--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:40:09 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2595/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -751.77          -755.71
2       -751.71          -756.61
--------------------------------------
TOTAL     -751.74          -756.26
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.893682    0.089433    0.376787    1.473395    0.858762   1267.81   1384.41    1.000
r(A<->C){all}   0.151438    0.018127    0.000045    0.429099    0.112447    135.97    142.43    1.002
r(A<->G){all}   0.162229    0.019459    0.000044    0.448539    0.123211    130.41    206.29    1.001
r(A<->T){all}   0.175097    0.019836    0.000066    0.452757    0.141213    199.38    226.73    1.003
r(C<->G){all}   0.165205    0.019835    0.000053    0.453140    0.128112    192.97    247.91    1.000
r(C<->T){all}   0.181197    0.020863    0.000122    0.462222    0.146395    194.88    274.53    1.001
r(G<->T){all}   0.164834    0.020610    0.000008    0.461242    0.123024    147.70    173.63    1.001
pi(A){all}      0.228998    0.000315    0.197952    0.267147    0.228012   1165.68   1257.49    1.000
pi(C){all}      0.281769    0.000362    0.244716    0.318980    0.281851   1208.35   1249.71    1.000
pi(G){all}      0.292588    0.000395    0.250960    0.329721    0.292383   1147.00   1150.49    1.000
pi(T){all}      0.196644    0.000295    0.160887    0.227664    0.196798   1200.02   1299.87    1.000
alpha{1,2}      0.416182    0.228647    0.000188    1.416131    0.238986   1157.33   1246.00    1.000
alpha{3}        0.474805    0.244493    0.000184    1.460005    0.307071   1282.11   1391.56    1.001
pinvar{all}     0.997088    0.000012    0.990845    1.000000    0.998202   1084.35   1112.46    1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-724.26471
Model 2: PositiveSelection	-724.264662
Model 0: one-ratio	-724.26468
Model 7: beta	-724.264683
Model 8: beta&w>1	-724.264661


Model 0 vs 1	6.000000007588824E-5

Model 2 vs 1	9.599999998499698E-5

Model 8 vs 7	4.399999988891068E-5
>C1
LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
>C2
LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
>C3
LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
>C4
LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
>C5
LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
>C6
LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=182 

C1              LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
C2              LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
C3              LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
C4              LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
C5              LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
C6              LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
                **************************************************

C1              QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
C2              QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
C3              QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
C4              QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
C5              QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
C6              QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
                **************************************************

C1              ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
C2              ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
C3              ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
C4              ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
C5              ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
C6              ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
                **************************************************

C1              RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
C2              RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
C3              RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
C4              RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
C5              RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
C6              RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
                ********************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  182 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  182 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5460]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [5460]--->[5460]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.475 Mb, Max= 30.722 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
C2              LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
C3              LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
C4              LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
C5              LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
C6              LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
                **************************************************

C1              QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
C2              QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
C3              QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
C4              QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
C5              QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
C6              QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
                **************************************************

C1              ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
C2              ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
C3              ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
C4              ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
C5              ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
C6              ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
                **************************************************

C1              RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
C2              RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
C3              RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
C4              RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
C5              RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
C6              RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
                ********************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG
C2              TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG
C3              TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG
C4              TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG
C5              TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG
C6              TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG
                **************************************************

C1              GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC
C2              GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC
C3              GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC
C4              GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC
C5              GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC
C6              GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC
                **************************************************

C1              TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC
C2              TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC
C3              TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC
C4              TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC
C5              TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC
C6              TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC
                **************************************************

C1              CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC
C2              CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC
C3              CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC
C4              CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC
C5              CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC
C6              CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC
                **************************************************

C1              GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG
C2              GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG
C3              GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG
C4              GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG
C5              GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG
C6              GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG
                **************************************************

C1              CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA
C2              CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA
C3              CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA
C4              CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA
C5              CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA
C6              CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA
                **************************************************

C1              GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT
C2              GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT
C3              GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT
C4              GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT
C5              GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT
C6              GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT
                **************************************************

C1              ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG
C2              ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG
C3              ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG
C4              ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG
C5              ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG
C6              ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG
                **************************************************

C1              ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT
C2              ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT
C3              ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT
C4              ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT
C5              ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT
C6              ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT
                **************************************************

C1              CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT
C2              CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT
C3              CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT
C4              CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT
C5              CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT
C6              CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT
                **************************************************

C1              CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG
C2              CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG
C3              CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG
C4              CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG
C5              CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG
C6              CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG
                **********************************************



>C1
TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG
GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC
TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC
CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC
GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG
CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA
GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT
ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG
ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT
CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT
CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG
>C2
TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG
GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC
TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC
CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC
GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG
CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA
GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT
ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG
ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT
CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT
CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG
>C3
TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG
GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC
TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC
CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC
GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG
CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA
GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT
ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG
ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT
CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT
CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG
>C4
TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG
GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC
TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC
CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC
GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG
CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA
GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT
ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG
ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT
CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT
CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG
>C5
TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG
GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC
TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC
CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC
GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG
CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA
GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT
ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG
ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT
CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT
CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG
>C6
TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG
GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC
TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC
CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC
GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG
CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA
GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT
ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG
ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT
CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT
CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG
>C1
LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
>C2
LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
>C3
LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
>C4
LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
>C5
LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
>C6
LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
RAHNQETGYRLRVKMALAEGQYKISKLDQVTK


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 546 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579858730
      Setting output file names to "/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1946369564
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5979006405
      Seed = 341386789
      Swapseed = 1579858730
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1221.973991 -- -24.965149
         Chain 2 -- -1221.974177 -- -24.965149
         Chain 3 -- -1221.974177 -- -24.965149
         Chain 4 -- -1221.974107 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1221.974177 -- -24.965149
         Chain 2 -- -1221.974177 -- -24.965149
         Chain 3 -- -1221.974107 -- -24.965149
         Chain 4 -- -1221.974177 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1221.974] (-1221.974) (-1221.974) (-1221.974) * [-1221.974] (-1221.974) (-1221.974) (-1221.974) 
        500 -- (-755.502) (-759.874) [-758.823] (-774.088) * (-764.415) [-757.628] (-758.030) (-764.142) -- 0:00:00
       1000 -- (-759.671) (-759.643) [-763.960] (-761.857) * [-764.612] (-757.547) (-759.275) (-762.222) -- 0:00:00
       1500 -- [-766.942] (-760.597) (-766.089) (-772.971) * [-758.207] (-764.896) (-759.394) (-764.240) -- 0:00:00
       2000 -- [-764.336] (-761.208) (-761.195) (-764.728) * [-759.931] (-761.418) (-761.392) (-761.097) -- 0:00:00
       2500 -- (-773.023) (-762.568) [-759.060] (-763.238) * [-759.612] (-766.036) (-762.883) (-759.085) -- 0:00:00
       3000 -- (-757.655) [-758.285] (-775.557) (-759.885) * (-759.962) (-758.960) [-765.319] (-758.031) -- 0:05:32
       3500 -- (-764.535) [-761.253] (-760.298) (-759.457) * [-761.804] (-760.410) (-767.311) (-765.427) -- 0:04:44
       4000 -- (-764.891) [-760.788] (-766.045) (-762.104) * (-767.529) (-758.376) (-766.516) [-757.567] -- 0:04:09
       4500 -- (-766.137) (-774.140) [-766.678] (-768.498) * (-760.796) (-765.790) [-761.581] (-766.547) -- 0:03:41
       5000 -- (-755.060) (-761.017) [-762.336] (-766.506) * [-755.448] (-754.868) (-757.947) (-765.663) -- 0:03:19

      Average standard deviation of split frequencies: 0.133565

       5500 -- [-760.621] (-767.306) (-763.493) (-759.134) * [-760.653] (-763.810) (-762.090) (-759.023) -- 0:03:00
       6000 -- (-754.673) (-767.433) (-757.635) [-759.889] * (-771.936) (-766.274) [-762.915] (-763.589) -- 0:02:45
       6500 -- (-763.092) [-762.752] (-757.382) (-761.603) * (-765.024) (-765.944) (-759.943) [-760.946] -- 0:02:32
       7000 -- [-759.970] (-763.248) (-753.337) (-765.371) * (-761.142) [-762.126] (-763.061) (-785.292) -- 0:02:21
       7500 -- (-761.690) [-759.001] (-753.708) (-755.689) * (-759.341) (-762.432) (-758.653) [-757.822] -- 0:02:12
       8000 -- (-763.562) (-765.211) [-753.411] (-756.535) * (-760.139) [-757.163] (-759.116) (-758.822) -- 0:02:04
       8500 -- (-759.803) (-762.121) [-752.184] (-759.453) * (-758.164) [-764.163] (-762.644) (-758.798) -- 0:01:56
       9000 -- [-764.294] (-772.873) (-752.389) (-756.547) * (-761.641) (-789.189) [-760.525] (-760.376) -- 0:01:50
       9500 -- (-756.839) (-767.408) (-752.622) [-759.496] * (-759.514) (-776.847) [-761.178] (-767.716) -- 0:01:44
      10000 -- (-761.811) [-759.251] (-751.442) (-758.596) * [-758.833] (-751.184) (-761.104) (-769.522) -- 0:01:39

      Average standard deviation of split frequencies: 0.079084

      10500 -- [-760.360] (-762.961) (-750.716) (-762.300) * (-760.628) (-753.544) [-759.853] (-762.047) -- 0:01:34
      11000 -- (-769.513) (-759.869) [-752.788] (-771.911) * [-762.812] (-754.972) (-765.307) (-762.324) -- 0:01:29
      11500 -- (-759.721) (-762.678) (-752.869) [-760.950] * [-757.695] (-753.533) (-760.238) (-760.186) -- 0:01:25
      12000 -- (-763.107) (-775.055) [-752.891] (-761.674) * (-761.232) (-751.596) [-757.135] (-758.083) -- 0:01:22
      12500 -- [-764.955] (-773.865) (-753.852) (-756.532) * (-771.211) (-751.160) (-765.237) [-763.234] -- 0:01:19
      13000 -- (-767.075) (-764.811) (-754.029) [-760.524] * (-763.191) (-752.269) (-760.470) [-757.748] -- 0:01:15
      13500 -- [-762.994] (-762.977) (-754.813) (-760.632) * [-765.353] (-750.374) (-758.684) (-759.662) -- 0:01:13
      14000 -- [-757.269] (-753.208) (-751.194) (-761.123) * (-763.749) (-750.614) (-761.321) [-760.932] -- 0:01:10
      14500 -- [-759.169] (-751.055) (-751.170) (-762.847) * (-762.113) (-755.033) [-758.995] (-759.297) -- 0:01:07
      15000 -- (-770.262) (-752.206) (-751.965) [-767.538] * (-758.883) [-753.389] (-754.165) (-758.425) -- 0:01:05

      Average standard deviation of split frequencies: 0.068746

      15500 -- (-763.186) (-755.156) [-751.110] (-765.421) * [-758.261] (-751.658) (-757.538) (-762.931) -- 0:01:03
      16000 -- (-757.729) [-752.643] (-752.668) (-769.587) * [-760.916] (-751.012) (-757.391) (-769.525) -- 0:02:03
      16500 -- (-762.352) (-752.861) (-752.837) [-761.422] * (-763.638) [-751.759] (-762.945) (-768.406) -- 0:01:59
      17000 -- (-760.127) (-750.423) [-751.709] (-758.911) * (-759.044) (-752.440) [-756.956] (-772.051) -- 0:01:55
      17500 -- [-757.363] (-750.964) (-751.172) (-764.034) * (-766.302) (-752.129) [-759.629] (-757.566) -- 0:01:52
      18000 -- [-765.075] (-751.632) (-751.552) (-763.030) * (-764.519) (-755.424) (-766.742) [-755.790] -- 0:01:49
      18500 -- [-757.934] (-750.465) (-750.495) (-758.120) * (-762.043) [-754.585] (-779.121) (-752.228) -- 0:01:46
      19000 -- (-764.474) (-751.342) [-752.301] (-754.966) * (-767.598) (-753.254) (-752.213) [-751.237] -- 0:01:43
      19500 -- (-762.310) (-750.742) (-751.173) [-759.580] * [-761.601] (-752.945) (-752.244) (-756.762) -- 0:01:40
      20000 -- (-760.091) (-750.622) (-758.437) [-761.801] * (-758.143) (-751.539) (-753.916) [-751.197] -- 0:01:38

      Average standard deviation of split frequencies: 0.052748

      20500 -- [-757.375] (-751.457) (-755.024) (-762.011) * (-759.905) (-751.059) [-752.616] (-751.611) -- 0:01:35
      21000 -- [-761.166] (-752.486) (-754.134) (-761.937) * (-762.900) [-751.212] (-752.884) (-751.418) -- 0:01:33
      21500 -- [-759.093] (-751.020) (-755.619) (-758.731) * [-759.575] (-751.337) (-754.099) (-751.390) -- 0:01:31
      22000 -- (-760.983) (-754.495) (-756.773) [-758.940] * (-760.923) (-751.990) [-751.921] (-750.957) -- 0:01:28
      22500 -- (-759.289) (-750.657) [-751.178] (-761.325) * [-760.662] (-751.169) (-753.131) (-750.746) -- 0:01:26
      23000 -- (-757.263) (-750.404) [-751.738] (-762.699) * (-768.685) (-751.683) [-752.304] (-753.604) -- 0:01:24
      23500 -- (-761.935) (-750.525) [-750.752] (-765.064) * (-761.332) [-752.525] (-754.914) (-753.770) -- 0:01:23
      24000 -- (-760.285) [-753.478] (-750.737) (-756.065) * [-757.683] (-751.276) (-753.703) (-751.590) -- 0:01:21
      24500 -- (-766.747) (-753.166) (-750.951) [-763.772] * [-761.752] (-753.577) (-755.356) (-755.008) -- 0:01:19
      25000 -- (-758.895) (-754.456) (-751.623) [-764.927] * [-760.175] (-752.256) (-753.877) (-750.990) -- 0:01:18

      Average standard deviation of split frequencies: 0.037125

      25500 -- (-764.646) [-751.226] (-754.837) (-758.376) * [-764.715] (-752.660) (-752.416) (-755.583) -- 0:01:16
      26000 -- (-764.034) (-754.098) [-754.819] (-758.793) * (-761.806) (-751.759) [-757.437] (-752.846) -- 0:01:14
      26500 -- [-758.945] (-754.521) (-753.015) (-770.380) * [-759.924] (-753.054) (-756.287) (-750.732) -- 0:01:13
      27000 -- [-758.072] (-752.826) (-754.711) (-772.165) * [-771.323] (-752.891) (-753.825) (-752.530) -- 0:01:12
      27500 -- (-757.915) (-751.577) [-753.495] (-760.962) * (-769.392) (-752.063) (-755.241) [-751.721] -- 0:01:10
      28000 -- [-759.750] (-757.606) (-755.351) (-759.866) * (-757.982) (-753.761) (-753.534) [-751.589] -- 0:01:09
      28500 -- (-762.325) (-755.124) [-755.296] (-765.252) * (-769.830) [-752.443] (-752.472) (-756.848) -- 0:01:08
      29000 -- (-762.471) (-757.219) (-751.516) [-756.291] * (-766.029) (-751.673) (-750.266) [-754.378] -- 0:01:40
      29500 -- (-766.248) (-751.098) (-751.279) [-758.052] * [-758.621] (-757.358) (-751.428) (-756.781) -- 0:01:38
      30000 -- (-763.374) (-753.737) (-752.447) [-758.626] * [-757.899] (-755.680) (-750.429) (-751.752) -- 0:01:37

      Average standard deviation of split frequencies: 0.033818

      30500 -- [-751.344] (-752.789) (-751.893) (-756.388) * (-753.326) (-750.658) [-750.248] (-758.736) -- 0:01:35
      31000 -- (-751.165) (-750.139) [-751.266] (-760.391) * (-751.319) (-751.885) (-754.179) [-753.343] -- 0:01:33
      31500 -- (-751.166) (-753.855) (-752.089) [-759.632] * (-750.691) (-751.024) (-751.440) [-751.198] -- 0:01:32
      32000 -- (-753.498) (-751.099) (-752.245) [-762.161] * (-750.897) [-751.826] (-754.303) (-754.749) -- 0:01:30
      32500 -- (-751.753) (-751.798) (-751.787) [-760.317] * (-750.680) (-752.283) (-753.667) [-750.707] -- 0:01:29
      33000 -- (-751.767) (-756.020) [-750.506] (-758.453) * (-751.248) (-756.407) [-750.923] (-750.832) -- 0:01:27
      33500 -- (-752.386) (-750.832) (-750.705) [-759.225] * (-751.800) (-753.689) [-752.967] (-752.966) -- 0:01:26
      34000 -- (-753.738) [-751.564] (-750.519) (-764.230) * [-751.878] (-753.892) (-751.884) (-751.915) -- 0:01:25
      34500 -- [-750.801] (-754.970) (-751.742) (-772.675) * (-752.988) (-755.500) [-750.819] (-752.764) -- 0:01:23
      35000 -- (-750.722) (-756.519) (-752.385) [-754.466] * (-751.277) [-755.888] (-750.752) (-751.072) -- 0:01:22

      Average standard deviation of split frequencies: 0.032082

      35500 -- [-751.953] (-753.009) (-751.397) (-751.818) * [-754.692] (-753.014) (-750.557) (-751.714) -- 0:01:21
      36000 -- (-751.171) (-752.355) [-750.458] (-753.160) * (-754.642) [-756.215] (-750.548) (-751.356) -- 0:01:20
      36500 -- [-752.781] (-753.016) (-751.718) (-751.035) * (-752.243) (-753.472) (-755.768) [-751.844] -- 0:01:19
      37000 -- [-751.416] (-751.869) (-752.307) (-750.869) * (-754.455) (-754.310) (-751.920) [-756.755] -- 0:01:18
      37500 -- (-750.849) (-752.663) (-756.454) [-750.950] * (-755.190) (-751.807) (-751.439) [-752.638] -- 0:01:17
      38000 -- (-751.334) (-754.555) [-753.532] (-750.861) * [-751.545] (-751.410) (-752.720) (-754.277) -- 0:01:15
      38500 -- (-754.584) (-752.517) (-754.053) [-753.470] * [-750.637] (-753.895) (-753.244) (-755.269) -- 0:01:14
      39000 -- (-752.214) [-751.021] (-751.301) (-754.387) * [-751.612] (-751.650) (-754.297) (-752.332) -- 0:01:13
      39500 -- [-751.792] (-750.915) (-751.316) (-752.933) * (-753.177) (-751.027) (-751.547) [-750.322] -- 0:01:12
      40000 -- (-750.391) [-752.386] (-753.642) (-751.566) * (-752.309) (-753.200) (-753.031) [-750.332] -- 0:01:12

      Average standard deviation of split frequencies: 0.034132

      40500 -- (-750.349) [-751.128] (-757.171) (-755.004) * [-751.269] (-753.698) (-758.592) (-752.998) -- 0:01:11
      41000 -- (-752.025) [-751.680] (-756.011) (-750.785) * (-752.084) (-751.600) [-754.307] (-751.068) -- 0:01:10
      41500 -- (-750.235) [-751.680] (-753.779) (-754.634) * (-753.963) (-751.229) [-753.119] (-750.944) -- 0:01:09
      42000 -- (-754.575) [-751.854] (-753.187) (-753.156) * (-756.156) (-751.146) (-757.097) [-753.316] -- 0:01:08
      42500 -- (-754.417) (-752.271) [-754.025] (-753.598) * (-752.856) [-753.694] (-753.700) (-753.966) -- 0:01:07
      43000 -- (-751.312) [-751.073] (-751.419) (-752.925) * [-751.976] (-753.731) (-752.401) (-755.485) -- 0:01:06
      43500 -- (-750.659) (-751.955) [-752.059] (-752.862) * (-751.782) [-752.332] (-752.593) (-752.346) -- 0:01:05
      44000 -- [-751.112] (-750.730) (-753.129) (-754.171) * (-752.147) (-751.804) (-752.221) [-754.440] -- 0:01:26
      44500 -- (-751.264) [-751.296] (-752.761) (-752.685) * [-753.742] (-752.261) (-753.966) (-754.977) -- 0:01:25
      45000 -- (-752.065) [-753.695] (-752.048) (-755.922) * (-751.808) (-752.253) (-752.148) [-753.293] -- 0:01:24

      Average standard deviation of split frequencies: 0.031675

      45500 -- (-750.392) (-756.272) [-751.503] (-752.934) * (-752.158) (-751.335) (-752.356) [-753.915] -- 0:01:23
      46000 -- [-752.417] (-750.855) (-752.010) (-752.678) * [-750.662] (-750.879) (-750.977) (-751.381) -- 0:01:22
      46500 -- (-753.224) (-751.034) [-752.081] (-751.903) * (-751.650) [-750.881] (-751.397) (-751.780) -- 0:01:22
      47000 -- (-754.197) (-751.646) (-751.574) [-753.382] * (-750.831) (-753.167) [-751.908] (-752.924) -- 0:01:21
      47500 -- [-754.677] (-752.389) (-757.452) (-751.593) * (-753.446) (-751.221) [-751.528] (-753.427) -- 0:01:20
      48000 -- [-752.198] (-751.894) (-757.096) (-752.935) * (-753.693) (-751.006) [-752.586] (-753.560) -- 0:01:19
      48500 -- (-752.635) (-750.791) (-753.988) [-751.262] * (-755.129) (-755.026) (-751.617) [-751.705] -- 0:01:18
      49000 -- (-756.222) (-751.689) [-754.429] (-750.732) * (-752.875) (-753.650) (-754.483) [-756.072] -- 0:01:17
      49500 -- (-755.526) [-752.572] (-755.344) (-751.710) * [-753.346] (-752.440) (-753.621) (-753.720) -- 0:01:16
      50000 -- [-752.867] (-753.977) (-754.836) (-751.065) * [-752.982] (-752.275) (-753.319) (-752.685) -- 0:01:16

