389.177) (-391.744) * [-390.679] (-390.589) (-389.619) (-392.901) -- 0:00:30
      501000 -- (-390.791) (-390.857) (-390.841) [-391.132] * (-391.581) (-390.547) (-392.481) [-389.832] -- 0:00:30
      501500 -- [-390.343] (-390.459) (-390.342) (-391.209) * [-390.420] (-392.664) (-398.333) (-389.304) -- 0:00:30
      502000 -- (-391.400) (-389.664) (-389.131) [-389.795] * [-389.899] (-392.442) (-390.168) (-390.692) -- 0:00:30
      502500 -- (-392.191) (-389.341) [-388.992] (-389.021) * (-390.774) [-392.126] (-392.154) (-394.566) -- 0:00:30
      503000 -- [-391.063] (-393.912) (-389.206) (-389.563) * [-393.925] (-393.377) (-393.480) (-394.262) -- 0:00:31
      503500 -- (-389.530) (-392.638) [-390.626] (-391.940) * (-392.338) (-392.072) [-389.130] (-395.626) -- 0:00:31
      504000 -- [-388.610] (-393.093) (-391.432) (-391.029) * [-392.159] (-394.295) (-388.938) (-390.974) -- 0:00:31
      504500 -- (-392.701) [-389.249] (-391.721) (-389.130) * (-391.148) (-394.725) (-391.958) [-388.853] -- 0:00:31
      505000 -- (-390.341) (-389.705) (-392.113) [-390.069] * (-391.070) (-389.658) (-392.241) [-394.829] -- 0:00:31

      Average standard deviation of split frequencies: 0.010960

      505500 -- (-390.413) (-391.712) (-389.818) [-391.311] * (-390.598) [-390.200] (-390.743) (-392.603) -- 0:00:31
      506000 -- (-393.369) [-389.026] (-391.186) (-390.819) * (-391.711) [-390.477] (-395.264) (-392.157) -- 0:00:31
      506500 -- [-392.355] (-390.197) (-392.344) (-391.441) * [-392.523] (-390.133) (-389.659) (-392.911) -- 0:00:31
      507000 -- (-389.346) (-391.458) [-393.465] (-390.160) * [-392.458] (-391.624) (-395.207) (-390.654) -- 0:00:31
      507500 -- (-392.385) [-389.942] (-392.372) (-390.243) * (-392.103) (-393.379) (-393.254) [-390.935] -- 0:00:31
      508000 -- (-391.052) [-390.886] (-391.340) (-390.943) * (-392.388) (-390.615) (-396.626) [-389.818] -- 0:00:30
      508500 -- [-391.757] (-390.327) (-390.183) (-391.809) * (-390.892) [-390.268] (-393.409) (-389.952) -- 0:00:30
      509000 -- (-389.781) (-390.622) (-388.637) [-394.722] * (-390.567) [-390.331] (-390.334) (-392.477) -- 0:00:30
      509500 -- (-392.310) [-391.550] (-389.656) (-398.753) * (-392.403) [-392.108] (-390.862) (-391.285) -- 0:00:30
      510000 -- [-390.150] (-390.556) (-388.715) (-389.666) * [-389.848] (-391.122) (-391.318) (-392.563) -- 0:00:30

      Average standard deviation of split frequencies: 0.010443

      510500 -- (-389.533) (-389.556) [-389.218] (-389.784) * (-393.104) [-391.871] (-390.635) (-391.772) -- 0:00:30
      511000 -- (-389.759) [-392.295] (-392.502) (-391.474) * (-391.371) (-389.395) (-392.709) [-390.881] -- 0:00:30
      511500 -- [-389.339] (-390.601) (-391.104) (-390.417) * (-392.930) (-389.062) (-394.015) [-389.735] -- 0:00:30
      512000 -- (-388.819) (-391.330) [-390.899] (-393.303) * (-392.721) (-390.024) (-389.242) [-389.634] -- 0:00:30
      512500 -- (-392.709) (-390.605) [-391.813] (-390.767) * (-392.279) (-391.243) (-388.872) [-391.231] -- 0:00:30
      513000 -- (-391.979) (-391.668) (-390.362) [-389.711] * (-390.161) [-389.789] (-390.419) (-393.822) -- 0:00:30
      513500 -- (-390.528) (-393.713) [-389.170] (-389.367) * (-392.563) (-390.765) (-391.712) [-391.968] -- 0:00:30
      514000 -- (-391.533) (-393.598) (-391.745) [-394.346] * (-389.981) (-391.535) (-390.968) [-388.869] -- 0:00:30
      514500 -- (-390.544) (-391.000) [-394.122] (-390.463) * (-389.782) (-389.006) (-391.687) [-390.427] -- 0:00:30
      515000 -- (-393.284) [-392.055] (-389.620) (-390.713) * (-392.186) (-391.064) [-389.673] (-389.914) -- 0:00:30

      Average standard deviation of split frequencies: 0.010164

      515500 -- (-391.295) [-391.206] (-389.356) (-393.434) * (-392.212) (-390.293) (-394.401) [-391.762] -- 0:00:30
      516000 -- [-389.168] (-390.956) (-394.359) (-390.438) * (-389.939) [-391.706] (-389.632) (-389.803) -- 0:00:30
      516500 -- [-392.416] (-391.331) (-390.367) (-389.720) * (-392.722) (-393.253) [-390.512] (-390.164) -- 0:00:29
      517000 -- (-391.765) (-390.607) (-391.282) [-391.178] * [-390.660] (-394.445) (-390.856) (-390.368) -- 0:00:29
      517500 -- (-394.057) (-392.981) (-390.380) [-391.975] * (-389.494) (-389.723) (-390.963) [-390.247] -- 0:00:29
      518000 -- (-391.966) (-389.545) (-393.251) [-389.952] * (-389.383) [-391.056] (-390.626) (-392.365) -- 0:00:29
      518500 -- (-391.658) (-392.256) (-390.550) [-390.166] * (-389.524) [-390.825] (-390.954) (-389.004) -- 0:00:29
      519000 -- [-394.134] (-394.461) (-396.257) (-389.675) * (-397.368) (-395.837) (-392.674) [-389.189] -- 0:00:30
      519500 -- (-397.011) (-393.406) [-390.045] (-389.369) * (-389.901) (-394.227) [-395.841] (-389.263) -- 0:00:30
      520000 -- [-392.571] (-392.618) (-390.706) (-389.702) * (-393.373) (-389.860) [-392.372] (-388.644) -- 0:00:30

      Average standard deviation of split frequencies: 0.009620

      520500 -- [-392.354] (-391.362) (-389.502) (-388.809) * (-395.587) [-389.139] (-392.256) (-393.003) -- 0:00:30
      521000 -- (-395.520) (-389.821) (-392.681) [-391.083] * (-392.865) [-391.315] (-390.464) (-391.827) -- 0:00:30
      521500 -- (-392.879) (-390.079) (-394.935) [-389.204] * [-393.506] (-390.086) (-389.510) (-391.925) -- 0:00:30
      522000 -- (-394.304) [-390.127] (-390.442) (-389.633) * (-393.091) [-389.209] (-391.301) (-389.763) -- 0:00:30
      522500 -- (-396.867) (-389.372) (-395.185) [-389.790] * [-390.354] (-389.475) (-394.875) (-394.684) -- 0:00:30
      523000 -- (-390.225) (-390.578) (-391.063) [-389.084] * (-392.311) [-393.829] (-393.121) (-393.637) -- 0:00:30
      523500 -- [-390.501] (-391.053) (-390.149) (-389.763) * [-388.903] (-401.612) (-390.779) (-393.598) -- 0:00:30
      524000 -- [-390.303] (-391.096) (-390.761) (-389.669) * (-389.602) (-390.952) [-388.918] (-390.044) -- 0:00:29
      524500 -- [-393.838] (-390.819) (-391.060) (-389.942) * (-392.906) (-389.025) [-393.090] (-394.196) -- 0:00:29
      525000 -- [-389.384] (-394.208) (-389.513) (-391.836) * (-392.841) (-391.517) [-392.074] (-392.077) -- 0:00:29

      Average standard deviation of split frequencies: 0.008698

      525500 -- (-389.168) [-389.478] (-392.114) (-390.411) * (-391.626) [-389.276] (-390.191) (-390.797) -- 0:00:29
      526000 -- (-390.172) (-390.263) (-393.514) [-390.230] * (-389.438) [-391.286] (-389.930) (-391.468) -- 0:00:29
      526500 -- [-388.874] (-391.850) (-391.617) (-390.708) * [-389.831] (-393.228) (-389.828) (-389.269) -- 0:00:29
      527000 -- (-389.724) [-392.668] (-393.112) (-392.559) * (-391.126) (-390.301) (-389.708) [-393.998] -- 0:00:29
      527500 -- (-391.102) [-389.526] (-392.041) (-391.068) * (-391.052) (-390.798) (-390.118) [-390.574] -- 0:00:29
      528000 -- (-392.235) (-389.643) [-389.294] (-390.121) * (-392.271) (-396.795) (-390.642) [-389.375] -- 0:00:29
      528500 -- (-395.640) [-391.444] (-389.054) (-390.628) * (-391.148) (-395.612) (-390.587) [-392.595] -- 0:00:29
      529000 -- (-391.060) (-390.672) (-389.755) [-390.218] * (-398.090) (-394.584) (-389.749) [-391.945] -- 0:00:29
      529500 -- (-390.866) (-391.017) (-391.307) [-390.397] * (-392.894) [-389.372] (-391.534) (-390.605) -- 0:00:29
      530000 -- (-391.636) (-389.847) (-394.129) [-389.721] * (-390.085) (-394.009) (-391.242) [-391.336] -- 0:00:29