      Average standard deviation of split frequencies: 0.023925

      50500 -- (-754.629) [-752.521] (-754.273) (-753.474) * (-752.708) (-750.046) (-752.888) [-751.780] -- 0:01:15
      51000 -- [-751.938] (-752.457) (-754.823) (-755.654) * (-759.162) (-753.675) (-754.768) [-752.141] -- 0:01:14
      51500 -- (-752.511) (-753.779) (-751.728) [-756.323] * (-757.086) (-750.869) [-754.327] (-753.497) -- 0:01:13
      52000 -- [-751.858] (-751.324) (-752.286) (-758.161) * (-751.468) [-752.966] (-754.400) (-756.295) -- 0:01:12
      52500 -- [-751.156] (-754.890) (-753.621) (-758.220) * [-750.626] (-753.154) (-752.982) (-753.777) -- 0:01:12
      53000 -- (-751.177) (-754.555) [-752.230] (-755.496) * [-750.778] (-750.941) (-754.986) (-756.299) -- 0:01:11
      53500 -- [-752.160] (-751.856) (-754.344) (-752.879) * [-751.244] (-750.938) (-757.240) (-755.085) -- 0:01:10
      54000 -- (-751.523) (-758.190) [-754.500] (-757.286) * (-751.254) (-757.218) (-752.288) [-752.514] -- 0:01:10
      54500 -- (-751.516) (-751.687) [-751.086] (-752.816) * [-750.685] (-755.292) (-750.586) (-754.134) -- 0:01:09
      55000 -- [-754.230] (-753.416) (-752.597) (-752.222) * (-750.809) (-753.668) (-750.341) [-751.640] -- 0:01:08

      Average standard deviation of split frequencies: 0.033289

      55500 -- [-752.683] (-753.337) (-752.964) (-750.756) * [-750.443] (-756.128) (-750.948) (-760.050) -- 0:01:08
      56000 -- (-750.692) (-754.206) (-751.179) [-752.387] * (-751.783) (-750.406) [-752.616] (-753.475) -- 0:01:07
      56500 -- [-750.705] (-753.482) (-751.892) (-755.205) * (-753.136) [-752.184] (-754.074) (-755.693) -- 0:01:06
      57000 -- (-750.984) [-750.670] (-754.694) (-751.251) * (-751.055) (-754.057) [-751.682] (-759.474) -- 0:01:06
      57500 -- (-755.832) (-756.394) (-752.264) [-751.152] * [-750.944] (-753.019) (-753.760) (-751.820) -- 0:01:05
      58000 -- (-753.852) (-751.398) [-754.291] (-751.201) * (-752.207) [-752.336] (-752.649) (-753.783) -- 0:01:04
      58500 -- (-752.695) (-751.044) (-750.860) [-752.041] * (-755.012) [-752.538] (-753.210) (-755.779) -- 0:01:04
      59000 -- (-751.112) [-752.583] (-751.029) (-752.017) * [-751.369] (-751.864) (-751.940) (-751.812) -- 0:01:03
      59500 -- [-750.873] (-752.894) (-752.098) (-753.029) * (-756.342) [-752.049] (-753.040) (-752.442) -- 0:01:03
      60000 -- (-751.593) (-751.214) [-751.399] (-754.073) * (-754.981) (-752.519) [-754.359] (-751.635) -- 0:01:02

      Average standard deviation of split frequencies: 0.030712

      60500 -- (-752.882) (-752.328) [-751.449] (-751.266) * (-753.961) [-751.324] (-753.904) (-752.770) -- 0:01:17
      61000 -- [-753.520] (-754.327) (-753.870) (-752.468) * (-750.586) (-751.189) [-751.813] (-756.624) -- 0:01:16
      61500 -- [-757.541] (-751.461) (-753.879) (-756.559) * (-753.452) (-751.430) (-754.055) [-754.814] -- 0:01:16
      62000 -- [-754.916] (-751.782) (-756.826) (-754.268) * (-751.412) (-751.320) [-752.597] (-753.516) -- 0:01:15
      62500 -- [-753.358] (-751.381) (-752.738) (-754.857) * (-753.276) [-751.503] (-754.284) (-761.346) -- 0:01:15
      63000 -- (-754.276) [-750.184] (-752.824) (-752.255) * (-754.611) (-750.751) [-751.275] (-756.898) -- 0:01:14
      63500 -- (-755.371) [-752.032] (-757.027) (-753.240) * (-752.516) [-750.956] (-750.733) (-755.275) -- 0:01:13
      64000 -- (-753.789) (-753.284) (-753.396) [-753.124] * [-751.705] (-752.240) (-751.713) (-753.037) -- 0:01:13
      64500 -- [-751.668] (-755.629) (-752.973) (-751.463) * (-751.050) [-753.157] (-752.657) (-754.236) -- 0:01:12
      65000 -- (-752.939) [-751.965] (-753.723) (-751.249) * (-751.974) (-752.998) (-752.983) [-754.474] -- 0:01:11

      Average standard deviation of split frequencies: 0.035712

      65500 -- (-753.666) (-756.716) (-757.474) [-752.334] * (-752.452) [-751.864] (-755.475) (-751.987) -- 0:01:11
      66000 -- (-751.722) [-751.668] (-752.872) (-751.120) * (-753.281) (-751.830) [-752.573] (-761.618) -- 0:01:10
      66500 -- (-750.633) (-757.031) (-755.740) [-754.732] * (-755.987) [-752.993] (-750.519) (-757.524) -- 0:01:10
      67000 -- [-751.657] (-753.446) (-753.432) (-751.518) * (-751.110) [-756.078] (-750.558) (-762.275) -- 0:01:09
      67500 -- (-751.063) (-753.189) (-753.380) [-751.478] * [-752.837] (-751.049) (-750.524) (-759.386) -- 0:01:09
      68000 -- [-754.527] (-753.045) (-754.803) (-755.410) * (-750.667) [-752.775] (-754.729) (-753.206) -- 0:01:08
      68500 -- (-752.510) (-750.987) [-750.559] (-753.492) * (-750.762) (-751.101) [-753.339] (-753.185) -- 0:01:07
      69000 -- (-755.743) (-751.985) (-754.467) [-752.839] * (-751.739) (-753.802) (-754.621) [-753.483] -- 0:01:07
      69500 -- (-751.119) [-752.996] (-751.351) (-757.473) * (-750.722) (-755.926) [-753.451] (-759.883) -- 0:01:06
      70000 -- [-753.025] (-755.074) (-750.707) (-756.099) * [-753.073] (-755.830) (-752.055) (-757.393) -- 0:01:06

      Average standard deviation of split frequencies: 0.035110

      70500 -- (-753.869) [-751.139] (-750.845) (-752.328) * (-752.925) (-750.719) (-752.122) [-750.951] -- 0:01:05
      71000 -- [-751.650] (-754.267) (-751.246) (-751.321) * (-752.625) (-755.013) (-753.356) [-752.171] -- 0:01:05
      71500 -- (-754.196) (-752.323) (-750.749) [-751.163] * (-751.919) (-753.509) (-754.020) [-750.515] -- 0:01:04
      72000 -- (-752.022) (-752.006) [-751.016] (-750.850) * (-758.077) [-756.312] (-751.182) (-752.047) -- 0:01:04
      72500 -- (-755.893) (-751.202) [-752.828] (-757.496) * (-753.552) (-750.761) [-751.724] (-751.920) -- 0:01:03
      73000 -- [-757.499] (-751.817) (-751.575) (-757.324) * (-753.210) [-751.635] (-750.751) (-751.907) -- 0:01:03
      73500 -- (-755.256) [-755.994] (-752.413) (-752.564) * [-755.931] (-751.382) (-751.962) (-753.209) -- 0:01:03
      74000 -- [-751.720] (-753.491) (-752.239) (-754.124) * (-752.030) (-752.628) (-754.521) [-753.838] -- 0:01:02
      74500 -- [-750.630] (-751.251) (-752.225) (-755.089) * (-752.145) (-752.042) (-753.745) [-754.400] -- 0:01:02
      75000 -- (-751.246) (-751.702) (-752.884) [-752.667] * (-755.957) (-751.247) (-754.675) [-750.457] -- 0:01:01

      Average standard deviation of split frequencies: 0.034278

      75500 -- [-751.267] (-754.878) (-753.219) (-753.586) * (-751.144) [-752.367] (-751.522) (-751.292) -- 0:01:01
      76000 -- [-753.582] (-756.515) (-753.288) (-753.174) * (-752.659) (-750.566) [-752.249] (-753.083) -- 0:01:00
      76500 -- [-753.775] (-756.559) (-751.328) (-751.715) * (-751.024) (-750.822) (-756.304) [-756.652] -- 0:01:00
      77000 -- (-751.869) [-754.157] (-750.567) (-752.137) * (-752.177) (-751.699) (-752.713) [-754.304] -- 0:00:59
      77500 -- (-751.471) (-754.769) (-750.983) [-755.559] * (-753.902) [-752.558] (-752.959) (-752.217) -- 0:01:11
      78000 -- (-754.318) (-756.520) [-752.670] (-755.901) * (-753.920) [-756.176] (-752.090) (-751.959) -- 0:01:10
      78500 -- (-755.474) (-750.722) [-751.406] (-756.851) * (-755.555) [-750.540] (-752.798) (-752.442) -- 0:01:10
      79000 -- [-755.834] (-757.232) (-752.449) (-755.038) * [-752.304] (-752.941) (-752.344) (-754.436) -- 0:01:09
      79500 -- (-752.146) (-753.080) (-753.791) [-752.333] * [-750.862] (-756.511) (-752.418) (-757.461) -- 0:01:09
      80000 -- (-751.426) [-751.321] (-754.864) (-752.347) * [-751.146] (-751.605) (-752.220) (-751.321) -- 0:01:09

      Average standard deviation of split frequencies: 0.030757

      80500 -- [-751.020] (-753.360) (-752.485) (-751.246) * (-753.426) [-752.484] (-751.754) (-751.148) -- 0:01:08
      81000 -- (-751.503) (-755.486) [-754.923] (-753.704) * (-753.355) (-752.267) [-752.083] (-752.142) -- 0:01:08
      81500 -- (-751.408) (-753.490) (-751.840) [-752.139] * (-752.999) (-753.881) (-752.512) [-751.026] -- 0:01:07
      82000 -- (-752.014) (-757.709) (-757.141) [-755.967] * (-753.509) (-753.487) (-750.912) [-750.741] -- 0:01:07
      82500 -- [-753.289] (-753.040) (-753.960) (-752.902) * (-755.326) (-751.461) (-751.727) [-755.147] -- 0:01:06
      83000 -- [-754.384] (-752.789) (-756.142) (-752.894) * [-750.631] (-753.456) (-750.595) (-751.760) -- 0:01:06
      83500 -- (-752.515) [-754.604] (-758.802) (-753.111) * (-753.018) (-752.289) (-754.758) [-752.595] -- 0:01:05
      84000 -- [-752.366] (-752.595) (-750.443) (-752.791) * [-752.133] (-754.531) (-752.552) (-753.007) -- 0:01:05
      84500 -- (-753.106) (-754.854) (-753.079) [-754.038] * (-751.369) (-750.807) (-752.010) [-752.919] -- 0:01:05
      85000 -- (-750.397) [-752.556] (-750.709) (-751.439) * [-753.080] (-751.872) (-751.486) (-753.983) -- 0:01:04

      Average standard deviation of split frequencies: 0.024916

      85500 -- [-751.083] (-751.782) (-750.484) (-752.275) * [-756.585] (-751.503) (-753.666) (-752.163) -- 0:01:04
      86000 -- (-753.633) (-751.943) [-755.027] (-753.038) * [-755.607] (-752.558) (-753.458) (-752.330) -- 0:01:03
      86500 -- (-751.423) (-754.293) (-753.007) [-753.405] * (-756.090) (-750.835) (-755.559) [-757.932] -- 0:01:03
      87000 -- (-755.530) [-755.604] (-755.755) (-752.128) * (-751.928) (-750.769) (-751.079) [-754.621] -- 0:01:02
      87500 -- (-754.130) (-753.156) [-754.619] (-752.488) * (-751.217) [-751.425] (-756.969) (-755.355) -- 0:01:02
      88000 -- (-751.777) (-752.619) (-751.941) [-751.268] * (-753.862) [-752.600] (-754.886) (-751.544) -- 0:01:02
      88500 -- (-750.941) [-752.031] (-752.554) (-751.349) * [-752.275] (-750.891) (-755.940) (-752.034) -- 0:01:01
      89000 -- (-753.550) (-752.299) [-751.853] (-755.382) * (-755.995) (-752.780) [-755.030] (-752.403) -- 0:01:01
      89500 -- (-754.594) [-754.091] (-756.648) (-753.833) * [-751.290] (-750.668) (-754.232) (-752.132) -- 0:01:01
      90000 -- (-753.574) (-750.872) (-753.243) [-754.184] * (-755.992) [-750.955] (-756.105) (-752.753) -- 0:01:00

      Average standard deviation of split frequencies: 0.025288

      90500 -- (-753.688) [-750.566] (-754.793) (-752.326) * (-751.661) [-751.584] (-752.645) (-750.249) -- 0:01:00
      91000 -- [-753.586] (-753.136) (-755.241) (-755.624) * [-752.211] (-752.553) (-756.252) (-751.383) -- 0:00:59
      91500 -- (-752.007) (-751.086) (-752.452) [-751.387] * (-753.541) (-753.134) [-750.659] (-752.622) -- 0:00:59
      92000 -- (-750.758) (-754.037) (-755.186) [-752.985] * (-750.561) (-756.425) [-750.739] (-757.148) -- 0:00:59
      92500 -- (-751.970) (-751.732) (-752.188) [-752.202] * (-755.370) (-750.703) (-750.499) [-754.505] -- 0:00:58
      93000 -- (-752.301) [-753.055] (-751.364) (-751.852) * (-753.437) (-751.520) [-751.400] (-752.826) -- 0:00:58
      93500 -- (-754.272) (-750.878) [-751.906] (-751.637) * (-753.072) (-750.415) [-751.924] (-753.771) -- 0:00:58
      94000 -- (-753.216) (-753.448) [-750.999] (-752.234) * (-753.824) (-751.725) (-750.794) [-754.328] -- 0:00:57
      94500 -- (-758.300) [-752.250] (-752.980) (-752.761) * (-753.791) (-750.397) [-750.606] (-752.355) -- 0:01:07
      95000 -- (-758.611) (-754.297) (-752.827) [-751.788] * [-750.993] (-750.965) (-752.361) (-754.474) -- 0:01:06

      Average standard deviation of split frequencies: 0.023213

      95500 -- [-754.017] (-753.023) (-753.900) (-752.067) * (-756.039) (-752.215) (-753.231) [-751.001] -- 0:01:06
      96000 -- (-751.314) [-754.437] (-754.282) (-751.897) * [-751.366] (-753.877) (-751.812) (-755.024) -- 0:01:05
      96500 -- (-751.704) [-756.319] (-751.131) (-751.599) * (-752.123) (-755.443) [-753.263] (-751.677) -- 0:01:05
      97000 -- (-751.448) [-753.109] (-751.775) (-754.404) * (-754.795) (-751.850) [-752.479] (-751.842) -- 0:01:05
      97500 -- [-751.838] (-751.628) (-756.312) (-753.835) * (-751.358) [-753.044] (-753.117) (-753.633) -- 0:01:04
      98000 -- (-752.117) (-753.484) (-753.392) [-754.983] * (-753.675) (-752.534) [-751.730] (-751.321) -- 0:01:04
      98500 -- [-751.863] (-751.673) (-752.898) (-754.807) * (-756.187) (-751.694) [-752.653] (-753.752) -- 0:01:04
      99000 -- (-753.484) (-756.347) (-752.068) [-753.531] * (-754.790) (-754.870) [-752.677] (-755.590) -- 0:01:03
      99500 -- (-752.358) (-753.160) [-750.795] (-755.775) * (-752.587) (-754.815) [-751.307] (-756.143) -- 0:01:03
      100000 -- (-751.814) (-752.520) [-752.488] (-753.463) * (-752.949) (-755.847) [-753.257] (-754.284) -- 0:01:02

      Average standard deviation of split frequencies: 0.021498

      100500 -- (-754.875) (-750.783) (-751.937) [-750.371] * (-751.791) [-752.355] (-757.626) (-752.023) -- 0:01:02
      101000 -- (-758.162) [-755.590] (-752.396) (-751.061) * (-762.517) [-757.555] (-756.177) (-750.817) -- 0:01:02
      101500 -- [-751.917] (-752.474) (-752.557) (-753.705) * [-750.722] (-757.929) (-756.605) (-750.544) -- 0:01:01
      102000 -- (-758.523) (-753.581) (-751.628) [-751.718] * (-754.498) [-752.584] (-752.998) (-751.348) -- 0:01:01
      102500 -- (-754.707) [-752.082] (-754.778) (-750.708) * (-758.524) [-751.506] (-752.718) (-751.236) -- 0:01:01
      103000 -- (-752.360) (-753.622) [-752.722] (-751.632) * (-757.107) (-758.092) (-752.691) [-752.829] -- 0:01:00
      103500 -- (-753.515) (-752.129) (-751.568) [-750.244] * (-754.281) [-752.327] (-753.755) (-752.442) -- 0:01:00
      104000 -- (-750.898) [-753.215] (-754.384) (-751.044) * (-753.561) (-756.683) [-752.984] (-750.752) -- 0:01:00
      104500 -- (-751.123) [-752.298] (-754.181) (-750.643) * (-752.698) [-752.777] (-752.171) (-750.924) -- 0:00:59
      105000 -- (-750.677) (-752.945) [-752.772] (-750.323) * (-753.088) [-752.296] (-755.797) (-754.677) -- 0:00:59

      Average standard deviation of split frequencies: 0.022236

      105500 -- (-751.148) (-750.553) [-750.809] (-751.351) * (-752.823) [-754.663] (-752.620) (-758.113) -- 0:00:59
      106000 -- (-751.357) (-756.571) [-751.449] (-752.411) * (-754.343) (-752.134) [-751.947] (-750.468) -- 0:00:59
      106500 -- (-756.005) (-751.815) [-754.141] (-750.652) * [-754.047] (-752.116) (-751.076) (-751.841) -- 0:00:58
      107000 -- (-754.321) (-757.397) (-753.026) [-752.147] * (-753.074) (-752.563) (-753.781) [-756.082] -- 0:00:58
      107500 -- (-752.678) (-751.589) [-753.272] (-751.133) * (-754.248) (-756.685) (-752.303) [-754.555] -- 0:00:58
      108000 -- (-750.939) (-750.427) [-754.077] (-753.609) * [-754.126] (-754.437) (-755.816) (-751.519) -- 0:00:57
      108500 -- (-753.645) (-751.039) [-754.451] (-755.403) * (-752.750) [-753.195] (-751.656) (-750.948) -- 0:00:57
      109000 -- (-750.326) [-750.940] (-753.292) (-754.949) * (-754.764) (-751.720) [-752.864] (-752.050) -- 0:00:57
      109500 -- (-752.235) (-752.177) [-752.644] (-753.512) * (-752.726) [-751.444] (-752.211) (-753.390) -- 0:00:56
      110000 -- (-752.423) (-752.338) (-753.890) [-753.393] * [-754.929] (-752.452) (-755.061) (-750.505) -- 0:00:56

      Average standard deviation of split frequencies: 0.023327

      110500 -- (-752.314) (-752.424) (-753.049) [-752.958] * (-752.372) (-750.968) (-752.870) [-751.890] -- 0:00:56
      111000 -- (-751.967) (-750.769) (-755.985) [-752.146] * (-751.225) (-751.604) (-755.019) [-754.494] -- 0:01:04
      111500 -- (-751.129) [-751.778] (-753.209) (-750.917) * [-751.161] (-752.018) (-753.829) (-751.663) -- 0:01:03
      112000 -- [-751.494] (-752.105) (-753.730) (-751.381) * (-757.196) (-753.037) (-752.818) [-755.885] -- 0:01:03
      112500 -- (-754.185) (-757.595) (-752.809) [-751.433] * (-752.322) (-751.350) [-753.967] (-752.146) -- 0:01:03
      113000 -- (-756.130) [-751.305] (-750.600) (-752.586) * (-752.123) (-751.518) [-751.036] (-751.745) -- 0:01:02
      113500 -- (-760.414) (-754.298) (-750.656) [-751.563] * [-752.168] (-752.630) (-751.948) (-751.250) -- 0:01:02
      114000 -- (-755.373) (-752.813) (-750.635) [-752.328] * (-751.140) (-751.700) [-753.484] (-752.763) -- 0:01:02
      114500 -- (-751.674) (-751.687) [-752.520] (-751.893) * (-752.887) [-752.490] (-752.818) (-752.642) -- 0:01:01
      115000 -- [-750.493] (-754.282) (-754.743) (-753.202) * [-756.523] (-751.342) (-751.944) (-754.933) -- 0:01:01

      Average standard deviation of split frequencies: 0.022886

      115500 -- [-752.197] (-752.761) (-752.241) (-750.887) * (-755.080) (-750.401) [-752.396] (-756.346) -- 0:01:01
      116000 -- (-750.653) [-755.162] (-752.832) (-750.381) * (-752.481) (-753.938) (-751.313) [-750.853] -- 0:01:00
      116500 -- [-751.059] (-751.918) (-754.087) (-752.041) * (-755.096) (-753.644) (-752.244) [-750.590] -- 0:01:00
      117000 -- (-750.982) [-750.474] (-753.429) (-751.600) * (-751.800) (-753.908) [-750.809] (-750.535) -- 0:01:00
      117500 -- (-751.133) (-751.489) [-755.566] (-752.619) * (-755.251) (-752.346) (-751.214) [-751.121] -- 0:01:00
      118000 -- (-752.950) [-752.584] (-750.939) (-754.390) * (-752.334) (-752.403) (-753.423) [-753.774] -- 0:00:59
      118500 -- (-754.911) (-752.508) [-752.093] (-757.002) * (-754.078) [-752.589] (-752.695) (-754.947) -- 0:00:59
      119000 -- (-751.678) [-750.803] (-752.693) (-759.252) * [-750.989] (-754.032) (-752.305) (-756.085) -- 0:00:59
      119500 -- (-751.315) (-750.734) [-751.351] (-761.550) * (-752.402) (-754.094) [-753.620] (-753.012) -- 0:00:58
      120000 -- (-753.398) (-750.380) (-752.116) [-751.821] * (-754.255) (-751.982) [-751.972] (-754.269) -- 0:00:58

      Average standard deviation of split frequencies: 0.022618

      120500 -- (-751.892) (-751.680) (-751.597) [-752.769] * (-751.555) (-751.270) (-753.685) [-754.170] -- 0:00:58
      121000 -- (-751.451) [-752.865] (-753.405) (-753.408) * (-752.560) (-752.848) [-750.791] (-752.625) -- 0:00:58
      121500 -- [-752.442] (-755.878) (-753.686) (-752.952) * [-752.475] (-750.895) (-752.128) (-752.175) -- 0:00:57
      122000 -- (-751.439) [-754.578] (-754.558) (-752.177) * [-751.685] (-750.465) (-751.552) (-751.416) -- 0:00:57
      122500 -- [-752.451] (-755.421) (-761.738) (-752.656) * (-753.231) (-751.975) [-751.703] (-750.983) -- 0:00:57
      123000 -- [-753.957] (-756.296) (-750.868) (-753.779) * (-751.602) (-751.572) [-752.630] (-752.600) -- 0:00:57
      123500 -- [-751.486] (-756.529) (-751.142) (-750.694) * (-753.154) [-755.400] (-753.517) (-754.183) -- 0:00:56
      124000 -- [-752.122] (-751.794) (-751.332) (-750.716) * (-753.337) [-751.422] (-751.078) (-753.417) -- 0:00:56
      124500 -- [-751.697] (-751.997) (-752.499) (-752.162) * (-753.806) (-751.400) [-751.180] (-754.986) -- 0:00:56
      125000 -- [-753.602] (-752.372) (-752.032) (-750.744) * (-753.460) (-754.762) [-752.130] (-756.432) -- 0:00:56

      Average standard deviation of split frequencies: 0.020203

      125500 -- (-752.446) (-754.149) [-751.545] (-750.555) * (-755.288) [-754.219] (-751.882) (-757.731) -- 0:00:55
      126000 -- (-752.759) (-754.570) [-751.307] (-750.495) * [-750.277] (-752.924) (-751.863) (-752.674) -- 0:00:55
      126500 -- (-761.895) (-758.977) (-750.848) [-750.716] * (-751.813) (-751.950) [-754.702] (-751.739) -- 0:00:55
      127000 -- (-755.908) (-753.862) (-751.234) [-754.056] * (-756.347) (-753.930) [-750.932] (-751.203) -- 0:00:54
      127500 -- (-754.233) (-752.653) [-750.709] (-754.803) * (-754.220) [-752.153] (-759.147) (-752.338) -- 0:01:01
      128000 -- (-755.423) [-752.234] (-750.081) (-751.676) * (-752.132) [-750.226] (-756.168) (-755.496) -- 0:01:01
      128500 -- [-756.202] (-752.680) (-751.575) (-750.291) * (-751.280) [-751.960] (-752.980) (-754.721) -- 0:01:01
      129000 -- (-756.299) (-752.715) (-752.300) [-751.990] * (-751.034) [-751.612] (-757.005) (-750.782) -- 0:01:00
      129500 -- [-751.866] (-751.462) (-753.248) (-752.105) * (-753.206) [-752.203] (-751.840) (-751.269) -- 0:01:00
      130000 -- [-756.052] (-754.047) (-750.153) (-752.891) * (-752.372) [-752.024] (-752.555) (-754.736) -- 0:01:00

      Average standard deviation of split frequencies: 0.018219

      130500 -- (-755.595) (-753.174) (-750.459) [-753.600] * (-752.297) [-752.871] (-752.100) (-759.173) -- 0:00:59
      131000 -- (-753.512) (-753.764) [-752.677] (-754.905) * [-750.415] (-760.725) (-751.072) (-757.800) -- 0:00:59
      131500 -- [-751.667] (-750.286) (-752.397) (-751.148) * (-750.116) (-750.140) (-752.270) [-752.441] -- 0:00:59
      132000 -- (-754.421) (-753.972) [-750.798] (-750.732) * (-756.027) [-754.305] (-752.234) (-751.449) -- 0:00:59
      132500 -- (-753.072) [-755.198] (-751.233) (-751.018) * (-753.735) (-751.438) (-750.812) [-751.312] -- 0:00:58
      133000 -- [-753.078] (-755.304) (-751.043) (-752.955) * (-751.533) (-751.994) (-753.087) [-753.427] -- 0:00:58
      133500 -- (-752.824) (-751.747) [-751.411] (-753.716) * (-751.885) [-752.288] (-755.728) (-750.291) -- 0:00:58
      134000 -- (-750.290) (-754.636) (-752.832) [-751.344] * [-752.078] (-751.469) (-757.261) (-753.700) -- 0:00:58
      134500 -- [-750.197] (-753.179) (-752.980) (-754.573) * (-753.950) (-752.314) (-754.074) [-753.514] -- 0:00:57
      135000 -- (-751.147) (-753.315) (-756.653) [-751.086] * [-753.950] (-751.576) (-751.091) (-754.959) -- 0:00:57

      Average standard deviation of split frequencies: 0.016984

      135500 -- (-752.006) [-753.167] (-755.340) (-751.355) * (-758.145) (-753.518) (-753.479) [-752.391] -- 0:00:57
      136000 -- [-753.140] (-755.714) (-751.806) (-751.357) * [-753.263] (-751.949) (-752.658) (-751.815) -- 0:00:57
      136500 -- (-753.372) (-752.787) [-750.115] (-755.258) * [-752.923] (-752.086) (-751.335) (-752.396) -- 0:00:56
      137000 -- (-753.867) (-750.671) (-750.685) [-753.419] * (-751.558) (-751.505) [-751.528] (-752.737) -- 0:00:56
      137500 -- (-751.627) (-750.475) [-751.236] (-754.154) * [-753.968] (-754.446) (-752.193) (-751.603) -- 0:00:56
      138000 -- [-756.137] (-752.154) (-751.395) (-754.172) * (-750.766) [-752.249] (-752.610) (-753.509) -- 0:00:56
      138500 -- (-754.114) (-753.341) (-756.131) [-752.812] * (-750.621) (-750.477) (-751.620) [-750.969] -- 0:00:55
      139000 -- (-755.329) [-753.644] (-754.034) (-753.041) * (-750.251) (-752.508) (-752.087) [-752.167] -- 0:00:55
      139500 -- [-752.112] (-755.246) (-756.008) (-753.276) * (-751.551) (-752.042) [-752.573] (-755.935) -- 0:00:55
      140000 -- (-750.391) (-752.128) (-755.598) [-752.744] * (-751.267) (-753.304) (-751.662) [-752.540] -- 0:00:55

      Average standard deviation of split frequencies: 0.017091

      140500 -- (-750.403) [-752.071] (-751.311) (-750.733) * (-750.749) (-752.828) (-752.143) [-754.810] -- 0:00:55
      141000 -- (-750.782) (-750.864) [-751.274] (-752.573) * (-751.841) (-752.785) (-751.621) [-752.819] -- 0:00:54
      141500 -- (-751.169) (-750.468) [-750.644] (-751.964) * (-754.147) (-753.394) [-751.302] (-752.779) -- 0:00:54
      142000 -- (-750.394) (-750.873) [-751.748] (-752.211) * [-752.746] (-754.015) (-751.796) (-752.728) -- 0:00:54
      142500 -- (-754.701) (-753.790) (-752.304) [-751.402] * (-750.582) [-751.908] (-754.393) (-751.641) -- 0:00:54
      143000 -- [-754.614] (-755.887) (-751.165) (-751.465) * [-751.286] (-750.843) (-754.816) (-751.169) -- 0:00:53
      143500 -- [-751.611] (-752.318) (-753.881) (-751.569) * [-751.614] (-752.886) (-750.874) (-752.219) -- 0:00:53
      144000 -- (-750.835) (-752.953) (-753.346) [-755.605] * [-752.554] (-757.861) (-753.302) (-751.954) -- 0:00:59
      144500 -- (-752.682) [-753.764] (-752.584) (-755.930) * (-755.336) [-751.350] (-751.865) (-755.799) -- 0:00:59
      145000 -- [-751.728] (-752.019) (-751.729) (-753.740) * (-751.516) (-751.684) [-751.542] (-753.833) -- 0:00:58

      Average standard deviation of split frequencies: 0.016628

      145500 -- (-755.239) [-752.317] (-753.752) (-752.512) * (-751.530) [-751.474] (-751.222) (-754.435) -- 0:00:58
      146000 -- (-760.748) (-751.740) [-753.429] (-752.638) * (-751.715) (-752.354) [-752.697] (-753.580) -- 0:00:58
      146500 -- (-753.436) (-750.577) [-754.878] (-752.865) * (-756.566) (-757.576) (-755.479) [-752.784] -- 0:00:58
      147000 -- [-754.369] (-750.527) (-756.113) (-754.163) * (-755.031) (-755.242) [-751.883] (-752.705) -- 0:00:58
      147500 -- (-752.748) [-750.785] (-754.232) (-753.195) * (-755.114) (-752.895) [-751.050] (-751.675) -- 0:00:57
      148000 -- (-757.253) (-750.668) (-752.298) [-752.097] * (-755.042) (-756.127) (-751.345) [-751.069] -- 0:00:57
      148500 -- [-754.882] (-756.374) (-755.276) (-752.541) * (-751.637) (-754.167) [-751.616] (-751.809) -- 0:00:57
      149000 -- (-752.958) [-756.511] (-756.492) (-751.595) * (-751.691) (-753.555) (-753.023) [-754.022] -- 0:00:57
      149500 -- [-753.157] (-755.773) (-755.176) (-751.886) * (-752.862) [-751.207] (-752.982) (-752.239) -- 0:00:56
      150000 -- (-751.297) (-752.053) (-755.342) [-753.583] * [-754.143] (-755.611) (-753.369) (-751.659) -- 0:00:56

      Average standard deviation of split frequencies: 0.016583

      150500 -- (-752.699) (-752.491) [-754.501] (-752.109) * [-752.933] (-753.335) (-753.207) (-750.298) -- 0:00:56
      151000 -- (-753.397) (-751.999) (-752.610) [-751.401] * (-750.436) (-756.250) [-755.310] (-754.148) -- 0:00:56
      151500 -- (-752.159) (-751.560) [-753.581] (-753.066) * [-751.853] (-755.809) (-752.144) (-750.748) -- 0:00:56
      152000 -- (-752.473) (-753.013) [-754.321] (-751.096) * (-750.517) (-756.141) (-753.313) [-750.549] -- 0:00:55
      152500 -- (-751.550) (-751.959) [-752.892] (-755.380) * (-752.780) [-752.830] (-753.888) (-754.957) -- 0:00:55
      153000 -- (-753.671) (-752.419) [-754.610] (-754.672) * [-754.889] (-751.257) (-752.246) (-753.140) -- 0:00:55
      153500 -- (-755.949) (-754.506) (-752.102) [-753.008] * [-752.012] (-751.422) (-752.496) (-752.841) -- 0:00:55
      154000 -- (-752.247) [-752.948] (-751.785) (-752.349) * (-751.089) (-751.725) (-751.097) [-753.155] -- 0:00:54
      154500 -- [-751.907] (-751.538) (-754.039) (-754.525) * [-750.311] (-751.040) (-752.651) (-752.676) -- 0:00:54
      155000 -- (-755.220) (-755.058) [-751.729] (-752.965) * (-751.547) (-752.083) [-755.965] (-755.797) -- 0:00:54

      Average standard deviation of split frequencies: 0.015865

      155500 -- [-754.168] (-752.324) (-752.607) (-755.954) * [-752.740] (-751.906) (-754.539) (-754.483) -- 0:00:54
      156000 -- (-752.699) [-751.508] (-752.022) (-751.368) * (-751.897) (-751.023) [-750.247] (-751.571) -- 0:00:54
      156500 -- (-751.658) (-752.081) (-751.904) [-756.832] * (-752.555) [-753.739] (-756.929) (-754.981) -- 0:00:53
      157000 -- [-752.423] (-750.983) (-751.501) (-751.670) * (-754.296) [-751.153] (-753.047) (-754.460) -- 0:00:53
      157500 -- (-754.569) (-751.856) (-754.694) [-754.591] * (-750.374) [-750.650] (-755.365) (-755.408) -- 0:00:53
      158000 -- (-755.166) (-755.529) [-755.258] (-751.898) * (-750.658) [-750.266] (-754.675) (-756.953) -- 0:00:53
      158500 -- (-756.673) (-753.708) (-751.851) [-753.261] * [-752.753] (-752.428) (-755.910) (-751.279) -- 0:00:53
      159000 -- (-752.290) (-754.437) [-751.488] (-750.741) * [-751.903] (-752.150) (-756.437) (-752.077) -- 0:00:52
      159500 -- (-753.126) [-755.208] (-751.839) (-751.044) * (-751.236) (-752.021) (-754.003) [-753.560] -- 0:00:52
      160000 -- (-751.501) (-759.513) (-754.815) [-753.829] * (-750.365) (-755.338) (-753.476) [-752.440] -- 0:00:57

      Average standard deviation of split frequencies: 0.016724

      160500 -- (-752.518) (-755.395) [-754.005] (-754.965) * [-751.219] (-753.816) (-758.133) (-750.898) -- 0:00:57
      161000 -- (-753.465) [-754.716] (-756.239) (-754.771) * [-750.458] (-757.889) (-752.755) (-752.290) -- 0:00:57
      161500 -- (-752.969) [-751.057] (-756.166) (-753.914) * (-752.086) (-753.396) [-754.241] (-751.228) -- 0:00:57
      162000 -- (-754.154) (-753.380) (-751.155) [-754.617] * (-752.798) [-753.929] (-753.970) (-753.754) -- 0:00:56
      162500 -- (-752.131) (-752.699) [-750.988] (-753.482) * (-752.468) (-752.896) (-758.871) [-753.313] -- 0:00:56
      163000 -- [-754.931] (-752.695) (-751.290) (-753.011) * (-752.348) (-753.019) [-755.959] (-757.277) -- 0:00:56
      163500 -- (-751.267) (-751.027) [-752.546] (-753.273) * [-753.436] (-754.746) (-754.742) (-754.656) -- 0:00:56
      164000 -- (-753.468) [-753.475] (-751.548) (-754.040) * (-752.353) [-750.852] (-754.591) (-755.969) -- 0:00:56
      164500 -- (-752.780) [-752.937] (-752.169) (-750.947) * (-752.426) (-751.117) (-751.724) [-753.568] -- 0:00:55
      165000 -- [-752.982] (-753.326) (-752.914) (-751.770) * (-754.741) [-750.838] (-752.812) (-753.798) -- 0:00:55

      Average standard deviation of split frequencies: 0.017749

      165500 -- [-751.450] (-751.530) (-751.147) (-753.536) * (-752.837) (-751.525) (-758.591) [-752.623] -- 0:00:55
      166000 -- (-753.525) (-750.447) (-753.294) [-751.719] * (-754.258) (-754.545) (-756.940) [-751.687] -- 0:00:55
      166500 -- (-755.999) [-750.704] (-752.771) (-754.780) * (-751.394) (-753.305) (-753.248) [-750.532] -- 0:00:55
      167000 -- (-753.958) (-751.358) [-752.481] (-752.244) * (-756.527) (-752.270) (-755.678) [-750.956] -- 0:00:54
      167500 -- (-753.323) [-752.583] (-752.530) (-752.339) * (-752.116) (-751.417) [-751.347] (-752.449) -- 0:00:54
      168000 -- (-752.625) (-752.469) [-753.190] (-751.190) * (-752.862) (-751.738) (-751.314) [-752.709] -- 0:00:54
      168500 -- [-751.809] (-751.150) (-751.721) (-751.457) * [-753.105] (-754.405) (-750.533) (-750.881) -- 0:00:54
      169000 -- (-753.930) (-752.357) [-752.078] (-752.693) * (-755.661) (-753.937) (-752.862) [-750.172] -- 0:00:54
      169500 -- [-753.124] (-752.755) (-755.403) (-753.019) * (-750.569) (-754.981) [-752.345] (-751.754) -- 0:00:53
      170000 -- [-751.251] (-752.099) (-750.659) (-751.187) * [-751.185] (-751.173) (-752.455) (-752.584) -- 0:00:53

      Average standard deviation of split frequencies: 0.017540

      170500 -- [-750.800] (-752.254) (-752.007) (-751.302) * [-753.467] (-752.467) (-752.047) (-750.930) -- 0:00:53
      171000 -- (-751.361) (-750.895) (-754.199) [-750.200] * (-756.301) (-753.316) (-756.850) [-753.213] -- 0:00:53
      171500 -- (-753.078) [-752.540] (-755.220) (-751.754) * (-754.405) (-750.936) [-751.330] (-753.682) -- 0:00:53
      172000 -- (-750.498) (-753.699) (-753.279) [-752.880] * (-752.238) [-750.401] (-753.797) (-752.019) -- 0:00:52
      172500 -- [-751.085] (-755.845) (-762.584) (-751.839) * [-753.184] (-753.630) (-753.242) (-752.393) -- 0:00:52
      173000 -- (-751.403) (-753.175) (-755.701) [-752.713] * [-753.610] (-752.494) (-752.758) (-752.370) -- 0:00:52
      173500 -- (-751.865) (-751.123) (-759.674) [-752.845] * (-753.219) (-752.675) [-751.407] (-753.631) -- 0:00:52
      174000 -- [-752.296] (-751.203) (-754.577) (-754.692) * (-750.775) (-753.044) (-751.750) [-754.777] -- 0:00:52
      174500 -- (-750.768) (-755.802) (-757.042) [-754.373] * (-754.248) (-754.763) (-755.875) [-751.442] -- 0:00:52
      175000 -- [-753.290] (-752.011) (-756.284) (-752.863) * [-754.607] (-753.071) (-753.260) (-754.958) -- 0:00:51

      Average standard deviation of split frequencies: 0.017142

      175500 -- (-753.426) [-754.557] (-755.520) (-753.250) * (-751.561) (-752.646) (-753.165) [-751.277] -- 0:00:51
      176000 -- (-750.773) (-750.814) [-751.833] (-751.206) * (-751.000) (-752.499) (-761.093) [-751.348] -- 0:00:56
      176500 -- (-751.509) [-752.066] (-754.968) (-752.098) * (-756.626) (-751.177) (-752.224) [-750.666] -- 0:00:55
      177000 -- [-752.868] (-751.844) (-754.217) (-750.691) * [-753.192] (-754.100) (-751.685) (-752.113) -- 0:00:55
      177500 -- (-751.113) (-754.263) (-754.869) [-754.245] * (-754.367) (-752.871) [-751.557] (-754.267) -- 0:00:55
      178000 -- (-751.311) [-754.575] (-755.685) (-754.792) * (-752.047) (-752.991) [-750.805] (-750.910) -- 0:00:55
      178500 -- (-751.019) (-753.332) [-755.162] (-753.818) * (-752.285) (-753.003) (-752.423) [-751.149] -- 0:00:55
      179000 -- [-753.131] (-750.384) (-752.617) (-752.833) * (-751.969) (-759.277) (-752.249) [-751.248] -- 0:00:55
      179500 -- [-752.899] (-750.606) (-754.348) (-757.295) * [-753.034] (-755.497) (-750.962) (-751.081) -- 0:00:54
      180000 -- (-751.606) [-755.409] (-755.938) (-754.560) * (-750.856) [-752.534] (-751.674) (-754.358) -- 0:00:54

      Average standard deviation of split frequencies: 0.017029

      180500 -- [-752.931] (-752.373) (-754.364) (-751.765) * (-752.428) [-751.792] (-751.200) (-753.617) -- 0:00:54
      181000 -- (-752.997) [-752.488] (-753.074) (-752.511) * (-753.842) [-754.557] (-751.189) (-752.826) -- 0:00:54
      181500 -- (-752.040) [-751.294] (-755.837) (-753.620) * (-753.274) [-750.520] (-751.906) (-752.983) -- 0:00:54
      182000 -- (-752.125) [-752.742] (-759.454) (-752.387) * [-753.095] (-754.647) (-751.942) (-751.759) -- 0:00:53
      182500 -- (-752.107) (-752.029) [-753.144] (-750.785) * (-751.296) [-750.119] (-754.050) (-753.323) -- 0:00:53
      183000 -- (-755.141) (-755.369) [-752.989] (-751.449) * [-752.440] (-752.755) (-752.582) (-751.610) -- 0:00:53
      183500 -- (-751.102) (-757.685) (-751.586) [-753.618] * (-751.959) (-755.699) [-751.280] (-753.329) -- 0:00:53
      184000 -- [-751.291] (-750.624) (-751.432) (-755.019) * (-751.465) (-760.866) (-751.548) [-754.676] -- 0:00:53
      184500 -- [-750.690] (-750.558) (-752.092) (-753.244) * (-752.678) [-752.609] (-752.962) (-756.094) -- 0:00:53
      185000 -- (-752.072) (-751.476) (-752.572) [-753.884] * (-756.132) (-755.280) [-751.745] (-751.788) -- 0:00:52

      Average standard deviation of split frequencies: 0.017474

      185500 -- [-752.000] (-750.376) (-756.469) (-751.512) * (-753.127) [-755.842] (-753.450) (-752.683) -- 0:00:52
      186000 -- [-752.675] (-751.763) (-753.186) (-754.170) * (-751.768) (-754.337) [-750.877] (-751.747) -- 0:00:52
      186500 -- [-750.684] (-753.531) (-750.789) (-755.584) * [-750.817] (-751.225) (-752.324) (-752.589) -- 0:00:52
      187000 -- (-753.754) (-753.552) [-752.728] (-752.026) * (-751.959) (-751.743) [-757.910] (-754.174) -- 0:00:52
      187500 -- (-752.060) (-753.589) [-752.587] (-751.483) * [-750.931] (-753.719) (-750.616) (-751.861) -- 0:00:52
      188000 -- (-752.027) [-751.531] (-751.136) (-752.551) * (-751.778) (-751.602) (-754.455) [-752.639] -- 0:00:51
      188500 -- (-752.372) [-754.091] (-753.315) (-753.218) * (-750.161) [-752.639] (-758.538) (-752.094) -- 0:00:51
      189000 -- (-756.658) [-753.037] (-752.145) (-750.940) * (-754.427) [-751.096] (-756.455) (-751.272) -- 0:00:51
      189500 -- (-753.441) (-754.772) (-758.701) [-751.751] * (-753.750) (-757.107) (-752.663) [-751.442] -- 0:00:51
      190000 -- [-753.326] (-753.602) (-750.591) (-751.217) * (-752.930) (-751.487) [-751.707] (-751.686) -- 0:00:51