      Average standard deviation of split frequencies: 0.009327

      530500 -- [-391.799] (-389.982) (-389.604) (-389.864) * [-389.875] (-392.915) (-393.210) (-390.871) -- 0:00:29
      531000 -- (-390.932) [-389.741] (-390.359) (-389.228) * (-396.863) (-390.986) (-392.989) [-389.188] -- 0:00:29
      531500 -- (-391.172) [-391.563] (-389.227) (-389.075) * [-392.006] (-392.239) (-389.065) (-394.471) -- 0:00:29
      532000 -- (-389.648) (-391.672) (-392.238) [-389.635] * [-391.881] (-392.099) (-388.789) (-390.650) -- 0:00:29
      532500 -- [-389.646] (-389.943) (-388.983) (-391.282) * [-391.273] (-394.555) (-390.708) (-390.648) -- 0:00:28
      533000 -- (-389.539) (-389.003) [-394.260] (-390.260) * (-390.895) (-392.761) [-394.660] (-390.587) -- 0:00:28
      533500 -- (-391.128) (-389.584) [-389.795] (-390.944) * (-391.699) (-388.760) [-388.964] (-391.106) -- 0:00:28
      534000 -- (-389.852) [-389.317] (-390.726) (-390.295) * (-394.513) (-389.705) [-392.473] (-389.063) -- 0:00:29
      534500 -- (-390.334) [-389.803] (-393.107) (-389.701) * (-391.355) [-390.755] (-393.787) (-391.048) -- 0:00:29
      535000 -- (-389.876) (-389.444) [-393.089] (-389.736) * [-390.996] (-391.947) (-391.533) (-391.527) -- 0:00:29

      Average standard deviation of split frequencies: 0.009260

      535500 -- (-392.554) (-389.031) (-390.700) [-391.664] * [-389.463] (-390.551) (-391.158) (-393.327) -- 0:00:29
      536000 -- (-392.424) (-388.957) (-393.325) [-391.901] * (-389.168) [-390.440] (-390.759) (-392.045) -- 0:00:29
      536500 -- [-390.347] (-391.361) (-390.862) (-391.146) * (-389.627) (-390.557) (-389.519) [-394.135] -- 0:00:29
      537000 -- (-391.610) (-390.460) [-392.374] (-390.188) * (-390.231) [-391.704] (-396.129) (-394.922) -- 0:00:29
      537500 -- [-390.606] (-389.938) (-389.826) (-395.802) * (-392.618) (-389.945) (-392.074) [-389.485] -- 0:00:29
      538000 -- (-391.842) (-389.734) (-389.383) [-390.530] * (-393.509) [-390.149] (-389.375) (-389.006) -- 0:00:29
      538500 -- [-392.791] (-389.549) (-394.592) (-390.135) * (-394.268) (-390.613) (-391.439) [-389.655] -- 0:00:29
      539000 -- (-390.139) (-389.975) (-391.917) [-389.326] * [-392.327] (-393.595) (-390.173) (-390.634) -- 0:00:29
      539500 -- [-391.911] (-391.481) (-389.486) (-393.057) * (-390.879) (-390.548) [-389.655] (-389.175) -- 0:00:29
      540000 -- (-389.863) (-391.844) [-390.257] (-390.282) * (-390.319) (-389.731) [-390.410] (-389.592) -- 0:00:28

      Average standard deviation of split frequencies: 0.009745

      540500 -- (-390.397) [-392.719] (-394.946) (-392.415) * [-390.724] (-393.143) (-391.646) (-391.362) -- 0:00:28
      541000 -- [-389.940] (-391.998) (-390.573) (-390.823) * (-389.959) (-388.770) (-391.252) [-391.657] -- 0:00:28
      541500 -- (-390.362) [-389.492] (-389.115) (-391.391) * (-389.070) (-391.772) (-391.274) [-391.509] -- 0:00:28
      542000 -- [-390.244] (-389.500) (-390.297) (-391.010) * [-389.740] (-392.703) (-392.552) (-394.162) -- 0:00:28
      542500 -- [-391.836] (-389.720) (-394.675) (-389.906) * (-389.635) [-389.271] (-394.524) (-389.217) -- 0:00:28
      543000 -- (-390.010) (-390.684) [-394.957] (-395.133) * (-389.326) (-392.797) (-390.580) [-390.667] -- 0:00:28
      543500 -- [-391.400] (-389.924) (-394.051) (-390.714) * (-390.794) (-392.632) (-391.237) [-389.968] -- 0:00:28
      544000 -- (-391.520) [-391.049] (-391.716) (-393.464) * (-391.434) (-389.304) (-391.279) [-390.568] -- 0:00:28
      544500 -- [-389.683] (-389.764) (-392.818) (-392.090) * [-388.591] (-389.553) (-391.279) (-391.728) -- 0:00:28
      545000 -- (-390.921) (-392.671) [-390.467] (-392.305) * (-390.396) (-392.277) [-390.178] (-391.564) -- 0:00:28

      Average standard deviation of split frequencies: 0.010005

      545500 -- (-392.560) [-392.249] (-391.874) (-389.970) * (-394.842) (-390.104) [-389.805] (-391.055) -- 0:00:28
      546000 -- (-389.634) (-390.631) (-392.337) [-394.293] * (-390.333) (-389.973) [-391.509] (-394.280) -- 0:00:28
      546500 -- [-393.822] (-397.450) (-389.978) (-393.964) * (-391.833) [-391.237] (-391.937) (-393.637) -- 0:00:28
      547000 -- [-391.828] (-392.752) (-390.912) (-390.248) * (-390.193) (-390.750) [-392.073] (-390.443) -- 0:00:28
      547500 -- (-390.698) (-395.337) (-389.471) [-393.133] * [-389.767] (-393.286) (-391.999) (-390.999) -- 0:00:28
      548000 -- (-388.754) (-396.472) (-391.580) [-389.965] * (-390.740) [-390.679] (-392.169) (-389.544) -- 0:00:28
      548500 -- (-389.938) [-390.191] (-390.652) (-391.260) * (-392.694) [-391.500] (-389.665) (-392.549) -- 0:00:27
      549000 -- (-391.861) [-394.602] (-389.530) (-389.595) * (-389.742) (-394.202) [-390.418] (-388.958) -- 0:00:28
      549500 -- (-392.819) [-391.433] (-390.548) (-391.947) * (-389.662) (-389.174) (-389.863) [-389.880] -- 0:00:28
      550000 -- (-390.119) (-390.505) (-392.431) [-391.546] * [-392.578] (-392.234) (-393.761) (-397.282) -- 0:00:28

      Average standard deviation of split frequencies: 0.010827

      550500 -- (-390.469) [-391.407] (-395.195) (-393.204) * (-392.894) (-390.127) [-394.243] (-394.331) -- 0:00:28
      551000 -- (-390.364) (-390.408) (-392.373) [-393.644] * (-393.718) [-388.934] (-390.883) (-396.098) -- 0:00:28
      551500 -- (-392.796) (-389.911) [-393.406] (-390.931) * (-395.763) (-390.498) (-389.068) [-392.626] -- 0:00:28
      552000 -- [-390.686] (-389.745) (-391.598) (-391.468) * (-390.971) (-391.011) [-389.883] (-393.573) -- 0:00:28
      552500 -- (-389.271) [-390.231] (-391.432) (-392.074) * (-393.102) (-389.793) [-390.188] (-393.047) -- 0:00:28
      553000 -- [-390.937] (-394.228) (-390.637) (-389.730) * (-390.847) (-390.063) [-392.848] (-391.519) -- 0:00:28
      553500 -- (-392.407) (-393.785) (-389.976) [-389.210] * (-392.283) [-392.796] (-391.445) (-391.970) -- 0:00:28
      554000 -- (-391.276) (-390.905) [-392.268] (-391.954) * [-390.138] (-391.445) (-390.729) (-390.105) -- 0:00:28
      554500 -- (-390.164) [-389.207] (-394.317) (-395.425) * (-391.768) (-389.378) [-389.821] (-388.988) -- 0:00:28
      555000 -- (-390.761) [-389.614] (-390.122) (-391.478) * (-393.960) (-389.496) (-392.122) [-389.499] -- 0:00:28

      Average standard deviation of split frequencies: 0.010975

      555500 -- (-390.436) (-389.803) (-391.833) [-394.561] * [-389.490] (-391.460) (-394.485) (-390.076) -- 0:00:28
      556000 -- [-389.514] (-391.853) (-390.069) (-392.461) * (-392.324) [-389.983] (-395.453) (-393.959) -- 0:00:27
      556500 -- [-389.341] (-391.310) (-393.237) (-391.003) * (-390.807) (-390.151) [-388.996] (-395.854) -- 0:00:27
      557000 -- (-389.139) (-390.176) (-391.158) [-389.338] * (-391.639) (-390.976) (-390.702) [-391.186] -- 0:00:27
      557500 -- [-392.688] (-389.493) (-391.864) (-389.302) * (-391.413) (-390.368) [-391.069] (-392.018) -- 0:00:27
      558000 -- (-390.170) [-389.386] (-390.838) (-393.774) * (-394.819) [-392.050] (-391.098) (-398.127) -- 0:00:27
      558500 -- [-391.418] (-389.539) (-390.285) (-391.803) * (-396.000) [-389.051] (-391.411) (-389.840) -- 0:00:27
      559000 -- (-391.959) [-390.037] (-390.725) (-393.823) * [-392.664] (-391.673) (-393.024) (-393.048) -- 0:00:27
      559500 -- (-393.766) (-394.344) [-392.543] (-391.943) * (-389.998) (-390.212) [-393.695] (-392.360) -- 0:00:27
      560000 -- (-389.796) (-390.488) [-390.634] (-395.561) * (-390.486) (-394.046) [-390.088] (-391.238) -- 0:00:27

      Average standard deviation of split frequencies: 0.010884

      560500 -- (-389.744) (-392.223) [-390.815] (-390.085) * (-389.560) (-391.655) [-390.199] (-393.909) -- 0:00:27
      561000 -- (-392.559) (-390.815) (-392.304) [-389.707] * [-389.368] (-395.821) (-391.052) (-394.924) -- 0:00:27
      561500 -- [-391.361] (-391.239) (-390.958) (-389.053) * (-390.473) [-391.419] (-392.447) (-392.972) -- 0:00:27
      562000 -- (-394.697) (-392.194) [-391.968] (-388.919) * (-389.749) (-392.659) [-391.385] (-392.433) -- 0:00:27
      562500 -- [-390.402] (-392.048) (-393.553) (-390.185) * (-389.699) [-389.345] (-390.029) (-390.098) -- 0:00:27
      563000 -- (-391.568) (-394.735) [-391.310] (-389.539) * (-393.084) (-395.970) [-392.008] (-390.577) -- 0:00:27
      563500 -- (-391.048) (-391.834) (-390.142) [-390.004] * (-389.393) [-390.984] (-389.661) (-394.014) -- 0:00:27
      564000 -- (-389.077) (-390.870) (-390.245) [-390.000] * [-391.542] (-389.504) (-393.906) (-391.227) -- 0:00:27
      564500 -- (-389.922) [-389.789] (-390.180) (-390.578) * (-394.014) (-389.700) [-392.014] (-391.124) -- 0:00:27
      565000 -- (-389.873) [-389.984] (-391.407) (-391.010) * (-392.025) [-391.516] (-392.445) (-389.851) -- 0:00:27