      Average standard deviation of split frequencies: 0.016757

      190500 -- [-753.714] (-755.330) (-752.419) (-751.554) * (-754.898) [-751.732] (-754.437) (-754.128) -- 0:00:50
      191000 -- (-752.363) [-752.679] (-753.671) (-755.622) * (-750.574) [-753.030] (-753.511) (-755.197) -- 0:00:50
      191500 -- (-750.637) (-756.091) (-751.541) [-752.529] * (-750.878) (-751.183) (-753.007) [-757.720] -- 0:00:50
      192000 -- [-750.307] (-754.562) (-750.690) (-758.330) * [-751.632] (-755.247) (-755.430) (-753.112) -- 0:00:50
      192500 -- (-750.748) (-752.636) (-751.772) [-755.277] * (-753.592) [-751.376] (-753.875) (-751.865) -- 0:00:54
      193000 -- (-753.128) (-753.995) [-751.542] (-753.596) * [-753.919] (-752.732) (-753.839) (-754.260) -- 0:00:54
      193500 -- (-752.957) (-752.197) [-751.568] (-751.692) * (-751.780) (-753.493) [-750.926] (-756.139) -- 0:00:54
      194000 -- (-753.621) (-753.967) (-752.921) [-753.308] * [-752.244] (-753.065) (-752.050) (-752.837) -- 0:00:54
      194500 -- (-757.326) (-753.017) [-751.945] (-754.649) * (-750.978) (-757.260) (-754.722) [-754.162] -- 0:00:53
      195000 -- (-752.589) (-750.643) (-752.730) [-755.042] * (-753.766) [-755.797] (-756.042) (-754.798) -- 0:00:53

      Average standard deviation of split frequencies: 0.016168

      195500 -- (-751.689) (-755.665) [-751.709] (-751.476) * (-751.856) [-751.476] (-751.670) (-751.749) -- 0:00:53
      196000 -- (-751.613) (-753.627) [-751.269] (-757.950) * (-755.508) [-753.911] (-753.204) (-751.718) -- 0:00:53
      196500 -- (-751.279) (-751.708) [-750.376] (-755.329) * (-752.461) [-751.087] (-750.625) (-752.840) -- 0:00:53
      197000 -- (-751.236) (-752.872) [-752.483] (-754.189) * (-752.541) [-750.834] (-754.361) (-755.034) -- 0:00:52
      197500 -- (-750.620) (-755.986) (-750.258) [-750.827] * (-756.430) (-752.170) (-751.617) [-753.167] -- 0:00:52
      198000 -- (-750.498) (-753.254) (-757.524) [-750.822] * (-756.249) (-751.329) [-751.564] (-756.023) -- 0:00:52
      198500 -- (-752.689) (-751.725) (-753.097) [-752.970] * [-751.459] (-750.561) (-750.927) (-753.297) -- 0:00:52
      199000 -- [-750.963] (-750.375) (-754.409) (-754.368) * (-752.482) (-751.719) (-753.960) [-751.444] -- 0:00:52
      199500 -- [-752.639] (-752.390) (-751.569) (-752.462) * (-752.015) (-752.947) (-754.467) [-753.197] -- 0:00:52
      200000 -- (-754.120) (-750.907) (-753.441) [-754.356] * [-751.397] (-753.396) (-753.110) (-751.204) -- 0:00:51

      Average standard deviation of split frequencies: 0.016705

      200500 -- (-753.712) (-752.311) [-754.126] (-756.196) * (-752.981) (-752.657) (-752.830) [-751.512] -- 0:00:51
      201000 -- [-753.082] (-752.850) (-752.653) (-751.693) * (-750.661) (-754.690) (-752.581) [-751.846] -- 0:00:51
      201500 -- (-757.001) [-753.288] (-754.837) (-751.509) * [-755.438] (-753.323) (-753.096) (-753.213) -- 0:00:51
      202000 -- [-750.510] (-750.798) (-759.821) (-754.279) * (-757.089) (-752.789) (-752.807) [-751.500] -- 0:00:51
      202500 -- (-752.330) (-755.979) [-752.375] (-751.481) * (-757.117) [-750.981] (-752.448) (-751.448) -- 0:00:51
      203000 -- [-752.897] (-750.677) (-752.329) (-751.647) * [-752.221] (-751.350) (-755.374) (-754.304) -- 0:00:51
      203500 -- (-755.697) (-750.873) (-751.958) [-755.368] * (-752.178) (-752.091) (-753.739) [-752.944] -- 0:00:50
      204000 -- [-754.351] (-753.061) (-750.759) (-752.827) * (-752.970) (-751.756) (-753.628) [-751.362] -- 0:00:50
      204500 -- (-757.983) (-752.506) (-751.136) [-751.224] * (-753.041) (-753.469) (-750.943) [-751.274] -- 0:00:50
      205000 -- (-752.407) [-754.557] (-754.462) (-753.776) * [-750.984] (-751.939) (-760.925) (-751.641) -- 0:00:50

      Average standard deviation of split frequencies: 0.016527

      205500 -- (-753.165) (-755.218) [-752.525] (-752.373) * [-751.287] (-752.320) (-755.898) (-752.416) -- 0:00:50
      206000 -- (-750.237) (-756.624) (-750.222) [-754.018] * (-754.213) (-751.356) (-756.663) [-750.790] -- 0:00:50
      206500 -- (-750.303) (-755.444) [-750.341] (-752.348) * (-754.304) (-753.852) [-753.122] (-754.765) -- 0:00:49
      207000 -- (-751.812) [-752.205] (-751.124) (-752.577) * (-753.020) (-754.585) [-752.909] (-750.626) -- 0:00:49
      207500 -- (-750.208) (-750.594) (-751.327) [-752.313] * (-750.337) (-753.996) (-754.827) [-750.465] -- 0:00:49
      208000 -- (-752.223) [-751.098] (-751.867) (-752.098) * (-753.041) [-753.840] (-750.698) (-751.115) -- 0:00:49
      208500 -- (-752.181) [-751.840] (-750.715) (-751.790) * (-752.829) (-751.634) (-751.198) [-751.212] -- 0:00:53
      209000 -- (-751.562) [-750.726] (-753.230) (-751.711) * (-751.882) (-751.916) (-752.958) [-757.206] -- 0:00:52
      209500 -- (-751.680) (-752.301) [-752.337] (-752.810) * (-752.074) (-750.570) (-753.179) [-753.115] -- 0:00:52
      210000 -- (-754.710) [-752.358] (-752.767) (-752.005) * (-750.712) (-750.884) (-753.021) [-755.046] -- 0:00:52

      Average standard deviation of split frequencies: 0.016534

      210500 -- (-751.331) [-752.962] (-751.857) (-753.286) * (-753.172) (-750.100) (-752.525) [-754.471] -- 0:00:52
      211000 -- (-754.126) (-756.487) (-753.987) [-753.395] * [-752.323] (-755.184) (-753.065) (-750.741) -- 0:00:52
      211500 -- [-752.821] (-756.857) (-752.404) (-750.636) * [-752.032] (-751.872) (-755.732) (-752.570) -- 0:00:52
      212000 -- [-754.354] (-756.269) (-751.703) (-751.097) * (-756.263) [-750.308] (-755.030) (-752.674) -- 0:00:52
      212500 -- [-751.141] (-751.269) (-751.972) (-750.599) * (-752.090) (-752.042) (-751.232) [-754.846] -- 0:00:51
      213000 -- (-751.628) (-753.791) [-751.344] (-753.984) * (-752.545) (-755.267) (-751.586) [-754.594] -- 0:00:51
      213500 -- (-751.024) [-750.403] (-752.079) (-755.358) * (-752.917) (-754.031) [-753.221] (-755.268) -- 0:00:51
      214000 -- (-751.249) (-751.701) [-752.721] (-752.135) * [-751.860] (-756.030) (-755.146) (-758.441) -- 0:00:51
      214500 -- (-754.194) (-757.572) (-753.818) [-755.455] * (-750.968) (-755.506) [-755.475] (-750.639) -- 0:00:51
      215000 -- (-753.163) (-755.397) [-754.553] (-752.248) * [-750.884] (-752.487) (-753.073) (-753.085) -- 0:00:51

      Average standard deviation of split frequencies: 0.018187

      215500 -- (-750.721) (-752.270) [-753.784] (-750.949) * [-755.033] (-751.060) (-755.981) (-751.761) -- 0:00:50
      216000 -- (-751.804) (-754.573) [-751.436] (-751.960) * (-755.057) (-756.130) [-751.109] (-752.134) -- 0:00:50
      216500 -- (-753.065) (-755.367) [-753.406] (-752.648) * [-750.772] (-751.498) (-752.908) (-750.872) -- 0:00:50
      217000 -- (-754.300) (-753.416) (-754.095) [-752.888] * (-757.096) (-750.621) (-751.362) [-753.334] -- 0:00:50
      217500 -- (-753.147) [-753.541] (-752.015) (-755.144) * [-754.247] (-751.213) (-752.141) (-753.571) -- 0:00:50
      218000 -- (-752.404) (-751.691) [-750.578] (-755.247) * (-752.588) (-751.659) (-754.632) [-752.126] -- 0:00:50
      218500 -- [-753.847] (-751.061) (-750.824) (-753.561) * (-752.778) [-752.512] (-752.716) (-752.589) -- 0:00:50
      219000 -- (-752.586) (-750.267) (-753.209) [-753.292] * (-754.292) [-751.182] (-752.810) (-752.129) -- 0:00:49
      219500 -- [-752.377] (-753.421) (-754.248) (-755.620) * (-758.546) [-751.660] (-752.213) (-751.486) -- 0:00:49
      220000 -- (-751.023) [-753.328] (-754.944) (-753.939) * (-755.338) [-752.551] (-753.161) (-752.970) -- 0:00:49

      Average standard deviation of split frequencies: 0.017090

      220500 -- (-753.494) (-752.161) (-754.871) [-751.953] * (-754.817) [-755.313] (-751.029) (-759.300) -- 0:00:49
      221000 -- (-753.966) (-752.161) [-753.817] (-752.420) * (-753.923) (-754.401) [-753.806] (-754.095) -- 0:00:49
      221500 -- [-754.478] (-750.236) (-755.146) (-754.457) * (-754.844) [-753.595] (-754.407) (-754.339) -- 0:00:49
      222000 -- [-752.484] (-753.189) (-755.399) (-750.921) * (-753.278) (-753.671) (-753.480) [-753.832] -- 0:00:49
      222500 -- [-751.294] (-753.554) (-753.135) (-757.979) * (-753.093) [-752.040] (-754.722) (-752.957) -- 0:00:48
      223000 -- (-753.241) [-754.484] (-751.416) (-756.587) * (-754.549) (-750.995) [-751.444] (-751.111) -- 0:00:48
      223500 -- (-756.179) (-752.559) [-752.559] (-754.081) * (-756.484) [-750.873] (-754.336) (-751.078) -- 0:00:48
      224000 -- (-755.371) [-751.419] (-754.609) (-751.590) * (-755.318) (-750.654) (-752.035) [-751.099] -- 0:00:48
      224500 -- [-751.938] (-751.058) (-753.548) (-750.609) * (-750.721) (-752.347) (-750.286) [-751.269] -- 0:00:48
      225000 -- (-752.051) (-751.158) (-755.105) [-751.297] * (-750.570) (-758.593) [-752.144] (-752.717) -- 0:00:51

      Average standard deviation of split frequencies: 0.017846

      225500 -- (-751.545) (-751.243) (-752.345) [-751.318] * (-753.140) (-758.610) [-752.701] (-751.383) -- 0:00:51
      226000 -- (-752.010) [-751.038] (-752.617) (-756.472) * (-753.738) (-755.719) (-753.493) [-750.624] -- 0:00:51
      226500 -- [-752.026] (-752.975) (-752.566) (-754.265) * (-751.966) [-753.688] (-753.398) (-753.627) -- 0:00:51
      227000 -- (-752.592) (-754.528) [-751.433] (-754.819) * (-751.224) (-754.898) [-754.687] (-757.121) -- 0:00:51
      227500 -- (-752.038) (-754.481) [-755.873] (-754.542) * [-750.500] (-751.885) (-751.538) (-751.060) -- 0:00:50
      228000 -- (-750.788) [-754.187] (-753.371) (-754.306) * (-751.026) [-754.426] (-757.306) (-752.671) -- 0:00:50
      228500 -- (-756.123) [-752.418] (-752.373) (-753.626) * (-750.508) (-754.916) [-752.414] (-752.421) -- 0:00:50
      229000 -- (-753.215) (-753.809) [-750.722] (-756.305) * (-753.299) (-759.722) [-752.421] (-753.801) -- 0:00:50
      229500 -- [-752.165] (-754.672) (-750.746) (-751.843) * (-751.204) [-753.742] (-756.202) (-757.486) -- 0:00:50
      230000 -- (-757.051) (-755.120) [-752.362] (-752.282) * (-751.649) [-751.747] (-751.951) (-755.762) -- 0:00:50

      Average standard deviation of split frequencies: 0.017031

      230500 -- (-754.680) [-755.151] (-752.336) (-753.683) * [-752.720] (-754.090) (-751.037) (-751.329) -- 0:00:50
      231000 -- [-757.487] (-753.708) (-759.729) (-753.752) * (-759.282) [-750.806] (-750.937) (-753.421) -- 0:00:49
      231500 -- [-751.443] (-753.911) (-757.061) (-754.394) * (-754.694) [-750.885] (-752.308) (-754.776) -- 0:00:49
      232000 -- [-752.443] (-751.501) (-751.016) (-755.964) * [-751.646] (-750.991) (-751.687) (-753.399) -- 0:00:49
      232500 -- (-753.930) (-752.048) (-751.187) [-753.347] * [-754.105] (-753.917) (-751.783) (-750.894) -- 0:00:49
      233000 -- (-757.724) (-750.409) (-751.004) [-750.116] * (-754.051) (-754.739) [-751.896] (-751.163) -- 0:00:49
      233500 -- (-758.170) (-750.478) [-753.420] (-751.146) * (-750.377) [-752.166] (-754.470) (-752.838) -- 0:00:49
      234000 -- (-752.838) [-750.915] (-753.817) (-755.023) * (-752.850) (-752.108) (-750.798) [-752.177] -- 0:00:49
      234500 -- (-752.259) [-751.372] (-753.517) (-758.150) * (-754.068) [-752.532] (-751.514) (-756.985) -- 0:00:48
      235000 -- (-753.215) (-753.549) (-750.797) [-755.083] * (-750.636) [-751.231] (-757.375) (-752.198) -- 0:00:48

      Average standard deviation of split frequencies: 0.018188

      235500 -- (-753.918) [-750.307] (-752.459) (-755.627) * [-754.838] (-751.443) (-754.856) (-751.440) -- 0:00:48
      236000 -- (-755.273) (-751.903) (-752.035) [-752.740] * (-752.144) [-750.837] (-750.868) (-753.748) -- 0:00:48
      236500 -- (-752.017) (-752.243) (-755.644) [-752.753] * (-751.652) [-751.102] (-753.430) (-751.107) -- 0:00:48
      237000 -- (-753.600) (-755.813) (-754.234) [-751.288] * (-753.588) [-752.684] (-752.105) (-754.109) -- 0:00:48
      237500 -- (-753.839) [-756.236] (-753.517) (-752.597) * (-752.867) (-754.445) [-750.718] (-753.220) -- 0:00:48
      238000 -- (-756.002) (-755.712) (-753.611) [-754.618] * (-757.365) [-750.544] (-755.919) (-754.503) -- 0:00:48
      238500 -- (-759.188) (-752.688) (-755.421) [-752.528] * [-752.326] (-752.074) (-753.882) (-757.773) -- 0:00:47
      239000 -- [-751.358] (-753.207) (-753.395) (-754.179) * (-755.611) (-750.417) [-755.022] (-751.685) -- 0:00:47
      239500 -- (-750.846) (-751.470) (-751.989) [-753.066] * (-752.832) [-750.417] (-752.573) (-751.768) -- 0:00:47
      240000 -- (-751.559) (-751.403) (-755.041) [-751.956] * [-754.648] (-752.021) (-752.460) (-751.475) -- 0:00:47

      Average standard deviation of split frequencies: 0.016592

      240500 -- (-751.125) (-752.742) [-750.867] (-754.327) * (-753.732) [-752.255] (-755.151) (-751.632) -- 0:00:47
      241000 -- (-753.432) (-752.370) (-757.969) [-754.734] * (-754.657) (-754.126) [-753.317] (-751.139) -- 0:00:47
      241500 -- [-751.931] (-751.445) (-759.063) (-752.419) * [-752.875] (-751.461) (-754.516) (-752.263) -- 0:00:50
      242000 -- [-752.581] (-754.476) (-755.989) (-750.576) * [-751.676] (-753.106) (-754.209) (-751.157) -- 0:00:50
      242500 -- (-751.732) (-751.580) [-751.745] (-755.927) * [-754.173] (-752.650) (-750.733) (-752.425) -- 0:00:49
      243000 -- (-753.500) (-751.387) [-752.597] (-751.862) * (-752.014) (-751.957) [-750.640] (-754.977) -- 0:00:49
      243500 -- (-752.166) [-752.367] (-756.006) (-752.257) * [-751.667] (-753.554) (-752.601) (-753.308) -- 0:00:49
      244000 -- [-752.746] (-753.883) (-750.989) (-752.400) * (-751.538) (-751.159) (-752.997) [-753.038] -- 0:00:49
      244500 -- (-751.349) (-753.057) (-753.286) [-751.034] * (-752.808) [-751.711] (-753.201) (-752.891) -- 0:00:49
      245000 -- [-752.084] (-757.723) (-750.740) (-754.684) * (-752.263) (-751.645) [-754.254] (-752.630) -- 0:00:49

      Average standard deviation of split frequencies: 0.015894

      245500 -- [-750.699] (-755.629) (-756.659) (-753.543) * (-753.122) [-753.045] (-753.783) (-752.731) -- 0:00:49
      246000 -- [-753.389] (-752.616) (-754.591) (-752.845) * [-751.566] (-752.257) (-754.113) (-752.749) -- 0:00:49
      246500 -- [-752.292] (-753.571) (-752.236) (-750.909) * (-752.846) (-753.658) [-752.943] (-752.659) -- 0:00:48
      247000 -- (-751.160) [-751.938] (-750.679) (-752.234) * [-753.040] (-757.208) (-750.564) (-757.120) -- 0:00:48
      247500 -- (-754.404) [-750.755] (-753.803) (-754.997) * (-757.513) [-753.887] (-750.777) (-756.007) -- 0:00:48
      248000 -- (-751.519) (-752.321) (-751.092) [-751.233] * [-751.690] (-751.092) (-755.088) (-753.193) -- 0:00:48
      248500 -- [-751.060] (-753.606) (-753.462) (-755.016) * (-750.814) (-753.476) (-753.613) [-754.785] -- 0:00:48
      249000 -- (-755.805) [-752.649] (-752.825) (-751.242) * (-752.866) (-751.421) (-751.007) [-751.030] -- 0:00:48
      249500 -- (-752.994) [-751.110] (-753.111) (-752.126) * (-753.560) [-751.291] (-751.167) (-755.832) -- 0:00:48
      250000 -- [-752.651] (-758.342) (-759.216) (-750.305) * (-757.392) (-751.934) (-751.846) [-754.316] -- 0:00:48

      Average standard deviation of split frequencies: 0.015358

      250500 -- (-751.188) (-752.485) [-752.907] (-750.346) * (-752.475) [-751.601] (-751.291) (-755.303) -- 0:00:47
      251000 -- (-754.655) (-755.530) (-751.234) [-750.854] * (-753.369) (-753.260) (-752.178) [-753.943] -- 0:00:47
      251500 -- (-756.545) [-754.316] (-753.303) (-752.254) * [-752.900] (-753.410) (-751.220) (-752.511) -- 0:00:47
      252000 -- (-754.121) (-753.391) (-752.735) [-752.130] * (-755.445) [-752.662] (-752.016) (-754.861) -- 0:00:47
      252500 -- (-753.548) (-756.164) [-752.815] (-753.235) * [-753.422] (-751.279) (-751.067) (-752.974) -- 0:00:47
      253000 -- [-751.997] (-755.210) (-751.504) (-751.835) * (-751.027) (-753.876) [-754.243] (-755.035) -- 0:00:47
      253500 -- (-751.249) [-755.542] (-751.945) (-751.907) * (-753.600) (-753.820) (-752.781) [-751.804] -- 0:00:47
      254000 -- (-753.513) (-751.388) [-752.568] (-752.745) * (-752.261) (-752.093) [-750.746] (-752.219) -- 0:00:46
      254500 -- (-751.595) [-752.022] (-751.374) (-750.810) * (-754.645) [-751.600] (-751.242) (-750.726) -- 0:00:46
      255000 -- (-753.233) (-757.486) (-752.711) [-754.163] * [-751.890] (-751.030) (-751.566) (-751.650) -- 0:00:46

      Average standard deviation of split frequencies: 0.014731

      255500 -- [-754.816] (-756.988) (-754.793) (-751.646) * (-752.592) (-750.398) (-756.046) [-752.151] -- 0:00:46
      256000 -- [-752.917] (-753.434) (-752.557) (-752.131) * (-752.783) (-752.163) [-755.146] (-754.506) -- 0:00:46
      256500 -- (-754.810) (-753.025) [-752.531] (-752.361) * [-752.479] (-752.624) (-758.458) (-753.845) -- 0:00:46
      257000 -- (-753.845) (-751.758) [-755.978] (-751.298) * (-753.903) [-752.854] (-753.204) (-752.291) -- 0:00:46
      257500 -- (-754.520) (-751.411) [-752.362] (-751.034) * (-753.433) [-752.134] (-753.327) (-753.438) -- 0:00:46
      258000 -- [-752.087] (-751.991) (-752.247) (-753.782) * (-754.373) [-751.908] (-750.786) (-752.622) -- 0:00:46
      258500 -- (-756.053) [-751.943] (-753.507) (-753.935) * [-752.365] (-756.258) (-750.622) (-752.871) -- 0:00:48
      259000 -- [-755.736] (-752.217) (-750.535) (-752.565) * (-750.929) [-754.845] (-752.903) (-752.839) -- 0:00:48
      259500 -- (-753.342) [-752.681] (-752.808) (-753.476) * [-750.637] (-755.662) (-751.391) (-755.018) -- 0:00:48
      260000 -- (-753.456) [-752.543] (-754.116) (-752.118) * [-753.510] (-753.179) (-750.163) (-758.007) -- 0:00:48