      Average standard deviation of split frequencies: 0.010735

      565500 -- [-389.565] (-390.057) (-390.384) (-392.388) * (-388.765) (-390.181) [-389.785] (-391.200) -- 0:00:27
      566000 -- (-389.353) [-389.561] (-391.771) (-391.893) * (-389.384) (-390.717) (-392.171) [-391.403] -- 0:00:27
      566500 -- (-391.146) [-390.953] (-393.519) (-390.454) * (-392.556) (-389.678) (-390.592) [-391.019] -- 0:00:27
      567000 -- (-389.604) (-390.883) (-395.624) [-390.118] * (-391.226) (-392.158) [-391.075] (-393.309) -- 0:00:27
      567500 -- (-393.788) (-393.454) [-389.741] (-389.365) * [-391.093] (-392.210) (-391.379) (-390.484) -- 0:00:27
      568000 -- (-389.948) (-392.229) (-392.263) [-391.725] * (-389.817) [-388.899] (-392.426) (-389.322) -- 0:00:27
      568500 -- (-390.092) (-391.380) (-392.422) [-390.062] * (-391.897) (-389.224) (-393.027) [-389.863] -- 0:00:27
      569000 -- [-392.237] (-392.915) (-391.419) (-391.364) * [-389.668] (-391.678) (-389.839) (-390.085) -- 0:00:27
      569500 -- (-390.345) (-390.694) [-390.582] (-392.185) * (-392.157) [-389.489] (-390.900) (-389.622) -- 0:00:27
      570000 -- (-392.787) [-392.189] (-392.529) (-392.806) * (-390.442) (-390.293) [-389.701] (-389.444) -- 0:00:27

      Average standard deviation of split frequencies: 0.010280

      570500 -- (-390.009) (-392.301) [-392.831] (-392.615) * (-390.376) (-389.997) [-389.516] (-390.818) -- 0:00:27
      571000 -- [-388.977] (-391.742) (-391.543) (-392.650) * (-390.424) [-391.142] (-394.054) (-390.932) -- 0:00:27
      571500 -- (-389.429) [-392.047] (-391.927) (-393.047) * (-390.620) (-391.079) [-390.689] (-391.247) -- 0:00:26
      572000 -- (-391.070) (-398.640) [-392.087] (-389.822) * (-389.694) [-391.063] (-391.929) (-394.223) -- 0:00:26
      572500 -- (-391.417) (-391.833) [-391.790] (-390.715) * (-390.551) (-392.926) (-391.773) [-389.838] -- 0:00:26
      573000 -- (-389.830) [-393.042] (-391.078) (-390.194) * (-390.715) (-394.750) [-389.680] (-389.774) -- 0:00:26
      573500 -- (-390.895) [-389.625] (-391.212) (-389.380) * [-393.094] (-391.879) (-389.153) (-389.318) -- 0:00:26
      574000 -- (-392.797) (-389.508) [-393.253] (-390.263) * (-389.487) (-392.951) (-388.788) [-389.462] -- 0:00:26
      574500 -- (-389.479) [-389.552] (-393.930) (-391.653) * [-391.321] (-392.656) (-389.649) (-392.339) -- 0:00:26
      575000 -- (-396.546) (-390.731) (-391.963) [-391.274] * (-390.801) [-391.400] (-392.305) (-394.214) -- 0:00:26

      Average standard deviation of split frequencies: 0.010013

      575500 -- (-393.670) [-392.375] (-395.223) (-390.593) * [-389.204] (-389.944) (-392.451) (-390.277) -- 0:00:26
      576000 -- (-390.893) (-389.861) (-394.641) [-394.387] * (-396.194) (-392.686) (-392.603) [-389.337] -- 0:00:26
      576500 -- (-394.030) (-393.645) [-390.550] (-394.744) * [-390.756] (-390.270) (-390.808) (-390.211) -- 0:00:26
      577000 -- [-390.387] (-392.197) (-390.545) (-392.073) * (-393.032) [-390.928] (-393.519) (-391.311) -- 0:00:26
      577500 -- (-395.522) [-389.395] (-389.585) (-391.309) * (-393.478) (-391.686) (-391.192) [-388.889] -- 0:00:26
      578000 -- [-390.099] (-391.667) (-396.811) (-393.421) * (-390.344) [-389.544] (-391.327) (-395.191) -- 0:00:26
      578500 -- (-393.035) (-394.545) [-390.384] (-395.443) * (-393.504) (-389.606) (-393.326) [-390.988] -- 0:00:26
      579000 -- (-391.643) [-391.734] (-390.217) (-391.837) * [-390.330] (-392.047) (-391.513) (-390.701) -- 0:00:26
      579500 -- (-390.305) (-390.960) (-389.181) [-389.791] * (-389.179) [-391.771] (-398.126) (-389.749) -- 0:00:26
      580000 -- (-390.332) (-390.007) (-393.218) [-390.192] * [-389.522] (-388.944) (-390.435) (-388.869) -- 0:00:26

      Average standard deviation of split frequencies: 0.009408

      580500 -- [-389.984] (-389.511) (-389.480) (-392.443) * [-391.371] (-388.824) (-395.153) (-390.091) -- 0:00:26
      581000 -- (-389.732) (-393.988) (-391.103) [-390.018] * (-389.317) (-389.487) (-389.918) [-393.887] -- 0:00:26
      581500 -- (-390.856) (-396.063) [-390.349] (-391.823) * (-389.321) (-389.180) (-393.093) [-389.050] -- 0:00:26
      582000 -- [-390.116] (-392.902) (-390.924) (-391.875) * (-391.238) (-390.866) (-395.998) [-391.933] -- 0:00:26
      582500 -- [-390.655] (-390.914) (-389.791) (-391.981) * [-390.190] (-389.747) (-392.200) (-389.511) -- 0:00:26
      583000 -- (-389.783) (-391.839) [-390.093] (-393.695) * (-390.823) (-393.381) (-392.689) [-392.022] -- 0:00:26
      583500 -- (-391.111) [-390.167] (-390.687) (-393.307) * (-389.661) (-390.346) [-391.039] (-389.252) -- 0:00:26
      584000 -- (-390.643) [-392.464] (-389.866) (-391.489) * (-389.245) (-389.351) (-392.437) [-390.661] -- 0:00:26
      584500 -- (-391.083) (-392.737) [-391.707] (-389.999) * [-391.657] (-396.260) (-392.415) (-394.048) -- 0:00:26
      585000 -- [-389.883] (-395.737) (-389.119) (-391.367) * (-391.944) (-389.945) [-389.875] (-391.432) -- 0:00:26

      Average standard deviation of split frequencies: 0.009251

      585500 -- (-390.538) (-392.643) (-390.791) [-392.419] * (-391.772) (-389.999) [-389.249] (-390.170) -- 0:00:26
      586000 -- [-393.438] (-391.969) (-390.363) (-392.988) * (-394.250) (-388.868) (-389.340) [-391.758] -- 0:00:26
      586500 -- [-390.877] (-389.115) (-389.971) (-391.050) * (-395.495) (-393.458) [-389.230] (-389.566) -- 0:00:26
      587000 -- (-390.438) (-390.265) (-395.637) [-388.799] * (-396.464) [-394.848] (-393.602) (-389.575) -- 0:00:26
      587500 -- [-392.030] (-392.663) (-389.965) (-392.448) * (-391.450) (-390.970) [-389.337] (-397.875) -- 0:00:25
      588000 -- (-392.983) (-394.967) [-390.214] (-391.294) * [-389.699] (-391.518) (-392.257) (-390.818) -- 0:00:25
      588500 -- (-389.331) [-392.035] (-390.216) (-394.238) * (-390.434) [-392.971] (-391.180) (-391.945) -- 0:00:25
      589000 -- [-389.970] (-392.125) (-389.940) (-391.436) * (-392.863) (-391.893) (-389.320) [-392.117] -- 0:00:25
      589500 -- (-390.532) (-392.186) [-390.975] (-391.260) * (-391.935) (-390.082) (-394.045) [-392.092] -- 0:00:25
      590000 -- [-388.862] (-392.369) (-392.068) (-390.075) * (-390.578) [-390.900] (-390.942) (-392.059) -- 0:00:25

      Average standard deviation of split frequencies: 0.009483

      590500 -- (-394.036) (-390.393) (-391.839) [-389.659] * (-391.530) (-390.262) [-390.011] (-391.739) -- 0:00:25
      591000 -- [-393.493] (-390.311) (-391.985) (-390.829) * (-392.099) (-390.561) (-391.346) [-393.122] -- 0:00:25
      591500 -- (-389.661) (-391.103) [-391.010] (-389.816) * [-392.871] (-390.677) (-390.465) (-392.406) -- 0:00:25
      592000 -- (-392.089) (-397.680) (-390.332) [-388.862] * (-391.056) [-390.762] (-393.412) (-397.350) -- 0:00:25
      592500 -- (-393.265) [-393.405] (-388.868) (-389.740) * (-391.840) [-393.602] (-390.440) (-391.774) -- 0:00:25
      593000 -- [-389.372] (-394.199) (-391.161) (-393.320) * [-392.787] (-391.045) (-389.560) (-393.952) -- 0:00:25
      593500 -- [-391.409] (-389.510) (-391.042) (-392.114) * (-392.471) (-396.875) (-392.829) [-395.202] -- 0:00:25
      594000 -- (-395.396) (-391.322) (-392.668) [-396.291] * (-392.873) (-389.792) [-391.992] (-392.314) -- 0:00:25
      594500 -- (-391.984) (-389.062) [-391.969] (-392.423) * (-390.731) (-389.817) [-389.930] (-390.083) -- 0:00:25
      595000 -- (-392.071) (-389.948) (-390.948) [-389.162] * [-390.630] (-391.715) (-390.910) (-391.561) -- 0:00:25

      Average standard deviation of split frequencies: 0.009491

      595500 -- (-395.070) [-389.310] (-391.152) (-389.229) * (-389.731) (-391.101) [-390.428] (-390.450) -- 0:00:25
      596000 -- [-390.611] (-388.903) (-391.332) (-393.605) * (-393.745) (-390.043) [-393.355] (-391.890) -- 0:00:25
      596500 -- (-392.508) [-390.543] (-389.354) (-388.997) * [-390.543] (-391.418) (-391.213) (-392.282) -- 0:00:25
      597000 -- (-389.680) (-399.618) [-391.850] (-390.539) * [-388.957] (-395.024) (-389.821) (-396.513) -- 0:00:25
      597500 -- (-393.682) [-397.661] (-391.897) (-390.063) * [-389.462] (-391.244) (-392.068) (-393.885) -- 0:00:25
      598000 -- (-392.737) (-396.232) (-391.230) [-389.469] * [-392.972] (-391.197) (-391.397) (-389.114) -- 0:00:25
      598500 -- (-393.582) (-389.642) (-390.261) [-390.044] * [-389.626] (-390.575) (-391.586) (-392.092) -- 0:00:25
      599000 -- (-393.446) (-391.328) [-395.423] (-389.710) * [-390.544] (-390.161) (-389.780) (-393.329) -- 0:00:25
      599500 -- [-391.350] (-390.707) (-389.574) (-391.244) * (-392.427) (-390.614) (-391.587) [-392.754] -- 0:00:25
      600000 -- (-389.933) (-389.980) (-389.401) [-390.544] * (-389.384) (-395.696) [-392.456] (-393.833) -- 0:00:25

      Average standard deviation of split frequencies: 0.009833

      600500 -- (-391.831) [-389.561] (-389.405) (-393.119) * (-390.251) [-391.736] (-389.978) (-390.855) -- 0:00:25
      601000 -- [-391.963] (-392.395) (-389.058) (-391.076) * (-389.974) [-389.618] (-388.982) (-391.015) -- 0:00:25
      601500 -- [-395.301] (-389.787) (-390.261) (-388.909) * (-391.001) (-390.722) (-389.415) [-390.857] -- 0:00:25
      602000 -- (-392.142) [-392.905] (-392.340) (-389.162) * (-390.448) (-390.977) (-389.206) [-390.084] -- 0:00:25
      602500 -- [-398.424] (-391.039) (-391.312) (-390.216) * (-389.764) (-398.730) (-390.436) [-390.643] -- 0:00:25
      603000 -- (-389.144) (-392.025) [-394.782] (-389.544) * (-392.137) [-389.723] (-392.255) (-393.300) -- 0:00:25
      603500 -- (-391.841) [-392.445] (-392.411) (-390.159) * (-391.106) [-389.307] (-389.788) (-392.319) -- 0:00:24
      604000 -- (-392.717) (-392.534) (-391.063) [-389.925] * (-392.342) (-390.663) (-392.340) [-390.349] -- 0:00:24
      604500 -- (-395.201) (-394.393) [-391.724] (-390.521) * (-390.919) (-392.022) (-389.811) [-391.152] -- 0:00:24
      605000 -- (-390.216) (-389.830) (-390.675) [-390.567] * [-392.872] (-393.048) (-390.760) (-393.901) -- 0:00:24

      Average standard deviation of split frequencies: 0.010113

      605500 -- (-391.457) (-389.626) [-390.824] (-391.595) * [-395.560] (-388.579) (-390.494) (-391.908) -- 0:00:24
      606000 -- (-392.504) (-393.472) (-390.173) [-393.225] * (-391.491) (-390.873) [-389.307] (-391.348) -- 0:00:24
      606500 -- [-395.447] (-390.589) (-390.023) (-391.442) * (-389.729) (-390.085) (-389.462) [-390.472] -- 0:00:24
      607000 -- (-394.192) [-392.240] (-392.285) (-391.468) * (-389.306) (-389.533) [-392.187] (-391.565) -- 0:00:24
      607500 -- (-394.290) [-391.336] (-393.703) (-392.008) * (-393.833) [-391.273] (-389.754) (-392.116) -- 0:00:24
      608000 -- [-391.489] (-392.090) (-395.319) (-391.384) * [-389.619] (-391.113) (-389.610) (-389.319) -- 0:00:24
      608500 -- (-391.626) (-392.394) [-391.369] (-390.396) * (-392.022) [-390.670] (-391.092) (-393.279) -- 0:00:24
      609000 -- (-390.421) (-389.688) (-392.397) [-391.319] * (-396.471) (-391.863) (-391.930) [-390.738] -- 0:00:24
      609500 -- [-388.812] (-391.474) (-391.763) (-389.592) * [-392.041] (-391.310) (-389.510) (-389.912) -- 0:00:24
      610000 -- (-389.939) (-391.843) (-390.734) [-388.934] * (-392.460) [-393.757] (-391.137) (-390.853) -- 0:00:24

      Average standard deviation of split frequencies: 0.010217

      610500 -- (-397.833) (-392.685) (-390.928) [-392.169] * (-390.988) (-394.297) [-389.209] (-392.185) -- 0:00:24
      611000 -- (-390.968) [-392.498] (-391.715) (-395.121) * (-391.874) (-391.279) [-389.074] (-389.356) -- 0:00:24
      611500 -- [-390.183] (-389.393) (-390.161) (-389.916) * (-394.285) [-392.302] (-392.726) (-390.793) -- 0:00:24
      612000 -- (-390.169) [-392.270] (-390.427) (-389.122) * (-390.394) (-393.724) (-389.224) [-391.183] -- 0:00:24
      612500 -- (-395.623) [-390.399] (-389.113) (-392.357) * [-390.997] (-393.100) (-391.047) (-391.025) -- 0:00:24
      613000 -- (-390.953) (-394.116) [-389.369] (-390.334) * [-390.865] (-391.892) (-390.643) (-393.788) -- 0:00:24
      613500 -- [-389.378] (-390.194) (-394.482) (-391.242) * [-389.724] (-390.964) (-390.424) (-391.786) -- 0:00:24
      614000 -- (-389.948) (-389.883) (-392.669) [-391.975] * [-392.512] (-389.535) (-389.492) (-390.306) -- 0:00:24
      614500 -- (-393.570) (-389.312) (-392.275) [-390.574] * (-389.592) (-392.045) (-389.492) [-389.620] -- 0:00:24
      615000 -- [-390.217] (-394.337) (-391.303) (-390.338) * (-391.481) (-391.204) (-391.674) [-390.317] -- 0:00:24

      Average standard deviation of split frequencies: 0.010618

      615500 -- [-389.248] (-398.096) (-389.592) (-393.615) * (-390.257) (-394.951) [-390.487] (-391.302) -- 0:00:24
      616000 -- [-390.120] (-396.027) (-392.780) (-389.704) * (-389.951) (-390.567) (-390.170) [-393.138] -- 0:00:24
      616500 -- (-390.314) [-391.331] (-390.225) (-389.216) * (-391.886) (-389.275) [-390.364] (-395.091) -- 0:00:24
      617000 -- (-393.820) (-391.093) (-390.956) [-390.814] * (-390.994) [-390.986] (-391.012) (-393.350) -- 0:00:24
      617500 -- (-390.936) (-391.131) [-389.098] (-391.146) * [-389.332] (-396.555) (-391.983) (-391.081) -- 0:00:24
      618000 -- (-391.599) (-390.791) (-389.361) [-390.718] * (-389.236) (-390.390) [-389.453] (-391.524) -- 0:00:24
      618500 -- [-391.137] (-389.530) (-389.153) (-391.435) * [-391.010] (-388.756) (-390.060) (-389.559) -- 0:00:24
      619000 -- [-390.775] (-390.315) (-391.037) (-391.377) * (-392.570) (-391.998) [-391.293] (-392.092) -- 0:00:24
      619500 -- (-394.438) (-392.199) [-390.599] (-390.897) * (-390.402) (-396.375) (-391.082) [-392.831] -- 0:00:23
      620000 -- (-393.929) (-389.476) (-391.331) [-388.846] * [-389.069] (-391.448) (-390.751) (-390.039) -- 0:00:23

      Average standard deviation of split frequencies: 0.010186

      620500 -- (-395.469) (-389.362) (-393.127) [-389.864] * [-390.660] (-390.567) (-390.005) (-389.770) -- 0:00:23
      621000 -- (-389.266) (-390.374) [-389.938] (-390.815) * [-391.270] (-391.245) (-392.374) (-391.908) -- 0:00:23
      621500 -- [-393.001] (-389.695) (-391.486) (-396.643) * (-390.254) (-389.518) (-390.284) [-389.839] -- 0:00:23
      622000 -- (-392.055) [-390.540] (-393.481) (-390.655) * (-395.175) (-393.971) (-390.906) [-389.556] -- 0:00:23
      622500 -- (-390.186) (-390.572) (-393.429) [-392.509] * [-390.447] (-391.718) (-390.970) (-390.350) -- 0:00:23
      623000 -- (-389.867) (-395.431) [-392.984] (-391.158) * (-389.701) (-393.617) (-393.717) [-390.715] -- 0:00:23
      623500 -- (-391.716) (-395.826) (-390.821) [-390.874] * (-389.507) (-392.539) (-390.209) [-391.285] -- 0:00:23
      624000 -- (-393.358) (-389.719) [-389.865] (-389.315) * (-390.916) (-389.742) (-392.124) [-393.565] -- 0:00:23
      624500 -- (-389.394) [-394.150] (-389.689) (-390.848) * [-390.249] (-392.674) (-390.433) (-393.732) -- 0:00:23
      625000 -- (-389.538) (-392.591) [-391.365] (-394.575) * (-389.368) [-392.409] (-391.106) (-389.621) -- 0:00:23