      Average standard deviation of split frequencies: 0.014255

      260500 -- [-751.739] (-753.189) (-753.064) (-753.801) * (-752.093) (-751.487) [-750.132] (-754.006) -- 0:00:48
      261000 -- (-754.402) (-757.585) (-752.500) [-750.257] * (-751.640) (-752.333) (-754.641) [-751.919] -- 0:00:48
      261500 -- (-754.389) (-756.785) [-753.191] (-751.842) * [-753.921] (-752.921) (-751.054) (-751.911) -- 0:00:48
      262000 -- (-758.846) (-751.973) (-754.244) [-753.068] * (-752.712) (-754.421) [-753.801] (-754.209) -- 0:00:47
      262500 -- [-757.797] (-751.345) (-753.632) (-750.809) * (-753.389) (-755.149) [-751.270] (-755.685) -- 0:00:47
      263000 -- (-752.411) (-752.984) [-750.886] (-756.453) * [-752.021] (-750.393) (-751.023) (-755.218) -- 0:00:47
      263500 -- (-751.996) (-753.508) [-753.101] (-752.041) * (-752.858) [-752.126] (-750.606) (-756.591) -- 0:00:47
      264000 -- (-752.770) (-751.779) (-753.845) [-752.490] * (-753.298) (-754.755) [-751.134] (-752.059) -- 0:00:47
      264500 -- [-751.766] (-753.607) (-751.554) (-751.874) * (-754.647) [-755.768] (-750.856) (-752.126) -- 0:00:47
      265000 -- (-755.726) (-754.212) [-750.864] (-751.819) * (-752.991) (-752.459) (-750.584) [-754.349] -- 0:00:47

      Average standard deviation of split frequencies: 0.015162

      265500 -- [-753.411] (-752.131) (-751.149) (-752.204) * [-753.805] (-754.410) (-751.464) (-755.263) -- 0:00:47
      266000 -- [-756.724] (-757.848) (-753.125) (-751.319) * [-754.322] (-757.230) (-752.732) (-754.666) -- 0:00:46
      266500 -- (-753.728) (-750.862) [-752.851] (-754.243) * (-753.297) (-754.979) [-753.545] (-752.763) -- 0:00:46
      267000 -- (-756.598) (-756.625) (-750.351) [-753.086] * (-752.990) (-754.404) (-751.583) [-750.461] -- 0:00:46
      267500 -- (-754.945) (-751.531) [-750.799] (-753.048) * (-752.290) [-752.738] (-751.175) (-752.620) -- 0:00:46
      268000 -- [-755.035] (-751.125) (-750.746) (-753.227) * [-751.132] (-754.016) (-751.625) (-754.125) -- 0:00:46
      268500 -- (-752.055) [-754.147] (-754.253) (-751.186) * (-756.733) (-750.987) [-750.300] (-754.376) -- 0:00:46
      269000 -- (-756.457) [-752.085] (-754.319) (-751.900) * [-753.528] (-751.447) (-752.983) (-753.289) -- 0:00:46
      269500 -- (-754.880) (-753.439) (-753.559) [-754.167] * (-750.943) (-752.270) (-753.960) [-752.485] -- 0:00:46
      270000 -- [-754.505] (-750.380) (-755.485) (-752.194) * (-756.326) [-757.901] (-754.864) (-751.176) -- 0:00:45

      Average standard deviation of split frequencies: 0.013933

      270500 -- [-754.792] (-754.828) (-752.329) (-751.765) * (-750.977) (-757.015) (-754.970) [-755.550] -- 0:00:45
      271000 -- (-750.781) (-752.698) [-751.580] (-752.106) * (-751.840) [-755.308] (-751.489) (-751.758) -- 0:00:45
      271500 -- (-752.193) [-752.949] (-751.023) (-751.965) * (-751.968) (-752.777) (-752.140) [-752.023] -- 0:00:45
      272000 -- (-750.959) (-752.070) [-751.494] (-750.317) * (-751.210) [-751.822] (-751.625) (-752.023) -- 0:00:45
      272500 -- (-752.992) [-752.613] (-753.996) (-750.564) * (-752.553) (-753.140) [-751.915] (-751.509) -- 0:00:45
      273000 -- (-753.113) [-751.738] (-752.611) (-752.402) * (-751.474) (-753.072) [-750.966] (-753.678) -- 0:00:45
      273500 -- [-753.987] (-750.755) (-753.957) (-750.566) * [-750.964] (-751.749) (-752.745) (-753.477) -- 0:00:45
      274000 -- [-751.615] (-751.669) (-752.143) (-755.553) * (-754.609) (-752.623) [-751.692] (-752.070) -- 0:00:45
      274500 -- [-750.402] (-754.311) (-754.215) (-755.442) * (-751.863) (-750.317) [-751.739] (-753.328) -- 0:00:44
      275000 -- (-750.089) (-751.056) [-751.520] (-754.661) * [-755.331] (-750.084) (-751.514) (-751.517) -- 0:00:47

      Average standard deviation of split frequencies: 0.012056

      275500 -- (-751.555) (-757.727) [-750.552] (-751.626) * (-753.600) [-750.638] (-756.973) (-751.536) -- 0:00:47
      276000 -- (-752.493) (-757.973) [-751.136] (-751.184) * [-752.957] (-750.378) (-751.751) (-751.084) -- 0:00:47
      276500 -- [-752.626] (-752.029) (-752.887) (-753.264) * (-754.033) (-752.842) (-754.382) [-756.393] -- 0:00:47
      277000 -- (-755.818) (-751.948) [-757.901] (-755.556) * (-754.020) (-753.968) (-753.262) [-755.941] -- 0:00:46
      277500 -- [-752.124] (-755.092) (-753.514) (-752.592) * (-752.412) (-754.018) [-750.429] (-754.603) -- 0:00:46
      278000 -- [-754.531] (-753.828) (-753.251) (-751.989) * [-751.644] (-753.273) (-752.840) (-751.964) -- 0:00:46
      278500 -- (-752.585) (-751.476) (-751.938) [-751.448] * (-755.430) (-752.918) (-752.866) [-751.306] -- 0:00:46
      279000 -- (-759.477) (-752.927) [-756.349] (-753.590) * (-751.673) (-758.414) [-754.514] (-751.735) -- 0:00:46
      279500 -- (-753.850) (-754.904) [-752.443] (-757.195) * (-751.759) [-752.858] (-752.593) (-750.353) -- 0:00:46
      280000 -- (-752.450) (-752.218) (-750.912) [-754.632] * (-751.169) [-752.467] (-753.723) (-751.243) -- 0:00:46

      Average standard deviation of split frequencies: 0.011362

      280500 -- (-754.122) (-755.804) [-750.914] (-752.045) * (-759.595) [-752.828] (-754.482) (-753.027) -- 0:00:46
      281000 -- (-751.952) [-752.282] (-751.243) (-756.392) * (-752.490) (-753.903) (-751.446) [-754.933] -- 0:00:46
      281500 -- (-751.548) [-753.616] (-752.176) (-758.237) * (-754.982) [-750.966] (-751.539) (-756.897) -- 0:00:45
      282000 -- [-751.069] (-753.594) (-751.095) (-756.429) * [-753.369] (-750.974) (-753.577) (-750.644) -- 0:00:45
      282500 -- (-753.005) (-751.216) [-751.125] (-751.801) * (-751.906) (-752.571) [-753.266] (-751.684) -- 0:00:45
      283000 -- (-754.614) (-754.664) (-752.326) [-753.080] * (-750.673) [-750.679] (-750.441) (-754.748) -- 0:00:45
      283500 -- (-752.776) (-753.257) [-752.768] (-756.473) * [-750.578] (-751.562) (-752.162) (-752.564) -- 0:00:45
      284000 -- (-753.488) (-752.117) [-754.571] (-754.982) * (-753.087) [-751.307] (-755.612) (-753.637) -- 0:00:45
      284500 -- [-753.450] (-753.389) (-753.233) (-752.438) * [-752.282] (-750.892) (-755.087) (-754.156) -- 0:00:45
      285000 -- (-752.561) (-755.396) (-751.170) [-752.190] * (-752.295) [-751.351] (-753.326) (-754.788) -- 0:00:45

      Average standard deviation of split frequencies: 0.010956

      285500 -- (-751.422) (-755.253) [-755.450] (-752.287) * [-753.036] (-751.768) (-755.626) (-752.758) -- 0:00:45
      286000 -- [-751.055] (-758.349) (-752.399) (-750.505) * (-753.699) (-756.390) [-750.739] (-752.192) -- 0:00:44
      286500 -- (-755.610) (-752.058) [-750.768] (-754.811) * [-753.121] (-754.002) (-751.809) (-751.391) -- 0:00:44
      287000 -- (-751.231) [-751.696] (-752.837) (-750.701) * [-754.120] (-757.432) (-752.091) (-752.359) -- 0:00:44
      287500 -- (-752.826) [-752.195] (-750.649) (-750.571) * [-755.033] (-756.935) (-753.226) (-752.556) -- 0:00:44
      288000 -- (-757.990) [-752.489] (-750.081) (-750.324) * (-751.711) [-752.813] (-753.213) (-752.832) -- 0:00:44
      288500 -- (-753.630) (-751.529) [-753.871] (-751.216) * (-753.318) [-752.407] (-752.015) (-758.510) -- 0:00:44
      289000 -- [-752.603] (-758.258) (-751.664) (-750.697) * (-751.054) [-750.161] (-754.630) (-752.634) -- 0:00:44
      289500 -- [-756.406] (-755.821) (-751.297) (-751.515) * (-756.038) (-750.491) [-754.225] (-751.684) -- 0:00:44
      290000 -- (-753.633) [-757.298] (-756.134) (-751.306) * [-754.570] (-751.310) (-754.325) (-751.428) -- 0:00:44

      Average standard deviation of split frequencies: 0.010589

      290500 -- (-750.825) [-751.450] (-753.441) (-751.565) * (-753.181) (-751.985) [-751.631] (-752.579) -- 0:00:43
      291000 -- (-750.678) (-751.487) [-752.530] (-752.701) * (-755.963) [-752.498] (-752.707) (-752.240) -- 0:00:43
      291500 -- (-751.788) (-751.974) [-754.023] (-755.128) * (-750.981) [-753.101] (-752.855) (-752.169) -- 0:00:46
      292000 -- (-755.511) (-751.487) (-753.984) [-751.566] * [-751.283] (-757.490) (-752.983) (-751.538) -- 0:00:46
      292500 -- [-751.645] (-757.641) (-752.183) (-751.130) * (-750.284) (-753.213) (-751.914) [-751.046] -- 0:00:45
      293000 -- (-751.890) [-750.921] (-753.212) (-753.353) * [-750.332] (-753.116) (-753.575) (-756.379) -- 0:00:45
      293500 -- [-752.179] (-751.785) (-755.370) (-755.028) * (-754.946) (-752.887) (-751.258) [-752.599] -- 0:00:45
      294000 -- (-753.690) [-751.986] (-754.179) (-757.769) * (-752.820) [-752.185] (-751.025) (-755.370) -- 0:00:45
      294500 -- (-751.792) (-754.908) [-751.457] (-759.217) * (-755.786) (-752.515) [-751.223] (-753.814) -- 0:00:45
      295000 -- (-750.770) [-754.978] (-750.994) (-759.620) * (-753.556) [-753.221] (-751.324) (-753.751) -- 0:00:45

      Average standard deviation of split frequencies: 0.010492

      295500 -- [-751.070] (-751.353) (-751.533) (-754.064) * (-753.983) [-751.384] (-750.662) (-753.357) -- 0:00:45
      296000 -- [-753.045] (-753.283) (-751.730) (-750.786) * (-754.735) [-754.663] (-751.705) (-758.023) -- 0:00:45
      296500 -- (-753.941) (-751.075) (-751.996) [-752.026] * (-753.166) [-751.934] (-753.391) (-750.848) -- 0:00:45
      297000 -- (-751.115) (-751.536) [-751.651] (-754.294) * (-755.914) [-751.048] (-752.028) (-752.905) -- 0:00:44
      297500 -- (-757.915) [-752.542] (-751.962) (-752.133) * [-751.637] (-752.369) (-750.232) (-750.695) -- 0:00:44
      298000 -- [-752.755] (-752.844) (-752.283) (-751.639) * (-754.597) (-759.775) [-750.379] (-750.695) -- 0:00:44
      298500 -- [-752.567] (-754.961) (-752.217) (-751.087) * (-754.714) (-757.141) (-754.400) [-753.835] -- 0:00:44
      299000 -- (-752.309) (-750.623) (-754.992) [-750.925] * (-752.113) (-758.257) [-754.479] (-753.276) -- 0:00:44
      299500 -- (-752.605) (-751.045) (-754.833) [-752.771] * (-752.247) (-753.584) [-751.844] (-752.920) -- 0:00:44
      300000 -- [-751.639] (-752.346) (-752.408) (-756.398) * (-755.509) (-751.597) (-752.919) [-750.807] -- 0:00:44

      Average standard deviation of split frequencies: 0.011528

      300500 -- (-755.149) (-753.313) [-754.332] (-751.609) * [-750.630] (-751.785) (-753.266) (-752.023) -- 0:00:44
      301000 -- (-752.869) [-754.242] (-754.281) (-750.808) * [-751.134] (-753.379) (-750.440) (-752.654) -- 0:00:44
      301500 -- (-754.010) (-751.834) (-752.545) [-753.331] * [-752.314] (-758.925) (-751.865) (-751.669) -- 0:00:44
      302000 -- (-752.180) [-751.160] (-754.841) (-752.233) * [-754.294] (-753.178) (-750.444) (-750.553) -- 0:00:43
      302500 -- (-751.576) (-751.750) [-754.830] (-753.598) * (-752.257) [-750.462] (-755.030) (-750.195) -- 0:00:43
      303000 -- (-751.797) (-753.063) (-751.480) [-755.949] * [-755.271] (-753.937) (-752.343) (-750.076) -- 0:00:43
      303500 -- [-753.967] (-750.358) (-752.120) (-750.958) * (-751.708) (-756.410) [-752.669] (-752.775) -- 0:00:43
      304000 -- [-753.859] (-750.353) (-750.931) (-752.089) * (-751.761) (-755.285) [-753.391] (-750.185) -- 0:00:43
      304500 -- (-753.733) [-752.953] (-751.318) (-754.241) * (-752.371) (-755.609) [-750.770] (-753.690) -- 0:00:43
      305000 -- (-753.747) (-754.398) [-751.880] (-758.407) * (-752.008) [-753.549] (-752.566) (-752.307) -- 0:00:43

      Average standard deviation of split frequencies: 0.011041

      305500 -- (-752.363) (-750.759) [-750.951] (-755.573) * (-755.539) (-751.874) [-753.315] (-751.368) -- 0:00:43
      306000 -- (-750.780) (-756.215) (-753.071) [-752.915] * (-752.306) [-751.729] (-753.737) (-750.305) -- 0:00:43
      306500 -- [-751.884] (-752.025) (-754.060) (-750.355) * (-752.878) (-753.013) [-754.616] (-750.838) -- 0:00:42
      307000 -- (-752.957) (-755.617) (-754.467) [-750.630] * (-752.878) (-755.164) (-755.143) [-752.292] -- 0:00:42
      307500 -- [-752.151] (-753.389) (-757.379) (-753.626) * (-756.041) [-753.620] (-750.457) (-753.938) -- 0:00:42
      308000 -- (-752.723) [-752.027] (-755.485) (-754.015) * (-753.958) [-750.811] (-753.725) (-752.387) -- 0:00:44
      308500 -- (-754.620) [-753.186] (-756.570) (-755.392) * (-752.475) [-753.394] (-754.006) (-751.115) -- 0:00:44
      309000 -- (-753.406) (-753.428) (-753.598) [-751.782] * [-751.136] (-751.554) (-750.981) (-755.281) -- 0:00:44
      309500 -- (-753.304) [-750.528] (-752.213) (-753.778) * (-752.430) (-751.584) (-754.953) [-751.482] -- 0:00:44
      310000 -- (-751.744) (-751.486) (-751.976) [-752.797] * (-751.900) [-754.593] (-752.977) (-753.887) -- 0:00:44

      Average standard deviation of split frequencies: 0.012139

      310500 -- (-751.000) (-754.166) (-752.365) [-752.207] * (-754.506) [-751.991] (-750.782) (-752.207) -- 0:00:44
      311000 -- [-754.383] (-752.834) (-753.126) (-751.125) * (-751.852) (-752.192) [-751.298] (-752.554) -- 0:00:44
      311500 -- (-751.164) [-752.005] (-752.450) (-752.330) * (-752.351) [-752.060] (-750.684) (-751.476) -- 0:00:44
      312000 -- [-753.680] (-752.572) (-751.546) (-754.272) * (-753.243) (-750.562) (-750.669) [-752.096] -- 0:00:44
      312500 -- (-755.740) (-753.705) [-751.593] (-754.431) * (-751.718) [-751.933] (-750.840) (-754.231) -- 0:00:44
      313000 -- (-751.863) (-757.498) (-753.045) [-752.718] * (-752.507) [-751.478] (-751.201) (-754.066) -- 0:00:43
      313500 -- (-752.595) [-751.643] (-754.187) (-752.086) * [-751.934] (-754.010) (-752.772) (-751.290) -- 0:00:43
      314000 -- (-754.478) (-753.743) (-751.003) [-752.903] * (-751.438) [-754.316] (-754.306) (-751.834) -- 0:00:43
      314500 -- [-751.925] (-755.355) (-755.097) (-752.953) * (-750.713) (-753.921) (-752.620) [-751.297] -- 0:00:43
      315000 -- [-751.586] (-752.455) (-752.543) (-751.668) * [-752.677] (-753.432) (-752.510) (-752.723) -- 0:00:43

      Average standard deviation of split frequencies: 0.010794

      315500 -- (-751.645) (-753.120) [-752.887] (-751.520) * [-753.131] (-752.905) (-758.015) (-753.590) -- 0:00:43
      316000 -- (-752.867) (-750.925) [-756.789] (-754.958) * [-753.698] (-752.991) (-752.025) (-750.452) -- 0:00:43
      316500 -- (-753.090) (-754.506) [-754.535] (-751.843) * [-752.343] (-753.123) (-753.023) (-752.117) -- 0:00:43
      317000 -- (-751.287) (-755.471) (-750.615) [-752.682] * [-755.050] (-758.248) (-751.848) (-751.943) -- 0:00:43
      317500 -- [-752.087] (-751.246) (-752.059) (-753.506) * (-752.568) [-750.311] (-753.736) (-755.573) -- 0:00:42
      318000 -- (-752.890) (-753.220) (-751.206) [-754.188] * [-750.793] (-752.213) (-752.871) (-751.458) -- 0:00:42
      318500 -- [-752.397] (-756.686) (-750.876) (-752.167) * (-752.331) (-751.838) (-752.787) [-754.978] -- 0:00:42
      319000 -- (-754.454) (-753.003) (-751.677) [-754.452] * [-751.190] (-750.398) (-752.723) (-752.534) -- 0:00:42
      319500 -- (-754.627) [-751.504] (-751.139) (-752.360) * (-755.046) (-750.475) (-752.167) [-751.329] -- 0:00:42
      320000 -- (-753.839) (-750.654) [-754.759] (-752.623) * (-752.751) (-753.749) (-752.298) [-751.526] -- 0:00:42

      Average standard deviation of split frequencies: 0.010118

      320500 -- [-751.398] (-750.654) (-752.086) (-752.962) * (-753.624) (-753.320) (-754.190) [-750.769] -- 0:00:42
      321000 -- (-751.630) (-751.248) (-751.673) [-752.565] * (-751.870) [-754.647] (-754.333) (-752.699) -- 0:00:42
      321500 -- (-751.572) [-751.164] (-752.401) (-750.252) * (-751.609) (-751.795) [-750.968] (-751.474) -- 0:00:42
      322000 -- (-752.115) (-751.229) [-750.886] (-750.038) * (-752.723) [-752.776] (-753.342) (-752.208) -- 0:00:42
      322500 -- (-753.902) (-757.155) (-753.131) [-752.120] * (-750.577) (-754.747) (-752.773) [-751.375] -- 0:00:42
      323000 -- (-751.457) (-756.491) [-753.119] (-755.168) * [-750.763] (-751.991) (-752.525) (-753.510) -- 0:00:41
      323500 -- [-752.588] (-752.101) (-751.656) (-753.281) * (-750.937) [-751.827] (-751.969) (-752.915) -- 0:00:41
      324000 -- (-750.195) (-753.241) (-752.590) [-754.500] * [-751.356] (-754.923) (-755.182) (-750.871) -- 0:00:41
      324500 -- (-752.489) (-751.659) [-752.388] (-751.137) * (-751.949) (-752.733) (-754.454) [-751.522] -- 0:00:43
      325000 -- (-753.686) (-756.417) [-751.500] (-753.966) * (-750.933) (-754.059) [-753.447] (-751.359) -- 0:00:43

      Average standard deviation of split frequencies: 0.011006

      325500 -- [-750.811] (-751.810) (-751.515) (-754.586) * [-752.953] (-752.008) (-753.964) (-750.112) -- 0:00:43
      326000 -- [-754.148] (-752.026) (-750.974) (-751.373) * (-753.281) (-755.991) (-754.757) [-750.661] -- 0:00:43
      326500 -- [-750.499] (-751.836) (-752.036) (-750.857) * (-751.518) [-752.030] (-750.601) (-750.813) -- 0:00:43
      327000 -- (-750.540) [-751.974] (-752.207) (-755.121) * (-752.365) [-751.759] (-751.316) (-755.011) -- 0:00:43
      327500 -- (-754.114) (-751.928) [-756.113] (-757.210) * (-753.933) (-755.063) (-751.397) [-750.776] -- 0:00:43
      328000 -- [-752.555] (-751.583) (-753.456) (-751.404) * (-752.656) (-755.076) [-751.685] (-754.103) -- 0:00:43
      328500 -- [-752.002] (-750.731) (-750.725) (-751.658) * (-757.047) [-753.290] (-750.512) (-753.244) -- 0:00:42
      329000 -- [-752.827] (-753.708) (-751.040) (-751.548) * (-753.205) (-751.727) [-751.612] (-753.021) -- 0:00:42
      329500 -- (-753.191) (-757.059) [-753.970] (-753.035) * (-752.592) [-755.977] (-754.148) (-753.500) -- 0:00:42
      330000 -- (-751.626) [-753.720] (-750.970) (-751.382) * (-752.600) (-753.198) [-753.870] (-753.579) -- 0:00:42