      Average standard deviation of split frequencies: 0.010233

      625500 -- (-392.138) [-392.668] (-389.902) (-389.830) * [-389.431] (-389.773) (-389.303) (-390.005) -- 0:00:23
      626000 -- (-392.305) (-392.560) (-394.018) [-394.594] * (-391.161) [-390.599] (-389.373) (-392.965) -- 0:00:23
      626500 -- [-393.817] (-390.734) (-394.249) (-388.822) * (-391.027) (-390.238) (-394.168) [-389.302] -- 0:00:23
      627000 -- (-395.981) (-389.919) (-394.065) [-389.404] * (-394.840) (-394.314) [-392.402] (-389.317) -- 0:00:23
      627500 -- (-392.781) (-390.432) (-390.048) [-389.823] * (-389.514) (-394.501) (-394.057) [-388.918] -- 0:00:23
      628000 -- (-398.016) [-393.826] (-389.529) (-389.681) * [-391.991] (-393.452) (-392.062) (-392.221) -- 0:00:23
      628500 -- [-391.026] (-389.903) (-392.989) (-389.603) * (-393.770) [-391.634] (-394.036) (-388.875) -- 0:00:23
      629000 -- [-390.690] (-391.353) (-393.660) (-390.572) * (-395.989) [-389.900] (-392.892) (-388.917) -- 0:00:23
      629500 -- (-391.658) [-390.928] (-391.610) (-393.473) * (-391.885) [-392.579] (-389.991) (-389.068) -- 0:00:23
      630000 -- [-391.252] (-394.009) (-393.788) (-391.075) * [-390.527] (-391.922) (-389.865) (-392.627) -- 0:00:23

      Average standard deviation of split frequencies: 0.010113

      630500 -- (-393.128) [-395.926] (-393.518) (-390.447) * [-390.828] (-390.911) (-391.126) (-389.006) -- 0:00:23
      631000 -- (-390.639) (-389.899) (-398.277) [-393.030] * (-389.527) [-393.333] (-389.485) (-392.264) -- 0:00:23
      631500 -- (-393.032) [-390.880] (-395.338) (-389.639) * (-391.625) (-393.250) [-389.471] (-391.822) -- 0:00:23
      632000 -- (-389.570) [-392.436] (-390.546) (-391.328) * (-392.342) (-391.528) (-389.537) [-389.783] -- 0:00:23
      632500 -- [-389.336] (-393.043) (-391.299) (-389.899) * (-391.194) (-394.611) [-391.356] (-390.842) -- 0:00:23
      633000 -- (-391.571) (-390.693) [-391.542] (-389.522) * (-390.866) (-389.347) [-392.101] (-390.925) -- 0:00:23
      633500 -- (-390.709) [-394.188] (-389.989) (-391.138) * (-391.111) (-390.986) [-389.911] (-390.131) -- 0:00:23
      634000 -- (-391.098) [-389.761] (-389.352) (-388.819) * (-392.931) [-388.877] (-391.023) (-390.914) -- 0:00:23
      634500 -- (-391.759) (-391.118) (-393.215) [-390.404] * (-394.078) [-395.062] (-390.986) (-389.351) -- 0:00:23
      635000 -- (-391.417) [-393.062] (-392.438) (-388.897) * (-391.147) [-390.447] (-392.868) (-388.780) -- 0:00:22

      Average standard deviation of split frequencies: 0.009766

      635500 -- (-389.835) (-391.784) [-389.944] (-391.032) * (-389.616) (-392.194) [-390.971] (-391.487) -- 0:00:22
      636000 -- (-395.255) (-390.096) [-389.044] (-394.277) * (-391.546) (-390.269) (-388.941) [-390.122] -- 0:00:22
      636500 -- [-390.208] (-390.625) (-391.580) (-394.417) * (-389.509) (-395.703) (-389.871) [-389.555] -- 0:00:22
      637000 -- (-393.357) (-394.516) [-389.014] (-390.629) * (-391.920) [-395.277] (-392.513) (-390.397) -- 0:00:22
      637500 -- (-392.461) (-390.618) [-390.349] (-392.685) * (-391.280) [-390.536] (-397.718) (-391.531) -- 0:00:22
      638000 -- (-392.760) (-391.958) [-394.121] (-392.641) * (-391.612) (-393.815) (-389.733) [-391.307] -- 0:00:22
      638500 -- (-389.864) (-392.954) [-390.079] (-390.200) * [-392.760] (-389.673) (-390.670) (-393.445) -- 0:00:22
      639000 -- (-389.766) (-392.142) (-393.178) [-389.573] * (-391.476) [-389.856] (-393.605) (-392.346) -- 0:00:22
      639500 -- (-393.039) [-389.295] (-393.054) (-389.293) * (-391.963) [-389.836] (-389.957) (-390.117) -- 0:00:23
      640000 -- (-392.426) (-397.501) (-394.601) [-394.088] * (-389.933) (-390.457) [-390.031] (-394.660) -- 0:00:23

      Average standard deviation of split frequencies: 0.009609

      640500 -- (-390.197) (-392.031) [-392.295] (-390.313) * (-392.218) [-390.843] (-393.516) (-391.450) -- 0:00:23
      641000 -- [-395.093] (-394.455) (-393.415) (-389.572) * [-391.831] (-389.560) (-391.553) (-391.052) -- 0:00:22
      641500 -- (-391.891) (-390.283) (-393.027) [-389.920] * [-392.359] (-392.380) (-390.377) (-392.885) -- 0:00:22
      642000 -- (-390.560) [-390.535] (-393.949) (-393.684) * [-389.858] (-389.116) (-390.608) (-388.849) -- 0:00:22
      642500 -- (-390.481) (-389.577) (-389.361) [-389.425] * (-389.584) (-391.063) (-390.816) [-389.251] -- 0:00:22
      643000 -- (-393.486) (-391.500) (-392.938) [-390.675] * (-389.016) (-392.169) (-389.142) [-394.277] -- 0:00:22
      643500 -- [-389.497] (-395.202) (-390.362) (-391.416) * (-391.050) (-389.779) (-390.883) [-391.232] -- 0:00:22
      644000 -- (-389.894) (-390.695) (-388.904) [-391.071] * (-389.166) (-390.676) (-393.907) [-389.813] -- 0:00:22
      644500 -- (-390.706) (-394.487) (-389.963) [-390.466] * (-392.621) (-390.153) [-391.158] (-392.936) -- 0:00:22
      645000 -- (-389.980) (-392.770) [-390.213] (-389.394) * [-391.728] (-392.988) (-390.494) (-394.728) -- 0:00:22

      Average standard deviation of split frequencies: 0.009959

      645500 -- (-394.570) (-394.594) (-391.285) [-390.313] * (-391.245) (-389.380) [-393.349] (-398.512) -- 0:00:22
      646000 -- (-393.960) [-391.395] (-391.672) (-390.514) * (-390.783) [-391.903] (-389.853) (-393.735) -- 0:00:22
      646500 -- [-391.887] (-391.189) (-390.354) (-391.188) * (-390.374) (-393.176) (-391.561) [-391.931] -- 0:00:22
      647000 -- (-390.758) (-399.133) [-391.065] (-391.043) * [-391.221] (-391.206) (-388.994) (-393.264) -- 0:00:22
      647500 -- (-392.132) [-393.464] (-390.467) (-392.463) * (-390.969) [-390.777] (-391.572) (-390.059) -- 0:00:22
      648000 -- (-396.928) (-393.348) [-390.618] (-391.124) * (-391.523) [-389.142] (-391.738) (-388.899) -- 0:00:22
      648500 -- [-395.884] (-391.711) (-390.402) (-390.125) * (-389.172) (-390.531) (-390.256) [-392.515] -- 0:00:22
      649000 -- (-395.224) (-395.283) (-389.767) [-389.790] * (-390.184) (-392.479) [-392.779] (-390.956) -- 0:00:22
      649500 -- (-391.612) [-389.426] (-392.475) (-392.469) * (-396.927) (-390.268) (-393.041) [-390.536] -- 0:00:22
      650000 -- [-392.707] (-390.460) (-390.210) (-395.544) * (-395.524) [-393.517] (-391.345) (-390.677) -- 0:00:22

      Average standard deviation of split frequencies: 0.009205

      650500 -- (-395.824) (-390.998) (-390.462) [-389.870] * (-390.635) (-392.125) [-390.784] (-393.863) -- 0:00:22
      651000 -- (-389.990) [-389.714] (-391.762) (-389.408) * (-389.804) (-390.407) (-389.795) [-391.568] -- 0:00:21
      651500 -- [-390.044] (-390.421) (-389.647) (-390.808) * (-390.393) [-393.100] (-392.801) (-391.681) -- 0:00:21
      652000 -- (-390.784) [-389.307] (-389.176) (-390.008) * [-389.478] (-390.984) (-390.742) (-391.932) -- 0:00:21
      652500 -- [-390.083] (-391.279) (-390.442) (-390.923) * (-389.439) [-391.701] (-391.087) (-392.309) -- 0:00:21
      653000 -- [-390.629] (-390.926) (-390.183) (-392.440) * (-390.014) (-393.462) (-388.780) [-389.460] -- 0:00:21
      653500 -- [-395.150] (-390.350) (-390.642) (-391.373) * (-390.844) [-391.101] (-390.516) (-391.858) -- 0:00:21
      654000 -- (-392.756) (-392.381) (-390.100) [-392.462] * (-391.437) (-391.619) (-391.290) [-390.948] -- 0:00:21
      654500 -- (-392.924) (-401.184) (-390.472) [-392.313] * (-394.806) [-389.126] (-391.760) (-390.280) -- 0:00:22
      655000 -- (-389.283) [-392.006] (-390.163) (-392.733) * (-393.743) (-392.322) [-389.261] (-389.309) -- 0:00:22

      Average standard deviation of split frequencies: 0.009131

      655500 -- [-388.964] (-391.608) (-390.424) (-395.274) * (-391.093) (-391.048) [-392.863] (-389.360) -- 0:00:22
      656000 -- (-388.932) (-390.351) (-389.645) [-394.214] * (-389.956) (-392.813) [-394.028] (-391.613) -- 0:00:22
      656500 -- (-391.149) (-391.150) [-390.273] (-390.750) * (-389.616) (-389.735) [-391.490] (-394.419) -- 0:00:21
      657000 -- (-394.096) (-393.855) (-390.433) [-390.440] * (-390.435) [-390.576] (-390.560) (-390.444) -- 0:00:21
      657500 -- (-391.294) (-389.086) (-392.998) [-390.484] * (-391.100) (-392.687) (-389.759) [-390.499] -- 0:00:21
      658000 -- [-391.281] (-391.802) (-394.433) (-392.550) * (-393.144) [-390.841] (-393.980) (-392.242) -- 0:00:21
      658500 -- (-391.670) (-394.172) [-392.877] (-389.156) * (-390.604) (-393.006) [-392.392] (-392.414) -- 0:00:21
      659000 -- (-391.804) (-395.511) [-391.842] (-389.628) * (-390.345) [-390.048] (-391.197) (-392.157) -- 0:00:21
      659500 -- (-391.018) (-391.407) [-394.805] (-389.673) * (-395.016) (-393.582) [-392.824] (-392.632) -- 0:00:21
      660000 -- [-391.214] (-395.761) (-394.886) (-390.105) * (-391.781) (-392.372) [-389.737] (-395.761) -- 0:00:21

      Average standard deviation of split frequencies: 0.009365

      660500 -- (-392.363) (-389.517) [-391.168] (-390.619) * (-390.049) (-391.521) [-390.395] (-391.197) -- 0:00:21
      661000 -- (-390.930) [-390.431] (-389.052) (-395.138) * (-391.018) (-388.995) [-391.779] (-391.259) -- 0:00:21
      661500 -- (-391.905) [-388.872] (-392.549) (-390.470) * (-393.776) [-389.320] (-393.814) (-392.585) -- 0:00:21
      662000 -- (-389.231) [-388.868] (-389.786) (-394.234) * (-390.219) (-389.912) [-392.071] (-391.092) -- 0:00:21
      662500 -- [-389.473] (-389.506) (-389.665) (-390.851) * (-390.460) (-392.046) [-389.660] (-394.862) -- 0:00:21
      663000 -- (-390.937) (-393.595) (-391.091) [-390.762] * [-391.754] (-397.559) (-393.529) (-391.213) -- 0:00:21
      663500 -- [-390.435] (-391.616) (-393.110) (-396.599) * (-392.782) [-395.182] (-389.919) (-394.285) -- 0:00:21
      664000 -- (-394.261) [-389.893] (-390.185) (-393.475) * (-391.989) (-389.530) [-393.637] (-394.060) -- 0:00:21
      664500 -- (-390.988) (-389.445) [-391.117] (-393.688) * (-389.927) (-389.791) (-392.402) [-393.887] -- 0:00:21
      665000 -- [-392.680] (-389.418) (-391.302) (-389.922) * (-390.308) (-389.596) [-390.017] (-390.081) -- 0:00:21

      Average standard deviation of split frequencies: 0.009777

      665500 -- (-392.238) (-390.443) (-391.120) [-389.446] * [-392.580] (-389.130) (-389.196) (-392.883) -- 0:00:21
      666000 -- (-392.277) (-389.999) [-390.884] (-389.549) * (-393.449) (-389.887) (-390.356) [-393.777] -- 0:00:21
      666500 -- (-391.054) [-389.090] (-394.475) (-388.936) * (-392.237) (-390.745) (-389.538) [-390.560] -- 0:00:21
      667000 -- [-391.838] (-393.069) (-392.852) (-388.573) * [-390.521] (-391.961) (-390.906) (-390.509) -- 0:00:21
      667500 -- (-391.098) (-389.674) [-391.674] (-391.195) * (-392.037) [-397.288] (-391.823) (-392.818) -- 0:00:21
      668000 -- (-392.065) (-392.561) [-392.219] (-390.345) * (-390.713) (-402.206) (-390.287) [-392.368] -- 0:00:21
      668500 -- (-393.130) [-394.534] (-390.768) (-390.746) * [-392.117] (-390.542) (-390.325) (-398.087) -- 0:00:21
      669000 -- (-391.983) [-389.542] (-391.656) (-389.806) * (-392.900) (-389.837) [-391.232] (-393.051) -- 0:00:21
      669500 -- (-392.320) [-390.197] (-389.123) (-389.520) * (-392.528) (-389.422) [-391.396] (-391.172) -- 0:00:21
      670000 -- (-390.302) [-389.603] (-390.748) (-390.289) * [-390.817] (-392.517) (-390.904) (-392.863) -- 0:00:21

      Average standard deviation of split frequencies: 0.009753

      670500 -- (-389.818) (-389.981) [-389.026] (-391.081) * (-389.026) (-392.021) (-390.025) [-395.125] -- 0:00:21
      671000 -- [-391.509] (-393.626) (-390.342) (-394.198) * (-394.099) (-391.122) (-389.203) [-391.240] -- 0:00:21
      671500 -- (-390.339) [-390.970] (-390.698) (-390.218) * (-393.943) (-396.959) [-388.793] (-389.999) -- 0:00:21
      672000 -- (-395.122) (-394.178) [-392.329] (-390.372) * [-391.766] (-395.220) (-388.901) (-390.747) -- 0:00:20
      672500 -- (-392.860) [-389.943] (-390.006) (-388.789) * (-392.203) (-390.974) (-389.576) [-389.989] -- 0:00:20
      673000 -- (-391.775) (-391.176) [-389.991] (-388.793) * (-391.657) (-390.278) (-390.992) [-392.217] -- 0:00:20
      673500 -- (-390.298) (-393.869) [-391.423] (-390.286) * (-390.970) (-399.552) [-389.536] (-393.546) -- 0:00:20
      674000 -- (-392.228) (-389.923) [-390.687] (-394.186) * (-397.673) [-390.191] (-389.580) (-391.887) -- 0:00:20
      674500 -- (-391.220) [-389.050] (-392.739) (-391.025) * (-394.647) (-391.523) (-393.157) [-393.266] -- 0:00:20
      675000 -- (-393.441) [-388.889] (-390.940) (-392.231) * (-391.352) (-390.356) (-390.132) [-389.026] -- 0:00:20

      Average standard deviation of split frequencies: 0.009588

      675500 -- (-390.574) (-396.080) [-390.785] (-393.786) * [-394.820] (-391.814) (-389.772) (-388.925) -- 0:00:20
      676000 -- (-389.846) (-392.739) (-390.393) [-395.649] * [-391.928] (-391.579) (-389.040) (-390.313) -- 0:00:20
      676500 -- [-389.892] (-391.467) (-391.909) (-391.475) * (-390.498) (-395.358) (-391.629) [-391.701] -- 0:00:20
      677000 -- (-390.896) [-391.855] (-393.678) (-390.582) * [-392.090] (-394.012) (-389.807) (-390.579) -- 0:00:20
      677500 -- (-391.436) (-390.577) (-392.925) [-390.765] * (-390.804) [-391.816] (-395.619) (-390.650) -- 0:00:20
      678000 -- (-391.080) (-390.992) [-392.440] (-389.441) * [-390.347] (-389.128) (-393.080) (-390.482) -- 0:00:20
      678500 -- [-389.618] (-392.154) (-390.703) (-391.923) * [-390.868] (-390.821) (-393.146) (-391.676) -- 0:00:20
      679000 -- [-390.544] (-397.362) (-390.169) (-389.619) * (-391.635) (-393.443) (-393.416) [-389.276] -- 0:00:20
      679500 -- (-392.651) [-388.990] (-389.252) (-389.763) * [-389.464] (-390.370) (-394.134) (-389.347) -- 0:00:20
      680000 -- [-389.261] (-391.887) (-389.795) (-392.311) * (-390.158) (-392.499) [-391.163] (-391.168) -- 0:00:20

      Average standard deviation of split frequencies: 0.009176

      680500 -- (-389.849) [-394.540] (-391.867) (-390.725) * (-391.049) (-393.148) [-391.844] (-390.572) -- 0:00:20
      681000 -- (-389.760) [-391.480] (-390.316) (-393.007) * (-390.008) [-391.986] (-393.236) (-391.304) -- 0:00:20
      681500 -- [-389.629] (-391.360) (-390.603) (-389.915) * (-388.835) (-393.889) (-394.200) [-391.233] -- 0:00:20
      682000 -- (-390.858) (-390.519) (-389.251) [-389.968] * (-391.967) (-390.781) (-392.032) [-393.085] -- 0:00:20
      682500 -- (-391.335) (-389.996) (-392.440) [-389.683] * [-391.631] (-389.400) (-395.055) (-393.995) -- 0:00:20
      683000 -- (-390.917) (-389.459) (-389.991) [-389.424] * [-390.657] (-389.482) (-395.613) (-393.254) -- 0:00:20
      683500 -- (-390.078) (-389.336) [-391.130] (-393.045) * [-392.565] (-393.504) (-393.529) (-391.863) -- 0:00:20
      684000 -- (-390.489) (-390.914) (-391.631) [-393.003] * (-391.593) [-389.354] (-390.108) (-390.707) -- 0:00:20
      684500 -- (-392.352) (-392.505) [-390.643] (-392.614) * (-393.909) (-395.571) (-389.037) [-389.704] -- 0:00:20
      685000 -- [-390.805] (-389.721) (-390.177) (-391.556) * (-394.038) (-391.331) [-389.562] (-388.888) -- 0:00:20

      Average standard deviation of split frequencies: 0.009406

      685500 -- (-389.632) (-390.211) [-390.253] (-391.851) * (-391.415) (-390.231) (-388.718) [-389.276] -- 0:00:20
      686000 -- (-398.438) (-394.177) (-392.283) [-389.088] * (-390.771) [-389.016] (-389.684) (-391.044) -- 0:00:20
      686500 -- (-390.131) (-392.648) (-392.976) [-392.011] * (-391.373) (-389.528) (-390.060) [-389.253] -- 0:00:20
      687000 -- [-391.971] (-394.278) (-393.971) (-389.095) * (-391.526) [-389.489] (-389.258) (-389.614) -- 0:00:20
      687500 -- (-392.952) (-389.367) [-390.980] (-393.354) * (-389.943) (-393.254) (-390.319) [-391.566] -- 0:00:20
      688000 -- (-390.470) (-390.011) (-390.183) [-389.240] * [-390.716] (-393.761) (-392.780) (-391.183) -- 0:00:19
      688500 -- (-390.564) (-390.011) [-391.079] (-388.884) * (-388.956) (-397.308) [-395.341] (-389.283) -- 0:00:19
      689000 -- [-399.200] (-390.738) (-389.217) (-392.364) * (-390.431) (-400.022) (-389.454) [-389.804] -- 0:00:19
      689500 -- (-393.613) (-389.868) [-389.164] (-392.641) * [-391.273] (-392.120) (-390.105) (-391.119) -- 0:00:19
      690000 -- (-392.385) (-394.024) (-390.377) [-391.367] * [-389.464] (-390.773) (-389.514) (-392.948) -- 0:00:19