      Average standard deviation of split frequencies: 0.010930

      330500 -- (-751.973) (-752.592) (-752.316) [-751.666] * (-753.553) (-751.419) (-751.358) [-752.425] -- 0:00:42
      331000 -- (-752.946) [-751.231] (-750.634) (-750.279) * [-755.272] (-754.006) (-753.302) (-751.340) -- 0:00:42
      331500 -- (-752.602) (-751.464) (-751.791) [-750.559] * (-751.688) (-751.791) [-751.491] (-751.012) -- 0:00:42
      332000 -- (-752.040) (-751.815) [-753.758] (-759.226) * (-752.535) (-751.653) (-755.751) [-750.500] -- 0:00:42
      332500 -- (-754.457) [-752.087] (-751.306) (-761.125) * (-752.437) [-750.487] (-752.614) (-750.651) -- 0:00:42
      333000 -- [-753.186] (-757.489) (-752.021) (-753.711) * (-750.713) [-754.662] (-753.928) (-751.765) -- 0:00:42
      333500 -- (-751.899) [-751.972] (-756.194) (-755.742) * [-753.710] (-755.757) (-752.368) (-751.249) -- 0:00:41
      334000 -- (-752.246) (-751.510) [-754.258] (-752.276) * (-751.294) [-757.026] (-751.802) (-753.465) -- 0:00:41
      334500 -- (-751.993) (-752.872) [-752.751] (-753.848) * [-751.477] (-753.397) (-750.785) (-751.701) -- 0:00:41
      335000 -- (-753.183) (-753.780) [-750.930] (-752.266) * (-752.206) [-752.569] (-752.115) (-752.052) -- 0:00:41

      Average standard deviation of split frequencies: 0.009986

      335500 -- [-754.329] (-752.238) (-752.358) (-752.735) * (-753.261) [-752.035] (-752.997) (-756.726) -- 0:00:41
      336000 -- (-753.314) [-750.976] (-753.574) (-752.685) * (-752.154) [-752.335] (-751.336) (-755.057) -- 0:00:41
      336500 -- [-753.373] (-752.750) (-751.218) (-752.299) * (-752.338) (-752.528) [-751.006] (-751.034) -- 0:00:41
      337000 -- (-752.472) (-760.651) [-750.404] (-751.940) * (-752.603) (-753.908) (-751.100) [-751.018] -- 0:00:41
      337500 -- (-751.517) [-753.346] (-753.246) (-751.305) * (-754.087) (-754.570) (-751.270) [-753.532] -- 0:00:41
      338000 -- [-752.318] (-751.666) (-753.031) (-755.865) * (-750.543) (-754.590) [-756.615] (-753.082) -- 0:00:41
      338500 -- [-755.492] (-752.102) (-753.617) (-752.295) * (-751.388) (-754.588) [-751.352] (-758.287) -- 0:00:41
      339000 -- (-750.832) (-752.576) (-753.204) [-752.689] * (-755.123) (-755.070) (-759.305) [-755.794] -- 0:00:40
      339500 -- (-752.144) (-751.126) [-755.419] (-753.394) * (-750.695) (-756.153) [-751.731] (-752.111) -- 0:00:40
      340000 -- [-752.479] (-752.253) (-754.589) (-750.739) * [-751.859] (-752.020) (-758.728) (-752.499) -- 0:00:40

      Average standard deviation of split frequencies: 0.010256

      340500 -- [-754.052] (-751.417) (-751.207) (-752.726) * (-750.460) [-750.816] (-754.123) (-751.124) -- 0:00:40
      341000 -- (-751.842) [-750.789] (-752.715) (-750.650) * (-752.920) (-752.531) (-751.835) [-751.385] -- 0:00:42
      341500 -- (-751.758) (-754.946) (-754.567) [-751.438] * (-752.189) [-751.799] (-758.099) (-751.105) -- 0:00:42
      342000 -- (-750.924) [-759.731] (-751.437) (-752.103) * (-753.355) (-751.356) [-753.575] (-756.645) -- 0:00:42
      342500 -- [-751.131] (-758.641) (-751.696) (-752.882) * (-751.942) (-751.141) (-750.372) [-752.987] -- 0:00:42
      343000 -- (-752.440) [-753.922] (-752.726) (-753.142) * (-751.597) (-752.752) (-752.912) [-752.757] -- 0:00:42
      343500 -- (-754.145) (-752.179) [-751.488] (-751.650) * (-752.626) [-754.424] (-751.437) (-754.563) -- 0:00:42
      344000 -- (-751.639) (-750.891) [-750.415] (-753.649) * (-751.194) (-754.252) (-750.817) [-751.610] -- 0:00:41
      344500 -- [-751.761] (-753.703) (-752.702) (-752.667) * (-752.987) (-751.883) [-750.709] (-751.695) -- 0:00:41
      345000 -- (-752.732) (-751.979) (-751.401) [-754.618] * (-756.655) [-751.257] (-755.154) (-752.635) -- 0:00:41

      Average standard deviation of split frequencies: 0.009840

      345500 -- [-751.732] (-755.155) (-751.550) (-752.913) * (-751.088) (-750.289) [-751.884] (-754.330) -- 0:00:41
      346000 -- [-752.186] (-757.136) (-752.075) (-750.216) * (-752.873) (-750.750) (-753.603) [-753.783] -- 0:00:41
      346500 -- (-751.975) (-753.970) [-751.369] (-752.796) * [-751.634] (-751.050) (-753.744) (-755.014) -- 0:00:41
      347000 -- (-753.324) (-751.612) [-751.837] (-756.020) * (-752.158) [-750.581] (-751.993) (-753.541) -- 0:00:41
      347500 -- (-755.065) (-752.320) [-750.781] (-754.963) * (-756.294) (-750.488) [-752.847] (-750.926) -- 0:00:41
      348000 -- [-750.114] (-756.281) (-753.689) (-753.920) * [-754.402] (-757.499) (-755.026) (-753.522) -- 0:00:41
      348500 -- [-751.516] (-751.736) (-751.018) (-759.701) * (-755.699) [-754.194] (-752.466) (-754.856) -- 0:00:41
      349000 -- (-750.911) [-753.816] (-751.938) (-756.962) * (-751.793) (-750.519) (-751.145) [-751.608] -- 0:00:41
      349500 -- (-751.824) (-752.353) (-752.949) [-750.498] * (-750.990) (-751.141) (-752.883) [-751.756] -- 0:00:40
      350000 -- [-753.344] (-752.602) (-752.132) (-750.408) * (-752.146) (-752.021) [-752.264] (-754.501) -- 0:00:40

      Average standard deviation of split frequencies: 0.009261

      350500 -- (-754.533) [-751.257] (-755.415) (-751.181) * (-752.544) (-752.097) (-751.152) [-751.474] -- 0:00:40
      351000 -- (-751.779) (-752.785) [-751.375] (-751.723) * (-751.755) [-753.366] (-753.036) (-752.521) -- 0:00:40
      351500 -- (-752.161) [-750.818] (-754.355) (-750.953) * (-752.609) (-753.536) (-762.595) [-753.369] -- 0:00:40
      352000 -- [-750.619] (-756.220) (-751.498) (-752.076) * (-751.182) [-751.680] (-756.980) (-753.094) -- 0:00:40
      352500 -- (-751.190) [-752.763] (-751.793) (-751.198) * (-751.282) (-751.999) [-754.766] (-751.204) -- 0:00:40
      353000 -- (-751.977) [-750.899] (-751.451) (-751.664) * (-750.278) (-755.811) (-754.814) [-751.809] -- 0:00:40
      353500 -- (-750.640) [-753.652] (-751.959) (-751.847) * [-751.692] (-756.318) (-757.178) (-750.939) -- 0:00:40
      354000 -- [-753.050] (-753.851) (-753.881) (-753.539) * [-753.771] (-753.014) (-754.345) (-751.800) -- 0:00:40
      354500 -- [-752.789] (-754.001) (-750.924) (-751.925) * [-752.879] (-752.064) (-752.386) (-753.750) -- 0:00:40
      355000 -- [-753.418] (-751.578) (-756.878) (-752.569) * [-757.559] (-752.261) (-752.646) (-751.376) -- 0:00:39

      Average standard deviation of split frequencies: 0.008958

      355500 -- (-757.202) (-754.646) (-754.236) [-755.668] * (-753.761) [-754.596] (-752.562) (-751.002) -- 0:00:39
      356000 -- (-753.844) [-754.170] (-750.669) (-753.686) * (-752.549) (-753.502) [-752.344] (-752.357) -- 0:00:39
      356500 -- (-753.682) (-752.626) [-752.897] (-756.331) * [-751.557] (-751.844) (-753.329) (-751.891) -- 0:00:39
      357000 -- (-754.633) (-751.545) [-750.763] (-761.347) * (-751.288) [-751.337] (-753.423) (-752.141) -- 0:00:39
      357500 -- (-754.297) (-753.595) (-750.824) [-751.075] * (-753.350) [-752.495] (-757.308) (-756.634) -- 0:00:39
      358000 -- (-754.050) [-751.398] (-752.569) (-751.629) * [-754.055] (-755.669) (-753.738) (-752.904) -- 0:00:41
      358500 -- (-753.615) (-754.534) (-750.753) [-752.907] * (-758.560) (-754.060) [-754.226] (-752.961) -- 0:00:41
      359000 -- (-754.162) (-758.544) [-754.013] (-754.639) * [-751.713] (-751.255) (-757.792) (-757.047) -- 0:00:41
      359500 -- (-752.886) (-752.644) (-752.679) [-753.501] * (-751.362) (-753.952) (-754.168) [-754.155] -- 0:00:40
      360000 -- (-754.152) (-751.438) (-754.018) [-753.342] * [-752.349] (-752.955) (-754.034) (-753.637) -- 0:00:40

      Average standard deviation of split frequencies: 0.009658

      360500 -- (-752.168) (-751.405) [-752.913] (-753.989) * (-753.190) [-752.866] (-755.349) (-754.051) -- 0:00:40
      361000 -- (-756.065) [-751.511] (-750.549) (-755.587) * [-750.869] (-756.504) (-757.091) (-751.596) -- 0:00:40
      361500 -- [-751.608] (-755.101) (-755.532) (-751.636) * (-752.116) (-751.720) [-752.758] (-752.704) -- 0:00:40
      362000 -- (-757.912) (-750.594) [-754.334] (-752.627) * (-751.350) [-756.648] (-753.053) (-751.870) -- 0:00:40
      362500 -- (-754.910) (-751.440) (-750.620) [-753.682] * [-755.246] (-751.877) (-751.917) (-751.287) -- 0:00:40
      363000 -- [-754.096] (-754.273) (-752.842) (-750.473) * [-751.471] (-751.661) (-754.335) (-752.425) -- 0:00:40
      363500 -- (-753.225) [-750.900] (-752.593) (-752.783) * (-751.575) [-755.328] (-752.413) (-751.830) -- 0:00:40
      364000 -- (-752.839) (-755.370) [-751.130] (-752.000) * (-752.491) (-756.369) [-753.071] (-751.951) -- 0:00:40
      364500 -- (-752.078) (-751.660) [-750.911] (-751.763) * (-753.366) (-756.364) (-754.643) [-752.696] -- 0:00:40
      365000 -- (-751.849) [-755.219] (-750.986) (-754.473) * [-753.048] (-752.939) (-752.067) (-751.415) -- 0:00:40

      Average standard deviation of split frequencies: 0.010089

      365500 -- (-752.416) (-753.564) (-751.386) [-753.467] * (-754.585) (-752.378) [-751.007] (-755.076) -- 0:00:39
      366000 -- (-754.284) (-756.709) [-751.334] (-755.795) * (-754.087) (-752.326) [-750.759] (-752.829) -- 0:00:39
      366500 -- (-753.427) [-752.553] (-750.346) (-753.467) * (-753.754) [-753.187] (-752.959) (-751.850) -- 0:00:39
      367000 -- (-753.626) (-756.763) [-751.138] (-752.193) * (-751.149) (-754.157) (-753.186) [-750.918] -- 0:00:39
      367500 -- (-754.497) (-760.980) (-751.589) [-751.720] * [-752.282] (-750.953) (-751.933) (-751.141) -- 0:00:39
      368000 -- (-753.486) (-752.593) [-752.936] (-753.401) * [-751.064] (-750.899) (-750.544) (-751.938) -- 0:00:39
      368500 -- (-752.239) [-750.995] (-753.080) (-753.242) * (-752.052) [-750.502] (-750.755) (-753.115) -- 0:00:39
      369000 -- (-752.273) (-752.084) (-752.974) [-752.009] * (-751.619) (-750.249) [-751.911] (-750.215) -- 0:00:39
      369500 -- (-751.054) [-751.214] (-754.860) (-753.861) * (-752.062) (-750.688) [-752.333] (-751.128) -- 0:00:39
      370000 -- (-752.182) (-751.850) (-757.259) [-755.220] * (-752.486) (-750.758) [-753.217] (-752.174) -- 0:00:39

      Average standard deviation of split frequencies: 0.010025

      370500 -- (-752.146) [-752.471] (-754.802) (-751.985) * (-751.663) (-751.257) (-751.304) [-752.718] -- 0:00:39
      371000 -- (-751.054) (-755.261) (-754.012) [-752.084] * (-753.984) [-751.288] (-750.369) (-754.216) -- 0:00:38
      371500 -- (-751.676) (-755.937) [-753.333] (-750.738) * [-750.960] (-751.450) (-752.419) (-754.223) -- 0:00:38
      372000 -- (-751.087) (-752.787) [-755.235] (-754.229) * (-750.331) (-757.186) (-751.245) [-752.446] -- 0:00:38
      372500 -- (-752.973) (-754.433) (-750.437) [-754.173] * (-753.486) (-753.508) [-752.620] (-754.493) -- 0:00:38
      373000 -- [-751.833] (-751.661) (-751.853) (-751.110) * [-753.573] (-752.586) (-750.866) (-753.635) -- 0:00:38
      373500 -- [-753.138] (-751.262) (-751.417) (-752.277) * [-751.447] (-752.284) (-751.708) (-751.785) -- 0:00:38
      374000 -- (-751.218) (-751.350) (-750.387) [-750.120] * (-758.423) (-762.592) [-751.183] (-752.271) -- 0:00:38
      374500 -- (-753.674) [-753.901] (-750.360) (-751.321) * (-754.041) [-752.993] (-752.958) (-752.224) -- 0:00:40
      375000 -- (-754.670) (-751.342) (-751.378) [-756.047] * (-754.312) [-753.289] (-752.940) (-754.329) -- 0:00:40

      Average standard deviation of split frequencies: 0.010915

      375500 -- [-752.719] (-751.110) (-750.755) (-751.347) * (-751.594) (-751.151) (-751.529) [-752.752] -- 0:00:39
      376000 -- (-751.972) (-751.247) [-754.848] (-751.796) * (-751.942) [-755.860] (-752.763) (-755.328) -- 0:00:39
      376500 -- (-753.804) (-751.637) (-752.748) [-752.502] * (-754.950) (-754.683) [-751.296] (-753.000) -- 0:00:39
      377000 -- (-753.120) (-755.278) [-751.001] (-752.020) * (-755.759) (-751.022) [-754.167] (-756.890) -- 0:00:39
      377500 -- (-750.485) (-754.522) [-751.208] (-754.426) * (-751.682) [-750.686] (-752.209) (-754.359) -- 0:00:39
      378000 -- (-752.950) (-751.069) (-751.184) [-754.437] * (-750.618) (-751.305) [-751.026] (-752.251) -- 0:00:39
      378500 -- (-752.817) (-750.621) (-754.334) [-751.497] * (-753.831) (-751.322) (-752.058) [-751.571] -- 0:00:39
      379000 -- (-754.227) (-753.637) [-754.732] (-752.820) * (-752.705) [-751.771] (-752.890) (-753.107) -- 0:00:39
      379500 -- (-756.350) (-751.658) [-752.177] (-753.689) * [-752.041] (-754.520) (-753.521) (-752.641) -- 0:00:39
      380000 -- (-752.814) (-751.165) [-751.993] (-755.246) * (-752.526) (-752.429) (-753.391) [-751.012] -- 0:00:39

      Average standard deviation of split frequencies: 0.010708

      380500 -- (-753.196) [-752.342] (-753.441) (-754.116) * (-752.392) (-753.914) [-752.425] (-755.298) -- 0:00:39
      381000 -- [-751.052] (-750.992) (-752.172) (-752.568) * [-751.831] (-752.821) (-752.667) (-756.144) -- 0:00:38
      381500 -- [-751.527] (-753.830) (-752.133) (-750.210) * (-752.525) (-753.912) [-750.403] (-751.127) -- 0:00:38
      382000 -- (-752.258) (-752.137) [-751.138] (-751.896) * (-751.764) (-750.523) [-751.475] (-751.257) -- 0:00:38
      382500 -- [-752.099] (-755.180) (-752.422) (-751.339) * (-750.821) (-751.524) (-753.532) [-751.082] -- 0:00:38
      383000 -- (-754.511) (-753.052) [-753.308] (-751.539) * (-751.628) (-751.107) [-751.459] (-753.840) -- 0:00:38
      383500 -- (-751.691) (-750.601) [-752.694] (-750.651) * (-751.572) (-756.597) (-756.269) [-753.106] -- 0:00:38
      384000 -- (-751.294) (-753.280) [-752.669] (-751.026) * (-753.082) (-751.076) [-753.587] (-751.169) -- 0:00:38
      384500 -- (-751.503) (-753.204) [-750.435] (-753.882) * [-752.498] (-752.540) (-752.381) (-752.542) -- 0:00:38
      385000 -- [-753.086] (-752.870) (-750.875) (-752.075) * (-753.184) (-755.413) [-752.316] (-751.195) -- 0:00:38

      Average standard deviation of split frequencies: 0.009986

      385500 -- [-752.502] (-752.184) (-750.446) (-752.030) * (-751.979) (-751.460) (-754.909) [-751.594] -- 0:00:38
      386000 -- (-751.683) (-752.730) [-750.420] (-752.068) * [-752.810] (-752.464) (-751.356) (-752.087) -- 0:00:38
      386500 -- [-750.399] (-752.942) (-755.300) (-751.914) * (-754.232) (-752.226) (-751.411) [-754.418] -- 0:00:38
      387000 -- (-759.371) [-751.627] (-751.697) (-751.602) * (-755.293) (-752.416) [-753.608] (-751.073) -- 0:00:38
      387500 -- (-751.299) (-757.464) [-753.019] (-750.500) * (-754.077) (-752.579) [-752.758] (-750.880) -- 0:00:37
      388000 -- (-754.470) (-754.805) (-753.027) [-750.710] * [-753.314] (-752.977) (-752.877) (-752.707) -- 0:00:37
      388500 -- (-751.451) (-753.682) (-755.170) [-753.325] * (-752.336) (-753.070) (-754.946) [-751.823] -- 0:00:37
      389000 -- (-752.181) (-751.896) [-752.938] (-759.681) * (-751.965) [-752.201] (-751.620) (-751.405) -- 0:00:37
      389500 -- [-754.604] (-751.818) (-751.029) (-751.825) * (-753.389) (-750.828) (-756.683) [-750.037] -- 0:00:37
      390000 -- (-755.055) (-754.249) (-750.838) [-752.202] * (-756.128) (-754.683) [-752.236] (-750.770) -- 0:00:37

      Average standard deviation of split frequencies: 0.010221

      390500 -- (-756.550) (-750.816) [-753.467] (-753.244) * [-756.675] (-751.163) (-751.836) (-752.733) -- 0:00:39
      391000 -- (-753.894) [-750.361] (-755.374) (-750.356) * (-753.763) (-753.578) (-751.659) [-753.283] -- 0:00:38
      391500 -- (-756.441) [-750.288] (-751.354) (-752.257) * (-753.732) (-754.411) (-751.904) [-751.582] -- 0:00:38
      392000 -- (-751.627) (-750.826) [-753.977] (-752.294) * (-753.645) [-753.916] (-750.376) (-751.510) -- 0:00:38
      392500 -- [-750.622] (-750.459) (-752.827) (-755.886) * (-751.655) (-752.686) (-754.294) [-752.057] -- 0:00:38
      393000 -- (-752.045) (-759.482) [-752.075] (-753.094) * [-751.726] (-751.465) (-752.532) (-753.763) -- 0:00:38
      393500 -- (-753.802) (-752.891) [-752.862] (-751.558) * (-752.014) (-753.011) (-751.701) [-754.469] -- 0:00:38
      394000 -- (-753.811) [-752.095] (-752.829) (-750.449) * (-752.930) [-750.571] (-752.850) (-751.715) -- 0:00:38
      394500 -- (-754.863) (-751.515) [-756.558] (-756.637) * [-750.206] (-752.615) (-752.248) (-753.935) -- 0:00:38
      395000 -- (-751.822) (-752.310) [-751.203] (-751.693) * (-751.335) (-754.066) (-757.325) [-752.043] -- 0:00:38

      Average standard deviation of split frequencies: 0.009873

      395500 -- (-757.462) (-752.228) (-750.761) [-751.655] * [-751.898] (-752.480) (-750.906) (-752.140) -- 0:00:38
      396000 -- (-751.810) (-758.952) (-751.180) [-751.477] * (-754.024) [-751.003] (-751.493) (-752.374) -- 0:00:38
      396500 -- (-750.572) (-752.769) [-753.646] (-754.077) * (-752.896) (-751.926) (-753.776) [-751.313] -- 0:00:38
      397000 -- (-750.459) (-753.354) (-751.404) [-750.287] * (-754.883) (-754.927) [-753.446] (-753.658) -- 0:00:37
      397500 -- [-752.158] (-753.260) (-754.722) (-750.757) * (-753.912) (-751.331) [-750.659] (-752.408) -- 0:00:37
      398000 -- [-751.310] (-757.011) (-752.908) (-753.058) * [-754.241] (-752.032) (-753.086) (-753.293) -- 0:00:37
      398500 -- (-752.780) (-755.882) [-752.916] (-752.708) * (-754.190) [-751.907] (-753.029) (-751.462) -- 0:00:37
      399000 -- (-750.983) (-756.840) (-751.906) [-752.681] * (-754.243) [-750.962] (-751.225) (-752.884) -- 0:00:37
      399500 -- (-754.161) (-750.633) [-752.774] (-753.028) * [-754.422] (-751.951) (-752.982) (-751.273) -- 0:00:37
      400000 -- [-750.830] (-751.074) (-752.369) (-755.162) * (-752.862) (-751.306) (-750.692) [-752.700] -- 0:00:37