      Average standard deviation of split frequencies: 0.009214

      690500 -- [-391.958] (-391.305) (-391.499) (-389.502) * (-390.248) (-394.595) (-391.373) [-392.349] -- 0:00:19
      691000 -- (-394.154) (-391.925) (-395.180) [-389.544] * (-391.436) (-392.845) (-390.329) [-390.771] -- 0:00:19
      691500 -- (-392.315) (-392.554) (-389.838) [-390.028] * (-390.710) (-392.592) (-392.912) [-390.071] -- 0:00:20
      692000 -- (-391.399) (-392.292) [-389.316] (-389.826) * [-393.046] (-389.812) (-389.772) (-390.982) -- 0:00:20
      692500 -- [-390.030] (-391.228) (-390.575) (-390.916) * [-389.150] (-390.304) (-391.766) (-393.054) -- 0:00:19
      693000 -- (-389.904) [-390.348] (-390.294) (-389.439) * [-389.300] (-389.156) (-392.571) (-391.189) -- 0:00:19
      693500 -- (-390.635) (-390.643) (-390.708) [-390.993] * [-389.284] (-393.597) (-398.495) (-390.341) -- 0:00:19
      694000 -- [-390.704] (-394.145) (-392.146) (-394.113) * [-391.212] (-392.399) (-393.561) (-391.324) -- 0:00:19
      694500 -- (-392.046) [-391.199] (-390.509) (-391.430) * (-392.901) (-390.833) [-392.520] (-392.225) -- 0:00:19
      695000 -- (-394.278) [-389.515] (-390.854) (-391.423) * (-392.538) (-390.178) [-391.368] (-390.850) -- 0:00:19

      Average standard deviation of split frequencies: 0.009398

      695500 -- (-393.301) [-391.472] (-389.942) (-391.152) * (-393.425) (-390.452) [-395.302] (-399.234) -- 0:00:19
      696000 -- (-389.420) (-388.868) [-392.101] (-391.230) * (-392.433) [-393.384] (-394.225) (-392.150) -- 0:00:19
      696500 -- [-388.847] (-391.215) (-391.484) (-389.216) * (-392.488) (-392.959) [-390.534] (-395.001) -- 0:00:19
      697000 -- (-390.245) (-391.722) (-390.749) [-389.796] * (-391.827) [-390.911] (-392.369) (-390.597) -- 0:00:19
      697500 -- (-393.506) (-394.924) [-389.583] (-389.454) * [-390.539] (-391.225) (-391.453) (-388.691) -- 0:00:19
      698000 -- (-393.107) (-393.658) (-392.663) [-390.127] * (-393.316) (-389.392) [-391.435] (-389.885) -- 0:00:19
      698500 -- (-393.478) (-395.242) [-390.360] (-390.199) * [-390.117] (-390.327) (-389.188) (-392.611) -- 0:00:19
      699000 -- [-392.909] (-390.153) (-389.551) (-391.422) * [-390.442] (-390.082) (-400.069) (-390.413) -- 0:00:19
      699500 -- (-391.207) [-391.482] (-389.795) (-389.943) * [-391.635] (-391.934) (-394.870) (-395.142) -- 0:00:19
      700000 -- (-391.171) (-391.232) (-393.157) [-389.911] * (-389.775) [-389.932] (-390.898) (-390.951) -- 0:00:19

      Average standard deviation of split frequencies: 0.009335

      700500 -- (-391.287) (-392.657) [-392.329] (-389.251) * (-390.006) (-390.470) (-390.171) [-394.933] -- 0:00:19
      701000 -- (-391.221) [-390.987] (-389.381) (-390.979) * (-392.014) [-390.384] (-392.474) (-390.548) -- 0:00:19
      701500 -- (-393.797) (-392.444) [-390.278] (-389.276) * (-392.784) (-392.797) (-391.606) [-391.262] -- 0:00:19
      702000 -- (-389.480) [-389.583] (-389.401) (-390.567) * (-391.667) (-390.082) (-390.711) [-390.614] -- 0:00:19
      702500 -- (-389.266) [-391.424] (-391.219) (-393.103) * [-391.275] (-389.592) (-388.919) (-390.916) -- 0:00:19
      703000 -- (-390.112) (-391.256) [-392.440] (-393.099) * (-390.937) (-390.395) (-389.188) [-390.045] -- 0:00:19
      703500 -- [-393.480] (-389.704) (-390.872) (-399.106) * (-393.402) (-392.244) [-389.355] (-394.265) -- 0:00:18
      704000 -- (-394.234) (-396.099) (-389.277) [-389.655] * (-389.716) (-390.955) (-393.065) [-389.737] -- 0:00:18
      704500 -- (-391.592) [-394.432] (-390.695) (-390.756) * [-390.044] (-391.958) (-389.830) (-391.277) -- 0:00:18
      705000 -- (-391.008) (-394.071) (-389.971) [-391.671] * (-393.060) (-394.496) [-390.375] (-390.945) -- 0:00:18

      Average standard deviation of split frequencies: 0.009265

      705500 -- [-392.522] (-392.585) (-389.633) (-393.553) * (-391.712) (-395.373) (-388.780) [-389.741] -- 0:00:18
      706000 -- (-391.402) [-392.008] (-394.571) (-396.522) * (-391.186) (-393.379) [-390.862] (-392.117) -- 0:00:18
      706500 -- [-389.156] (-391.817) (-393.175) (-392.966) * (-391.567) (-395.690) [-388.939] (-391.116) -- 0:00:18
      707000 -- (-389.848) (-393.083) (-391.186) [-390.193] * (-393.293) [-390.986] (-392.252) (-391.738) -- 0:00:18
      707500 -- (-388.755) (-391.938) [-391.636] (-391.517) * (-391.564) (-389.965) [-391.588] (-390.598) -- 0:00:19
      708000 -- [-389.814] (-391.675) (-391.711) (-389.927) * (-393.177) (-390.130) (-389.719) [-390.148] -- 0:00:18
      708500 -- [-388.923] (-390.137) (-391.528) (-392.359) * (-392.472) [-390.273] (-392.338) (-391.671) -- 0:00:18
      709000 -- (-390.753) (-391.245) (-390.182) [-389.610] * (-389.772) [-392.428] (-393.410) (-390.148) -- 0:00:18
      709500 -- (-390.878) (-389.804) [-389.113] (-390.384) * (-392.277) (-390.417) (-389.288) [-391.492] -- 0:00:18
      710000 -- (-388.651) [-390.720] (-390.539) (-392.309) * (-390.266) (-397.825) [-389.832] (-388.614) -- 0:00:18

      Average standard deviation of split frequencies: 0.008831

      710500 -- (-389.366) (-393.711) (-391.035) [-392.486] * (-390.014) (-395.508) [-389.404] (-390.451) -- 0:00:18
      711000 -- (-388.802) [-390.032] (-393.418) (-390.934) * (-390.365) [-388.889] (-390.002) (-390.020) -- 0:00:18
      711500 -- (-389.608) (-393.547) [-394.790] (-391.246) * (-389.405) (-390.939) [-390.670] (-392.784) -- 0:00:18
      712000 -- (-391.970) (-391.206) (-398.723) [-389.866] * (-389.405) (-393.182) (-390.404) [-390.977] -- 0:00:18
      712500 -- (-392.127) (-391.453) (-392.481) [-389.735] * (-390.466) (-391.065) [-389.331] (-391.557) -- 0:00:18
      713000 -- [-388.962] (-389.108) (-389.152) (-390.968) * (-388.701) [-394.032] (-390.389) (-391.986) -- 0:00:18
      713500 -- (-390.894) (-392.496) (-391.315) [-389.939] * [-390.229] (-390.131) (-392.052) (-392.818) -- 0:00:18
      714000 -- [-390.294] (-389.865) (-391.865) (-392.802) * (-389.544) (-388.927) (-393.396) [-390.139] -- 0:00:18
      714500 -- (-391.386) [-392.513] (-394.061) (-394.872) * (-393.791) [-388.821] (-393.023) (-390.289) -- 0:00:18
      715000 -- (-391.033) (-390.544) [-390.333] (-397.554) * [-389.913] (-390.823) (-395.606) (-390.885) -- 0:00:18

      Average standard deviation of split frequencies: 0.008998

      715500 -- [-389.907] (-392.207) (-403.903) (-398.255) * (-389.145) (-393.459) (-390.543) [-390.594] -- 0:00:18
      716000 -- (-390.703) (-388.892) [-391.878] (-393.661) * (-393.072) (-393.297) [-390.424] (-390.639) -- 0:00:18
      716500 -- [-391.594] (-389.890) (-389.629) (-389.362) * (-394.418) [-390.181] (-389.806) (-390.991) -- 0:00:18
      717000 -- (-392.070) (-389.197) [-389.603] (-389.873) * (-393.373) [-389.115] (-392.384) (-389.156) -- 0:00:18
      717500 -- (-395.748) (-390.546) (-392.691) [-389.807] * [-391.809] (-393.686) (-389.171) (-390.274) -- 0:00:18
      718000 -- [-390.936] (-389.348) (-393.138) (-392.841) * (-391.379) [-389.726] (-391.641) (-392.175) -- 0:00:18
      718500 -- [-390.996] (-389.175) (-390.956) (-394.836) * [-390.966] (-391.187) (-390.297) (-392.111) -- 0:00:18
      719000 -- (-400.328) [-389.871] (-391.256) (-391.580) * (-390.958) (-391.428) (-391.634) [-391.614] -- 0:00:17
      719500 -- (-395.943) (-393.472) [-391.114] (-390.607) * (-389.917) (-389.555) (-390.844) [-393.441] -- 0:00:17
      720000 -- (-394.734) (-391.305) [-392.084] (-390.825) * (-390.400) [-388.675] (-390.661) (-393.100) -- 0:00:17

      Average standard deviation of split frequencies: 0.008581

      720500 -- (-389.504) (-392.034) [-391.950] (-390.328) * [-391.112] (-390.629) (-390.267) (-390.717) -- 0:00:17
      721000 -- (-391.909) (-391.079) [-392.833] (-389.925) * (-390.566) (-395.142) (-390.830) [-392.948] -- 0:00:17
      721500 -- (-397.052) (-391.542) (-399.629) [-389.915] * (-394.345) (-391.690) (-390.093) [-390.464] -- 0:00:17
      722000 -- (-393.140) (-390.474) (-391.985) [-389.223] * [-390.510] (-390.547) (-389.558) (-389.927) -- 0:00:18
      722500 -- [-390.554] (-394.374) (-391.751) (-391.878) * (-388.813) (-390.749) [-389.906] (-389.282) -- 0:00:18
      723000 -- (-390.030) (-391.064) [-391.126] (-390.005) * [-389.498] (-392.391) (-390.892) (-390.061) -- 0:00:18
      723500 -- (-393.003) (-391.244) (-389.959) [-391.093] * (-389.336) (-390.253) [-390.150] (-392.228) -- 0:00:17
      724000 -- [-391.250] (-389.711) (-396.911) (-390.436) * [-389.190] (-391.493) (-389.640) (-389.826) -- 0:00:17
      724500 -- (-392.473) [-391.309] (-389.838) (-392.492) * (-392.287) [-389.476] (-390.235) (-394.187) -- 0:00:17
      725000 -- (-393.680) [-389.826] (-393.398) (-389.217) * (-390.994) (-391.229) [-389.816] (-392.491) -- 0:00:17

      Average standard deviation of split frequencies: 0.008730

      725500 -- (-390.014) [-391.322] (-394.845) (-389.567) * (-391.036) (-395.363) (-392.079) [-389.726] -- 0:00:17
      726000 -- [-390.226] (-390.214) (-391.442) (-390.216) * (-391.404) [-392.096] (-394.722) (-389.537) -- 0:00:17
      726500 -- (-389.342) (-389.456) (-395.186) [-389.700] * (-390.145) (-393.009) [-390.316] (-391.122) -- 0:00:17
      727000 -- (-392.090) (-393.001) (-389.228) [-388.904] * (-391.471) (-390.122) [-390.110] (-390.235) -- 0:00:17
      727500 -- (-389.742) (-389.338) [-398.061] (-389.354) * (-396.537) (-389.298) [-389.134] (-389.945) -- 0:00:17
      728000 -- (-390.790) [-389.651] (-391.090) (-390.811) * (-392.487) (-390.144) (-389.971) [-390.347] -- 0:00:17
      728500 -- (-393.997) (-389.422) (-391.912) [-390.359] * (-393.364) (-393.161) (-391.671) [-389.808] -- 0:00:17
      729000 -- (-389.151) [-390.583] (-391.126) (-390.140) * (-389.887) (-389.251) (-393.673) [-390.024] -- 0:00:17
      729500 -- [-390.676] (-390.639) (-390.562) (-391.189) * [-392.113] (-391.134) (-390.832) (-390.643) -- 0:00:17
      730000 -- (-389.308) [-389.597] (-393.854) (-393.739) * [-389.897] (-391.329) (-399.015) (-390.939) -- 0:00:17

      Average standard deviation of split frequencies: 0.008881

      730500 -- [-390.713] (-390.230) (-390.122) (-392.496) * (-393.326) (-390.148) (-399.066) [-391.829] -- 0:00:17
      731000 -- [-393.392] (-393.078) (-393.296) (-391.003) * [-392.805] (-390.169) (-401.515) (-390.824) -- 0:00:17
      731500 -- (-395.937) [-390.695] (-390.037) (-394.747) * (-391.471) (-389.319) (-398.759) [-389.273] -- 0:00:17
      732000 -- [-389.810] (-394.523) (-392.888) (-392.121) * [-393.208] (-390.746) (-392.737) (-393.730) -- 0:00:17
      732500 -- [-394.686] (-390.913) (-390.767) (-391.964) * (-392.331) [-390.071] (-391.999) (-390.437) -- 0:00:17
      733000 -- [-393.684] (-390.228) (-390.915) (-392.238) * (-389.302) (-390.904) [-391.763] (-390.998) -- 0:00:17
      733500 -- [-388.903] (-391.314) (-389.285) (-392.531) * (-390.488) (-391.194) [-390.745] (-390.406) -- 0:00:17
      734000 -- (-390.318) (-391.932) [-389.264] (-392.538) * (-390.802) (-389.661) [-391.113] (-391.948) -- 0:00:17
      734500 -- (-390.889) (-388.638) (-392.219) [-391.958] * (-391.031) [-391.846] (-390.768) (-390.646) -- 0:00:17
      735000 -- (-391.162) (-389.111) (-390.013) [-389.761] * (-389.690) [-389.303] (-395.567) (-392.348) -- 0:00:17

      Average standard deviation of split frequencies: 0.009231

      735500 -- (-395.480) (-388.700) (-389.248) [-391.811] * (-392.537) (-391.655) [-395.113] (-389.785) -- 0:00:17
      736000 -- (-390.357) [-388.922] (-389.450) (-390.516) * (-389.607) (-394.563) [-390.680] (-391.721) -- 0:00:17
      736500 -- [-392.701] (-390.835) (-389.169) (-389.311) * (-389.893) (-394.127) (-390.259) [-397.341] -- 0:00:17
      737000 -- (-391.573) (-392.130) (-391.246) [-391.015] * (-391.160) (-389.965) (-392.721) [-389.805] -- 0:00:17
      737500 -- [-391.186] (-392.542) (-391.005) (-392.176) * (-389.241) (-390.329) (-392.754) [-388.889] -- 0:00:17
      738000 -- (-390.682) [-392.518] (-393.173) (-389.646) * [-389.571] (-393.068) (-389.675) (-392.782) -- 0:00:17
      738500 -- (-398.909) [-391.477] (-390.433) (-393.250) * [-389.143] (-391.067) (-389.701) (-392.169) -- 0:00:16
      739000 -- (-390.022) (-390.535) (-395.971) [-392.276] * (-389.142) [-392.454] (-392.897) (-390.308) -- 0:00:16
      739500 -- [-393.723] (-391.423) (-390.549) (-390.699) * (-393.366) (-392.674) (-391.695) [-390.530] -- 0:00:16
      740000 -- (-389.380) (-391.212) (-389.768) [-391.003] * [-389.850] (-391.555) (-390.295) (-390.637) -- 0:00:16

      Average standard deviation of split frequencies: 0.008873

      740500 -- (-390.327) (-390.403) (-389.883) [-391.838] * (-390.773) [-389.975] (-391.065) (-390.042) -- 0:00:16
      741000 -- (-390.265) (-389.416) (-389.510) [-391.599] * [-393.387] (-394.603) (-390.381) (-390.748) -- 0:00:16
      741500 -- (-390.314) (-389.533) (-391.349) [-391.672] * (-392.960) [-392.500] (-388.615) (-390.252) -- 0:00:16
      742000 -- (-390.303) (-390.571) [-393.394] (-389.608) * (-395.504) [-390.265] (-388.812) (-393.543) -- 0:00:16
      742500 -- (-392.913) [-390.123] (-389.294) (-389.974) * (-393.622) [-390.441] (-389.525) (-388.937) -- 0:00:16
      743000 -- (-391.400) (-390.749) (-389.692) [-389.331] * (-392.527) (-389.533) [-389.879] (-391.530) -- 0:00:16
      743500 -- (-393.384) [-390.627] (-393.052) (-389.646) * (-394.413) (-391.110) [-391.009] (-392.065) -- 0:00:16
      744000 -- (-391.594) [-390.694] (-392.891) (-390.969) * (-391.875) [-392.137] (-391.495) (-393.322) -- 0:00:16
      744500 -- [-391.262] (-395.296) (-392.321) (-391.961) * (-391.792) (-394.749) (-390.551) [-392.870] -- 0:00:16
      745000 -- (-389.647) (-392.761) (-394.569) [-391.564] * (-392.224) [-392.969] (-390.722) (-389.271) -- 0:00:16

      Average standard deviation of split frequencies: 0.009181

      745500 -- (-390.535) (-389.605) [-391.451] (-389.344) * (-389.229) [-392.176] (-391.438) (-391.294) -- 0:00:16
      746000 -- (-392.539) (-393.916) [-392.967] (-393.312) * [-391.249] (-389.333) (-392.959) (-390.435) -- 0:00:16
      746500 -- [-389.661] (-391.386) (-399.638) (-392.177) * (-390.988) [-391.049] (-389.586) (-390.833) -- 0:00:16
      747000 -- (-390.725) (-392.148) [-392.661] (-389.950) * (-389.930) (-389.443) (-393.603) [-390.350] -- 0:00:16
      747500 -- [-390.295] (-395.961) (-389.643) (-389.784) * [-390.546] (-389.031) (-389.916) (-390.170) -- 0:00:16
      748000 -- [-389.423] (-394.884) (-394.275) (-389.534) * [-389.776] (-390.429) (-393.061) (-389.233) -- 0:00:16
      748500 -- (-391.614) (-390.678) (-392.996) [-390.050] * (-394.183) [-392.672] (-389.630) (-389.432) -- 0:00:16
      749000 -- (-391.798) (-393.363) [-389.705] (-390.472) * (-392.959) [-390.364] (-390.391) (-391.329) -- 0:00:16
      749500 -- [-390.527] (-390.971) (-394.668) (-391.847) * (-390.997) (-389.692) (-388.861) [-390.497] -- 0:00:16
      750000 -- (-392.170) (-394.745) (-391.443) [-391.963] * (-391.811) (-391.095) (-392.715) [-389.838] -- 0:00:16

      Average standard deviation of split frequencies: 0.008792

      750500 -- [-394.233] (-392.734) (-390.653) (-393.705) * (-391.755) [-390.452] (-392.126) (-390.144) -- 0:00:16
      751000 -- [-388.970] (-390.726) (-391.799) (-394.287) * (-390.477) (-395.529) (-395.238) [-393.051] -- 0:00:16
      751500 -- [-390.266] (-389.844) (-390.692) (-390.197) * (-391.900) (-394.597) (-390.463) [-389.188] -- 0:00:16
      752000 -- (-389.7