      Average standard deviation of split frequencies: 0.010866

      400500 -- (-750.798) (-752.032) [-754.182] (-752.223) * (-757.587) [-751.896] (-752.277) (-752.287) -- 0:00:37
      401000 -- (-750.530) (-755.120) (-753.724) [-752.078] * (-755.322) (-752.829) (-750.765) [-750.996] -- 0:00:37
      401500 -- (-753.363) [-752.923] (-752.017) (-751.921) * (-751.322) [-752.015] (-750.437) (-752.150) -- 0:00:37
      402000 -- (-751.723) (-755.145) (-751.751) [-751.205] * (-751.545) [-754.260] (-757.139) (-752.347) -- 0:00:37
      402500 -- [-753.676] (-752.023) (-754.258) (-751.396) * (-751.875) (-752.120) [-753.844] (-754.319) -- 0:00:37
      403000 -- (-750.884) [-752.136] (-752.683) (-751.124) * (-753.158) (-753.850) [-750.185] (-751.983) -- 0:00:37
      403500 -- (-753.566) [-752.547] (-754.414) (-754.056) * (-753.996) (-754.059) [-750.716] (-750.166) -- 0:00:36
      404000 -- (-752.604) (-751.262) (-753.251) [-751.267] * (-751.160) [-752.568] (-754.738) (-750.925) -- 0:00:36
      404500 -- (-754.509) (-751.878) (-753.100) [-754.998] * (-752.250) [-758.311] (-756.417) (-752.897) -- 0:00:36
      405000 -- [-754.935] (-752.176) (-753.412) (-756.968) * (-758.077) (-753.683) (-756.070) [-755.713] -- 0:00:36

      Average standard deviation of split frequencies: 0.009699

      405500 -- (-751.811) (-754.363) [-750.968] (-754.138) * (-751.953) (-753.786) [-750.485] (-750.381) -- 0:00:36
      406000 -- (-752.255) (-750.696) [-751.025] (-754.096) * [-753.530] (-757.636) (-752.122) (-751.603) -- 0:00:36
      406500 -- (-751.097) [-751.970] (-752.051) (-751.679) * (-753.788) (-752.257) [-750.601] (-751.473) -- 0:00:36
      407000 -- (-750.796) (-755.335) [-752.491] (-752.173) * (-758.109) [-753.886] (-751.860) (-756.729) -- 0:00:37
      407500 -- (-751.177) (-754.733) (-754.283) [-754.247] * (-752.019) (-751.111) (-754.331) [-752.614] -- 0:00:37
      408000 -- (-752.056) (-752.608) [-753.580] (-753.910) * (-752.055) (-752.488) (-750.604) [-752.370] -- 0:00:37
      408500 -- (-753.068) (-752.748) [-750.700] (-752.347) * (-753.181) [-750.105] (-751.894) (-752.028) -- 0:00:37
      409000 -- [-752.839] (-752.761) (-762.521) (-755.507) * [-752.027] (-751.234) (-752.089) (-752.913) -- 0:00:37
      409500 -- (-753.749) [-751.043] (-753.450) (-755.499) * (-753.355) [-752.925] (-750.796) (-753.779) -- 0:00:37
      410000 -- (-752.329) [-750.710] (-754.603) (-755.914) * (-753.352) (-755.229) [-750.942] (-756.316) -- 0:00:37

      Average standard deviation of split frequencies: 0.010196

      410500 -- (-753.170) [-752.787] (-755.000) (-755.817) * [-752.593] (-755.724) (-751.982) (-751.793) -- 0:00:37
      411000 -- (-753.148) [-751.647] (-751.174) (-751.512) * (-752.793) (-751.904) [-750.994] (-751.459) -- 0:00:37
      411500 -- (-756.500) (-752.903) (-750.715) [-753.439] * [-752.280] (-753.773) (-752.959) (-754.593) -- 0:00:37
      412000 -- (-758.297) (-752.361) (-753.248) [-754.767] * (-754.215) [-753.150] (-754.263) (-754.604) -- 0:00:37
      412500 -- (-751.373) (-752.422) [-753.545] (-755.172) * (-753.952) (-753.698) [-752.713] (-752.924) -- 0:00:37
      413000 -- (-754.668) (-750.861) [-750.629] (-752.539) * (-753.809) (-754.728) (-754.023) [-755.023] -- 0:00:36
      413500 -- (-753.066) (-754.865) (-754.190) [-751.851] * (-752.253) (-750.859) (-750.939) [-752.213] -- 0:00:36
      414000 -- [-754.218] (-751.195) (-752.985) (-751.210) * (-751.180) [-752.682] (-753.425) (-753.450) -- 0:00:36
      414500 -- [-753.615] (-754.432) (-751.398) (-751.829) * (-755.422) [-757.633] (-752.734) (-751.603) -- 0:00:36
      415000 -- (-755.473) (-752.091) [-754.233] (-750.429) * (-753.446) [-751.886] (-756.070) (-756.019) -- 0:00:36

      Average standard deviation of split frequencies: 0.010128

      415500 -- (-758.788) (-751.382) [-753.285] (-753.343) * [-753.753] (-754.825) (-755.055) (-751.833) -- 0:00:36
      416000 -- [-751.464] (-753.824) (-751.866) (-752.748) * (-753.853) (-756.193) (-752.362) [-750.542] -- 0:00:36
      416500 -- [-751.733] (-751.297) (-750.852) (-751.477) * (-755.522) (-756.905) (-750.992) [-752.795] -- 0:00:36
      417000 -- (-752.369) (-755.801) [-751.513] (-753.239) * (-755.223) (-753.915) [-751.751] (-751.230) -- 0:00:36
      417500 -- [-754.516] (-754.205) (-751.639) (-756.838) * (-753.582) (-751.937) [-751.854] (-752.058) -- 0:00:36
      418000 -- (-755.969) [-751.531] (-751.937) (-755.440) * (-751.111) (-751.304) [-752.793] (-753.806) -- 0:00:36
      418500 -- (-752.948) (-752.845) [-752.711] (-750.812) * (-755.131) [-752.548] (-752.563) (-753.577) -- 0:00:36
      419000 -- [-751.767] (-754.474) (-753.267) (-758.936) * [-755.374] (-752.874) (-752.695) (-751.123) -- 0:00:36
      419500 -- [-755.493] (-754.764) (-753.099) (-752.562) * (-752.565) [-755.302] (-753.626) (-751.561) -- 0:00:35
      420000 -- (-752.507) (-757.866) (-754.933) [-750.896] * (-750.963) (-755.282) (-756.808) [-751.338] -- 0:00:35

      Average standard deviation of split frequencies: 0.009315

      420500 -- (-751.516) (-752.308) (-753.299) [-751.905] * (-750.751) [-751.781] (-754.914) (-752.409) -- 0:00:35
      421000 -- (-752.106) (-752.889) [-756.588] (-751.505) * [-750.969] (-752.119) (-754.269) (-754.970) -- 0:00:35
      421500 -- [-750.795] (-752.945) (-752.275) (-754.474) * (-754.130) (-752.974) (-751.019) [-750.223] -- 0:00:35
      422000 -- (-753.736) (-752.041) [-750.880] (-754.041) * [-755.223] (-753.100) (-750.958) (-751.601) -- 0:00:35
      422500 -- (-753.621) (-754.422) [-750.905] (-751.793) * (-752.960) (-752.114) [-750.799] (-751.801) -- 0:00:35
      423000 -- (-753.555) [-759.582] (-754.109) (-753.889) * (-751.549) (-752.217) [-752.050] (-752.432) -- 0:00:35
      423500 -- (-751.607) (-759.074) (-750.390) [-750.607] * [-755.677] (-752.283) (-750.941) (-751.813) -- 0:00:35
      424000 -- (-753.541) (-752.555) [-754.029] (-751.024) * (-753.114) (-753.888) (-753.990) [-755.569] -- 0:00:36
      424500 -- [-754.690] (-751.760) (-752.956) (-752.963) * (-750.831) (-754.589) [-755.758] (-752.981) -- 0:00:36
      425000 -- (-752.571) (-750.731) (-751.960) [-751.146] * (-751.770) (-753.396) (-758.571) [-751.007] -- 0:00:36

      Average standard deviation of split frequencies: 0.008507

      425500 -- (-753.275) (-751.986) [-751.057] (-752.430) * (-750.772) (-752.304) [-750.825] (-755.745) -- 0:00:36
      426000 -- (-753.770) [-751.295] (-752.081) (-752.387) * [-752.695] (-751.103) (-751.917) (-753.852) -- 0:00:36
      426500 -- (-751.220) (-753.663) (-751.130) [-751.018] * (-751.322) (-751.019) [-750.813] (-753.078) -- 0:00:36
      427000 -- (-750.104) (-752.074) (-751.562) [-750.665] * (-754.480) [-752.535] (-756.234) (-751.076) -- 0:00:36
      427500 -- (-752.802) [-753.077] (-751.126) (-753.368) * (-754.930) [-752.296] (-754.867) (-752.106) -- 0:00:36
      428000 -- [-752.079] (-753.232) (-754.500) (-750.864) * (-752.218) (-750.549) [-751.081] (-751.301) -- 0:00:36
      428500 -- [-751.438] (-751.709) (-752.336) (-753.423) * (-753.813) (-751.812) (-751.412) [-750.415] -- 0:00:36
      429000 -- [-751.729] (-751.627) (-753.064) (-752.015) * (-750.355) (-763.793) (-754.438) [-750.378] -- 0:00:35
      429500 -- [-751.031] (-753.315) (-759.281) (-750.537) * [-752.545] (-754.707) (-752.306) (-752.714) -- 0:00:35
      430000 -- (-751.402) (-755.122) (-752.379) [-750.765] * [-752.855] (-750.320) (-754.633) (-753.164) -- 0:00:35

      Average standard deviation of split frequencies: 0.008209

      430500 -- (-754.927) [-753.238] (-751.293) (-751.392) * (-751.624) (-751.704) (-752.141) [-750.836] -- 0:00:35
      431000 -- (-751.779) (-754.226) [-752.847] (-751.600) * (-751.162) (-751.551) (-752.064) [-750.355] -- 0:00:35
      431500 -- [-751.903] (-751.978) (-753.154) (-754.593) * (-751.446) [-753.409] (-752.464) (-752.579) -- 0:00:35
      432000 -- (-753.589) [-753.036] (-752.820) (-751.179) * [-750.926] (-751.247) (-751.660) (-751.306) -- 0:00:35
      432500 -- (-752.972) (-753.001) [-752.192] (-760.311) * (-754.499) (-750.690) (-752.457) [-755.222] -- 0:00:35
      433000 -- (-752.033) [-750.986] (-756.298) (-752.859) * [-751.649] (-755.406) (-750.751) (-752.623) -- 0:00:35
      433500 -- (-752.576) (-752.265) [-752.168] (-753.403) * (-754.295) (-754.239) [-751.561] (-750.675) -- 0:00:35
      434000 -- [-750.913] (-752.939) (-751.492) (-753.403) * (-752.139) [-752.503] (-753.403) (-751.855) -- 0:00:35
      434500 -- [-754.020] (-755.539) (-752.412) (-755.143) * [-751.751] (-753.444) (-752.469) (-751.445) -- 0:00:35
      435000 -- [-753.860] (-752.390) (-751.368) (-758.848) * (-752.161) [-751.548] (-755.277) (-752.361) -- 0:00:35

      Average standard deviation of split frequencies: 0.008244

      435500 -- [-752.060] (-752.738) (-752.092) (-756.444) * (-750.679) (-752.610) (-751.938) [-751.219] -- 0:00:34
      436000 -- (-753.874) (-751.399) [-753.529] (-752.931) * [-754.146] (-751.356) (-752.532) (-751.540) -- 0:00:34
      436500 -- (-751.610) [-753.940] (-751.722) (-757.785) * (-753.448) (-753.803) (-753.944) [-753.315] -- 0:00:34
      437000 -- (-752.626) (-751.523) [-753.369] (-751.648) * [-750.723] (-760.153) (-752.420) (-753.554) -- 0:00:34
      437500 -- (-752.699) (-752.189) (-750.615) [-752.507] * [-753.315] (-752.328) (-751.100) (-751.365) -- 0:00:34
      438000 -- (-754.018) (-750.641) (-750.654) [-751.251] * (-753.901) [-750.978] (-753.716) (-752.688) -- 0:00:34
      438500 -- (-753.886) (-750.916) [-755.093] (-752.800) * [-754.488] (-753.251) (-753.566) (-753.717) -- 0:00:34
      439000 -- (-752.456) [-751.876] (-751.918) (-752.775) * (-755.429) (-755.338) (-751.582) [-753.824] -- 0:00:34
      439500 -- (-754.474) [-751.778] (-752.907) (-752.870) * (-753.319) [-754.114] (-750.729) (-754.056) -- 0:00:34
      440000 -- (-753.467) (-752.893) (-754.983) [-752.065] * [-751.647] (-756.528) (-753.419) (-752.081) -- 0:00:34

      Average standard deviation of split frequencies: 0.008090

      440500 -- (-751.723) (-753.960) (-752.010) [-751.130] * (-750.513) [-752.140] (-751.509) (-753.483) -- 0:00:35
      441000 -- [-752.363] (-752.934) (-750.414) (-751.224) * (-751.353) (-752.070) [-752.613] (-750.515) -- 0:00:35
      441500 -- (-752.426) (-751.595) [-754.208] (-752.036) * (-750.495) (-752.193) (-752.081) [-751.744] -- 0:00:35
      442000 -- (-753.158) [-754.216] (-753.020) (-752.309) * (-751.209) (-754.293) (-754.420) [-752.490] -- 0:00:35
      442500 -- (-755.459) (-752.707) [-752.463] (-753.199) * [-751.095] (-752.743) (-757.421) (-755.512) -- 0:00:35
      443000 -- (-753.972) [-753.410] (-752.721) (-752.008) * (-757.870) (-752.462) (-750.971) [-751.035] -- 0:00:35
      443500 -- [-750.809] (-751.707) (-753.304) (-753.456) * [-751.640] (-753.611) (-756.892) (-752.939) -- 0:00:35
      444000 -- (-753.885) (-753.521) (-752.985) [-753.646] * (-750.811) (-750.726) [-752.058] (-753.923) -- 0:00:35
      444500 -- (-751.684) (-755.203) [-751.306] (-754.102) * (-751.770) [-751.699] (-751.401) (-752.688) -- 0:00:34
      445000 -- (-756.661) (-752.397) [-750.508] (-752.597) * (-753.035) (-752.739) (-751.774) [-750.233] -- 0:00:34

      Average standard deviation of split frequencies: 0.008390

      445500 -- [-751.217] (-750.286) (-751.034) (-751.793) * (-752.487) (-755.598) (-753.763) [-751.855] -- 0:00:34
      446000 -- (-751.698) [-750.643] (-752.361) (-750.497) * (-757.699) (-755.081) (-761.690) [-750.876] -- 0:00:34
      446500 -- [-751.534] (-752.558) (-750.462) (-751.173) * [-755.012] (-753.025) (-752.653) (-750.277) -- 0:00:34
      447000 -- (-751.118) (-756.256) [-750.830] (-751.096) * (-751.950) [-751.559] (-752.852) (-750.755) -- 0:00:34
      447500 -- (-752.005) (-751.761) (-751.101) [-752.766] * (-755.320) (-753.369) (-751.169) [-750.988] -- 0:00:34
      448000 -- (-752.446) (-750.595) [-750.705] (-753.934) * (-753.024) (-752.298) (-752.646) [-753.247] -- 0:00:34
      448500 -- (-751.500) [-753.532] (-750.050) (-752.663) * (-753.381) (-752.748) (-754.480) [-756.307] -- 0:00:34
      449000 -- [-751.534] (-750.742) (-750.886) (-752.135) * [-750.440] (-754.384) (-753.016) (-754.007) -- 0:00:34
      449500 -- (-752.714) (-752.640) [-752.251] (-751.029) * (-755.899) [-754.405] (-750.735) (-754.427) -- 0:00:34
      450000 -- (-752.206) [-752.489] (-752.840) (-751.121) * [-750.536] (-751.210) (-750.535) (-754.778) -- 0:00:34

      Average standard deviation of split frequencies: 0.008957

      450500 -- (-753.081) (-760.345) [-753.773] (-752.166) * (-751.400) (-753.234) [-750.621] (-751.121) -- 0:00:34
      451000 -- (-750.520) [-754.845] (-755.672) (-751.489) * (-752.478) (-751.855) [-750.593] (-751.035) -- 0:00:34
      451500 -- (-750.494) (-752.078) [-754.911] (-752.256) * [-752.854] (-758.257) (-751.848) (-751.936) -- 0:00:34
      452000 -- (-751.205) (-752.963) [-753.292] (-753.906) * (-753.976) [-752.106] (-751.770) (-752.468) -- 0:00:33
      452500 -- (-754.025) [-751.087] (-752.903) (-753.111) * (-753.779) [-751.644] (-751.715) (-752.279) -- 0:00:33
      453000 -- (-753.678) (-754.538) (-752.741) [-752.386] * [-752.117] (-752.781) (-751.251) (-751.132) -- 0:00:33
      453500 -- (-751.916) (-756.637) [-752.242] (-752.241) * (-759.126) (-751.522) (-752.475) [-754.071] -- 0:00:33
      454000 -- (-753.157) [-752.158] (-750.648) (-750.991) * (-752.407) [-751.932] (-752.539) (-754.872) -- 0:00:33
      454500 -- (-752.497) (-754.945) (-752.362) [-755.112] * (-753.280) (-751.777) [-751.777] (-754.943) -- 0:00:33
      455000 -- (-751.944) (-753.477) (-753.485) [-754.049] * [-751.082] (-751.669) (-753.249) (-758.187) -- 0:00:33

      Average standard deviation of split frequencies: 0.008399

      455500 -- (-752.986) [-751.285] (-754.458) (-753.356) * (-750.366) [-751.450] (-752.535) (-751.337) -- 0:00:33
      456000 -- (-752.776) [-751.162] (-753.428) (-752.698) * [-750.989] (-752.245) (-760.242) (-752.779) -- 0:00:33
      456500 -- [-752.810] (-752.488) (-750.928) (-751.809) * [-750.114] (-752.386) (-751.066) (-752.092) -- 0:00:33
      457000 -- (-751.278) [-751.320] (-753.583) (-754.289) * (-751.835) [-752.787] (-753.262) (-753.462) -- 0:00:34
      457500 -- (-760.097) [-751.982] (-755.597) (-755.188) * (-751.013) [-750.984] (-750.732) (-752.766) -- 0:00:34
      458000 -- (-755.763) (-755.360) (-751.195) [-753.924] * (-753.606) (-753.038) (-750.787) [-753.838] -- 0:00:34
      458500 -- (-751.931) [-755.435] (-752.045) (-752.094) * (-750.791) [-753.044] (-751.106) (-754.381) -- 0:00:34
      459000 -- [-754.046] (-753.118) (-754.830) (-751.051) * (-750.768) [-753.612] (-757.911) (-753.393) -- 0:00:34
      459500 -- (-752.348) (-752.368) (-755.870) [-752.154] * (-754.649) (-753.370) (-752.241) [-752.803] -- 0:00:34
      460000 -- (-752.304) (-753.885) [-751.358] (-751.271) * (-751.741) (-750.734) [-750.380] (-753.297) -- 0:00:34

      Average standard deviation of split frequencies: 0.007803

      460500 -- (-752.440) (-752.512) [-751.223] (-753.074) * (-751.159) (-752.955) [-751.543] (-752.713) -- 0:00:33
      461000 -- (-752.665) [-753.186] (-751.766) (-753.230) * (-752.837) (-753.685) [-752.363] (-755.449) -- 0:00:33
      461500 -- (-750.604) [-756.415] (-756.091) (-756.076) * [-754.669] (-756.222) (-752.662) (-757.048) -- 0:00:33
      462000 -- (-753.961) (-751.911) [-750.338] (-754.889) * [-751.611] (-752.650) (-752.265) (-751.918) -- 0:00:33
      462500 -- [-751.154] (-753.588) (-750.337) (-753.193) * [-750.825] (-754.028) (-753.023) (-754.287) -- 0:00:33
      463000 -- [-751.246] (-753.452) (-751.983) (-757.085) * [-750.839] (-752.069) (-754.146) (-752.465) -- 0:00:33
      463500 -- (-752.761) (-755.047) [-751.855] (-752.977) * (-752.366) [-752.111] (-751.404) (-755.901) -- 0:00:33
      464000 -- (-753.443) (-753.284) (-753.127) [-752.751] * (-753.509) [-753.915] (-751.569) (-751.449) -- 0:00:33
      464500 -- [-751.915] (-751.376) (-755.043) (-752.441) * (-754.335) (-757.314) [-758.825] (-753.626) -- 0:00:33
      465000 -- (-752.108) [-750.776] (-752.581) (-750.935) * (-752.189) (-753.146) [-752.775] (-752.994) -- 0:00:33

      Average standard deviation of split frequencies: 0.008282

      465500 -- (-753.275) [-752.508] (-751.408) (-750.861) * (-751.570) (-751.754) [-751.442] (-753.717) -- 0:00:33
      466000 -- (-753.035) [-751.227] (-754.034) (-751.967) * (-751.480) (-751.732) (-753.800) [-752.782] -- 0:00:33
      466500 -- (-753.199) [-751.275] (-759.447) (-752.535) * [-754.895] (-751.378) (-752.036) (-752.241) -- 0:00:33
      467000 -- (-754.208) [-751.759] (-753.991) (-753.787) * (-755.000) [-755.540] (-752.018) (-753.960) -- 0:00:33
      467500 -- [-751.637] (-752.848) (-754.352) (-752.966) * [-752.218] (-754.629) (-752.481) (-759.732) -- 0:00:33
      468000 -- (-754.624) (-751.952) (-752.967) [-752.480] * (-752.299) (-751.011) [-751.927] (-753.360) -- 0:00:32
      468500 -- (-755.940) [-752.608] (-751.807) (-752.737) * (-752.440) (-750.688) (-755.361) [-753.906] -- 0:00:32
      469000 -- (-753.497) [-752.872] (-751.566) (-752.841) * (-751.316) (-752.661) [-754.594] (-751.048) -- 0:00:32
      469500 -- [-755.534] (-752.509) (-752.306) (-752.561) * [-750.848] (-751.869) (-751.279) (-750.719) -- 0:00:32
      470000 -- (-751.270) (-752.961) (-752.397) [-753.830] * (-754.630) (-753.901) (-751.736) [-754.244] -- 0:00:32

      Average standard deviation of split frequencies: 0.008576

      470500 -- [-754.838] (-751.367) (-751.971) (-751.875) * (-755.618) [-752.493] (-752.562) (-754.991) -- 0:00:32
      471000 -- [-751.236] (-751.165) (-752.772) (-752.840) * [-752.542] (-753.687) (-754.570) (-752.274) -- 0:00:32
      471500 -- (-752.205) (-754.616) (-752.854) [-751.919] * (-753.890) [-753.405] (-751.392) (-752.732) -- 0:00:32
      472000 -- (-752.887) (-752.388) (-752.227) [-752.893] * (-754.980) (-752.244) [-750.785] (-751.921) -- 0:00:32
      472500 -- (-756.284) [-750.404] (-755.364) (-755.695) * (-753.244) (-753.944) [-750.911] (-752.637) -- 0:00:32
      473000 -- (-751.993) (-751.230) (-754.660) [-753.103] * (-752.777) [-750.966] (-750.434) (-756.350) -- 0:00:32
      473500 -- (-751.969) (-755.032) (-751.879) [-751.964] * (-751.145) [-751.063] (-751.552) (-752.073) -- 0:00:32
      474000 -- [-751.465] (-754.837) (-751.967) (-752.040) * (-751.743) (-752.683) (-762.300) [-752.476] -- 0:00:33
      474500 -- (-753.212) (-753.857) (-753.035) [-752.267] * [-755.229] (-753.018) (-758.785) (-755.947) -- 0:00:33
      475000 -- (-756.052) (-752.453) [-752.523] (-752.730) * (-753.060) (-753.070) (-752.396) [-753.216] -- 0:00:33

      Average standard deviation of split frequencies: 0.009161

      475500 -- (-751.305) [-751.459] (-750.778) (-751.867) * [-751.267] (-752.549) (-752.671) (-751.182) -- 0:00:33
      476000 -- (-751.170) [-753.966] (-750.327) (-753.021) * (-753.578) (-752.823) (-754.113) [-756.161] -- 0:00:33
      476500 -- (-752.118) (-751.796) [-750.592] (-754.162) * (-753.587) (-751.576) (-754.792) [-750.663] -- 0:00:32
      477000 -- (-752.378) (-754.412) (-753.630) [-755.126] * (-756.092) (-753.996) (-752.270) [-750.707] -- 0:00:32
      477500 -- [-751.740] (-753.846) (-751.631) (-755.187) * [-751.088] (-755.545) (-754.429) (-751.916) -- 0:00:32
      478000 -- [-751.614] (-752.276) (-751.085) (-750.805) * [-753.801] (-757.866) (-750.745) (-752.870) -- 0:00:32
      478500 -- (-753.209) [-752.660] (-757.883) (-750.777) * (-752.245) (-757.554) (-750.568) [-751.176] -- 0:00:32
      479000 -- (-752.433) (-752.735) [-754.513] (-751.632) * (-754.809) (-751.512) (-751.049) [-750.943] -- 0:00:32
      479500 -- (-753.234) [-754.098] (-754.757) (-752.091) * (-750.978) (-754.280) (-753.854) [-752.339] -- 0:00:32
      480000 -- (-754.500) [-754.460] (-754.617) (-756.020) * [-752.561] (-754.636) (-752.624) (-751.581) -- 0:00:32

      Average standard deviation of split frequencies: 0.009685

      480500 -- (-757.258) [-750.570] (-752.631) (-757.722) * [-750.959] (-753.809) (-752.242) (-752.821) -- 0:00:32
      481000 -- (-751.808) [-750.574] (-757.115) (-752.699) * [-753.037] (-753.173) (-752.201) (-754.470) -- 0:00:32
      481500 -- (-750.785) (-751.963) [-752.446] (-752.032) * (-758.820) (-751.364) [-750.778] (-756.907) -- 0:00:32
      482000 -- (-751.461) [-755.224] (-751.880) (-752.938) * (-752.437) (-751.753) [-751.440] (-756.555) -- 0:00:32
      482500 -- [-753.276] (-752.083) (-750.914) (-755.762) * (-757.206) (-753.675) (-757.606) [-753.753] -- 0:00:32
      483000 -- (-752.242) (-751.778) (-750.312) [-752.675] * [-755.715] (-751.294) (-754.924) (-755.253) -- 0:00:32
      483500 -- [-750.583] (-751.674) (-753.094) (-753.478) * (-752.984) (-752.154) (-754.919) [-750.781] -- 0:00:32
      484000 -- (-757.239) (-750.760) [-751.383] (-754.557) * (-754.250) [-751.661] (-752.154) (-752.049) -- 0:00:31
      484500 -- (-751.042) [-752.707] (-755.822) (-756.467) * (-752.823) (-753.197) [-752.136] (-753.593) -- 0:00:31
      485000 -- (-750.317) (-752.135) (-751.989) [-750.941] * (-751.188) [-750.587] (-756.476) (-752.848) -- 0:00:31

      Average standard deviation of split frequencies: 0.010003

      485500 -- [-754.543] (-750.342) (-756.962) (-752.523) * (-752.992) (-752.906) [-755.046] (-754.352) -- 0:00:31
      486000 -- (-754.953) (-754.701) [-751.817] (-752.811) * (-752.863) [-754.805] (-753.628) (-754.784) -- 0:00:31
      486500 -- (-752.422) (-751.732) [-750.640] (-753.880) * [-754.126] (-752.195) (-752.515) (-755.103) -- 0:00:31
      487000 -- (-754.384) (-754.940) (-752.402) [-753.707] * [-755.800] (-754.446) (-750.959) (-755.877) -- 0:00:31
      487500 -- [-751.658] (-751.456) (-753.737) (-751.286) * [-754.765] (-755.441) (-756.943) (-751.215) -- 0:00:31
      488000 -- (-751.405) (-751.597) (-755.192) [-751.148] * (-752.763) (-752.150) [-752.349] (-751.236) -- 0:00:31
      488500 -- (-754.055) (-751.122) [-753.836] (-750.367) * [-752.403] (-750.758) (-755.607) (-751.736) -- 0:00:31
      489000 -- (-752.423) [-751.326] (-752.098) (-753.553) * (-752.261) (-752.055) [-752.374] (-751.661) -- 0:00:31
      489500 -- [-753.654] (-753.297) (-753.460) (-751.302) * (-752.345) (-754.306) [-750.991] (-750.788) -- 0:00:31
      490000 -- [-752.411] (-753.085) (-753.085) (-751.378) * (-751.696) (-753.981) [-751.175] (-751.020) -- 0:00:31

      Average standard deviation of split frequencies: 0.009667

      490500 -- (-752.811) [-753.019] (-752.715) (-753.554) * (-752.034) [-753.433] (-754.261) (-751.092) -- 0:00:32
      491000 -- (-752.049) (-756.998) (-753.586) [-751.669] * (-755.299) (-750.416) [-751.927] (-752.090) -- 0:00:32
      491500 -- (-752.289) (-754.665) (-759.273) [-753.806] * (-753.092) (-750.301) (-756.205) [-750.811] -- 0:00:32
      492000 -- (-753.256) (-753.879) [-754.896] (-753.591) * [-751.205] (-750.832) (-750.542) (-754.288) -- 0:00:32
      492500 -- [-759.345] (-757.335) (-757.883) (-758.362) * (-752.147) [-750.464] (-752.889) (-754.558) -- 0:00:31
      493000 -- (-752.581) (-755.969) (-752.152) [-754.017] * (-752.018) [-753.079] (-751.237) (-752.503) -- 0:00:31
      493500 -- [-750.937] (-756.341) (-753.538) (-752.206) * (-750.263) (-751.144) [-751.405] (-754.862) -- 0:00:31
      494000 -- (-750.948) [-755.862] (-752.791) (-751.287) * (-753.403) (-755.897) (-751.767) [-752.743] -- 0:00:31
      494500 -- (-752.724) (-754.594) [-750.467] (-753.193) * (-751.534) [-750.554] (-752.489) (-754.276) -- 0:00:31
      495000 -- (-753.420) [-751.736] (-753.015) (-754.048) * [-755.076] (-752.340) (-755.059) (-754.024) -- 0:00:31

      Average standard deviation of split frequencies: 0.009742

      495500 -- [-753.873] (-751.181) (-752.723) (-751.948) * (-752.504) [-755.940] (-752.901) (-751.123) -- 0:00:31
      496000 -- (-752.301) [-752.005] (-752.541) (-752.462) * (-750.927) (-754.212) (-753.215) [-752.012] -- 0:00:31
      496500 -- (-754.292) (-754.265) [-752.542] (-751.045) * (-752.187) (-755.413) (-751.087) [-754.556] -- 0:00:31
      497000 -- (-755.703) (-754.469) (-752.704) [-751.528] * (-752.494) (-750.709) (-755.765) [-753.422] -- 0:00:31
      497500 -- (-754.211) (-753.938) [-752.464] (-751.386) * [-752.557] (-750.756) (-753.487) (-751.453) -- 0:00:31
      498000 -- (-757.460) [-753.497] (-752.109) (-751.788) * [-754.438] (-755.384) (-752.223) (-750.912) -- 0:00:31
      498500 -- [-752.161] (-754.135) (-752.921) (-752.758) * [-752.844] (-751.340) (-754.710) (-750.946) -- 0:00:31
      499000 -- (-752.048) [-752.813] (-753.486) (-753.653) * [-753.479] (-751.703) (-752.133) (-750.800) -- 0:00:31
      499500 -- (-753.124) [-751.686] (-755.539) (-752.673) * (-752.675) [-751.120] (-752.206) (-756.250) -- 0:00:31
      500000 -- (-753.351) (-751.547) (-756.561) [-752.951] * [-753.878] (-754.880) (-752.808) (-755.820) -- 0:00:31

      Average standard deviation of split frequencies: 0.009886

      500500 -- (-750.511) (-751.586) (-752.704) [-752.609] * (-753.067) [-751.687] (-751.927) (-752.484) -- 0:00:30
      501000 -- [-751.380] (-753.518) (-750.587) (-752.919) * (-753.223) (-750.854) (-751.751) [-751.457] -- 0:00:30
      501500 -- (-751.978) (-753.297) [-756.123] (-752.406) * (-751.094) (-753.520) (-753.259) [-751.667] -- 0:00:30
      502000 -- (-752.946) [-752.419] (-754.285) (-752.790) * (-753.031) (-753.625) [-750.741] (-751.556) -- 0:00:30
      502500 -- (-754.635) (-751.910) (-752.508) [-759.642] * (-750.550) (-758.304) (-751.158) [-752.648] -- 0:00:30
      503000 -- [-753.509] (-752.271) (-753.329) (-756.766) * (-752.998) (-751.123) (-755.920) [-752.973] -- 0:00:30
      503500 -- (-754.256) (-752.256) (-758.686) [-752.250] * (-751.620) [-751.820] (-752.544) (-753.059) -- 0:00:30
      504000 -- (-754.728) [-750.873] (-755.222) (-751.158) * (-750.734) (-754.047) (-752.944) [-751.251] -- 0:00:30
      504500 -- (-752.521) (-751.768) [-754.081] (-754.282) * [-752.790] (-752.948) (-753.025) (-753.212) -- 0:00:30
      505000 -- (-752.692) (-751.235) [-751.959] (-751.611) * (-751.557) (-752.087) (-751.865) [-751.860] -- 0:00:30

      Average standard deviation of split frequencies: 0.010539

      505500 -- [-758.249] (-754.284) (-750.655) (-750.678) * (-757.029) [-753.114] (-758.916) (-752.722) -- 0:00:30
      506000 -- (-754.100) (-756.537) (-751.650) [-750.436] * (-751.664) (-753.095) (-753.495) [-751.605] -- 0:00:30
      506500 -- [-751.388] (-753.175) (-754.361) (-755.437) * (-754.441) [-751.309] (-751.816) (-753.621) -- 0:00:30
      507000 -- (-753.465) [-750.761] (-752.551) (-752.877) * [-753.868] (-751.222) (-752.722) (-751.923) -- 0:00:31
      507500 -- (-752.810) [-752.612] (-751.423) (-753.590) * (-754.970) (-753.173) (-751.956) [-750.798] -- 0:00:31
      508000 -- [-753.018] (-754.455) (-750.832) (-752.895) * (-752.269) (-752.404) (-755.901) [-752.144] -- 0:00:30
      508500 -- (-752.160) [-752.959] (-753.964) (-753.299) * [-754.193] (-751.277) (-751.722) (-754.869) -- 0:00:30
      509000 -- [-751.172] (-752.401) (-752.038) (-752.581) * (-752.023) [-752.237] (-753.442) (-752.946) -- 0:00:30
      509500 -- (-751.623) (-751.942) (-753.055) [-758.321] * (-754.447) (-752.647) [-754.685] (-755.115) -- 0:00:30
      510000 -- (-752.659) (-751.354) [-752.195] (-753.525) * (-757.018) [-750.579] (-754.445) (-752.823) -- 0:00:30

      Average standard deviation of split frequencies: 0.010558

      510500 -- (-752.958) (-753.404) [-751.652] (-755.273) * (-756.984) (-752.968) [-754.204] (-752.351) -- 0:00:30
      511000 -- [-751.168] (-752.574) (-751.433) (-750.840) * (-753.844) (-751.694) (-753.301) [-751.437] -- 0:00:30
      511500 -- (-752.381) (-753.933) [-751.700] (-752.585) * (-751.088) (-752.911) [-755.679] (-756.239) -- 0:00:30
      512000 -- (-752.257) [-751.523] (-755.659) (-752.443) * [-751.643] (-754.671) (-750.569) (-753.768) -- 0:00:30
      512500 -- (-752.802) (-752.117) [-752.535] (-751.757) * (-756.010) (-757.533) (-754.403) [-752.615] -- 0:00:30
      513000 -- (-751.387) (-751.963) (-752.649) [-751.944] * (-758.219) (-754.805) (-754.727) [-751.475] -- 0:00:30
      513500 -- (-755.806) (-751.953) [-752.646] (-756.315) * (-754.220) [-750.598] (-754.704) (-753.200) -- 0:00:30
      514000 -- (-751.351) (-752.646) (-754.126) [-754.703] * (-751.040) (-752.666) (-753.971) [-751.498] -- 0:00:30
      514500 -- (-753.558) [-753.223] (-752.432) (-753.273) * (-752.295) (-751.375) [-751.717] (-752.228) -- 0:00:30
      515000 -- (-762.475) (-751.269) (-752.850) [-752.283] * (-752.614) (-751.858) (-752.563) [-754.923] -- 0:00:30

      Average standard deviation of split frequencies: 0.010849

      515500 -- (-752.856) (-752.000) [-751.380] (-755.663) * (-752.475) (-750.763) [-751.398] (-756.440) -- 0:00:30
      516000 -- (-752.966) [-753.448] (-750.411) (-757.437) * [-753.543] (-752.347) (-751.603) (-754.173) -- 0:00:30
      516500 -- (-752.178) (-752.366) [-753.021] (-755.763) * [-758.274] (-751.177) (-750.597) (-753.473) -- 0:00:29
      517000 -- [-751.793] (-752.116) (-751.829) (-751.473) * (-754.991) [-750.582] (-751.822) (-752.208) -- 0:00:29
      517500 -- (-752.113) [-751.542] (-750.691) (-751.011) * (-754.339) (-753.091) [-751.813] (-754.235) -- 0:00:29
      518000 -- [-754.334] (-754.387) (-752.625) (-756.543) * (-751.031) (-753.048) [-754.338] (-754.508) -- 0:00:29
      518500 -- (-756.408) [-753.591] (-753.773) (-752.364) * (-751.039) (-751.193) [-751.746] (-751.122) -- 0:00:29
      519000 -- [-752.289] (-754.055) (-753.586) (-753.118) * [-750.824] (-750.954) (-753.718) (-752.034) -- 0:00:29
      519500 -- (-753.547) [-754.350] (-753.625) (-754.118) * (-755.090) (-751.046) (-752.679) [-755.667] -- 0:00:29
      520000 -- (-754.041) [-753.156] (-756.105) (-756.230) * [-753.716] (-753.654) (-753.533) (-753.831) -- 0:00:29

      Average standard deviation of split frequencies: 0.010186

      520500 -- (-752.411) (-752.303) (-752.592) [-750.991] * (-750.157) [-750.230] (-753.386) (-751.041) -- 0:00:29
      521000 -- (-757.207) [-752.434] (-753.365) (-752.229) * (-751.516) (-751.658) [-750.809] (-750.450) -- 0:00:29
      521500 -- (-754.275) [-753.277] (-752.287) (-751.681) * [-751.379] (-752.151) (-752.213) (-751.825) -- 0:00:29
      522000 -- (-754.852) (-758.272) [-755.486] (-757.399) * (-751.741) [-753.185] (-754.413) (-751.484) -- 0:00:29
      522500 -- (-754.904) (-756.392) (-751.546) [-750.897] * [-750.614] (-752.789) (-752.213) (-751.744) -- 0:00:29
      523000 -- (-752.977) (-751.466) (-751.566) [-751.645] * (-753.016) (-751.266) [-755.590] (-752.671) -- 0:00:29
      523500 -- [-755.822] (-754.998) (-752.697) (-752.175) * (-752.247) [-752.179] (-754.745) (-754.619) -- 0:00:30
      524000 -- (-755.986) (-750.637) (-752.445) [-751.447] * [-754.037] (-752.228) (-751.956) (-750.986) -- 0:00:29
      524500 -- (-752.785) [-750.510] (-755.910) (-751.617) * (-750.751) (-751.423) (-751.148) [-752.189] -- 0:00:29
      525000 -- (-751.619) [-750.832] (-760.203) (-754.402) * (-750.899) (-751.205) [-751.965] (-751.719) -- 0:00:29

      Average standard deviation of split frequencies: 0.010250

      525500 -- (-752.452) (-751.143) [-753.125] (-751.562) * (-751.520) (-751.048) (-752.164) [-750.985] -- 0:00:29
      526000 -- (-753.971) [-752.157] (-754.368) (-750.460) * [-751.186] (-751.271) (-751.009) (-751.163) -- 0:00:29
      526500 -- (-754.626) [-752.302] (-751.170) (-750.296) * (-751.179) (-751.374) [-751.019] (-752.550) -- 0:00:29
      527000 -- (-750.786) (-752.124) [-751.454] (-752.699) * (-750.429) [-752.404] (-751.331) (-752.587) -- 0:00:29
      527500 -- (-753.464) (-755.517) (-751.871) [-750.593] * [-750.628] (-751.009) (-752.257) (-751.884) -- 0:00:29
      528000 -- [-750.786] (-754.654) (-752.026) (-755.605) * (-750.632) [-751.813] (-752.266) (-755.215) -- 0:00:29
      528500 -- (-751.511) (-756.620) [-751.787] (-754.797) * (-753.404) (-752.815) (-750.733) [-752.105] -- 0:00:29
      529000 -- (-750.607) (-753.308) (-753.087) [-752.877] * [-752.283] (-754.181) (-752.966) (-752.693) -- 0:00:29
      529500 -- [-753.068] (-753.491) (-753.973) (-753.759) * (-755.488) (-754.130) (-753.299) [-752.590] -- 0:00:29
      530000 -- (-757.500) (-753.645) (-757.754) [-750.647] * (-758.097) (-754.179) (-754.469) [-753.481] -- 0:00:29

      Average standard deviation of split frequencies: 0.009050

      530500 -- (-756.658) [-753.414] (-751.715) (-754.445) * [-753.828] (-752.384) (-751.959) (-752.148) -- 0:00:29
      531000 -- (-751.845) (-751.120) [-751.085] (-752.625) * (-752.533) (-754.300) (-750.763) [-753.390] -- 0:00:29
      531500 -- (-752.428) (-752.837) (-750.265) [-753.239] * (-751.757) (-759.145) [-755.149] (-751.324) -- 0:00:29
      532000 -- [-753.746] (-751.649) (-750.369) (-752.549) * [-750.889] (-750.957) (-753.308) (-753.558) -- 0:00:29
      532500 -- (-751.586) (-751.514) [-750.368] (-755.427) * (-757.082) (-750.784) [-752.546] (-752.747) -- 0:00:28
      533000 -- [-753.581] (-751.403) (-751.261) (-753.730) * (-756.134) (-754.836) (-754.916) [-751.179] -- 0:00:28
      533500 -- (-755.584) [-753.119] (-751.429) (-751.945) * [-753.960] (-756.682) (-754.964) (-753.428) -- 0:00:28
      534000 -- [-752.542] (-753.215) (-751.788) (-753.177) * (-751.682) [-759.956] (-752.163) (-755.022) -- 0:00:28
      534500 -- (-752.232) [-752.390] (-752.005) (-752.160) * [-750.962] (-751.666) (-750.230) (-751.923) -- 0:00:28
      535000 -- (-753.275) (-755.604) (-751.537) [-751.849] * (-751.845) (-753.797) (-752.296) [-751.155] -- 0:00:28

      Average standard deviation of split frequencies: 0.009400

      535500 -- (-752.459) [-757.596] (-751.023) (-751.918) * [-752.046] (-753.072) (-752.405) (-753.134) -- 0:00:28
      536000 -- (-753.193) (-754.458) (-751.589) [-750.344] * (-752.801) (-755.652) (-752.097) [-752.622] -- 0:00:28
      536500 -- [-752.972] (-754.138) (-753.945) (-751.269) * [-751.443] (-751.415) (-754.591) (-752.230) -- 0:00:28
      537000 -- (-754.046) (-755.667) (-754.427) [-750.972] * (-751.025) (-754.069) (-753.527) [-752.210] -- 0:00:28
      537500 -- (-752.899) [-752.873] (-751.825) (-750.847) * (-750.898) [-753.977] (-752.353) (-752.512) -- 0:00:28
      538000 -- [-754.976] (-752.382) (-751.565) (-751.409) * [-751.480] (-752.054) (-752.917) (-756.388) -- 0:00:28
      538500 -- (-757.740) (-750.569) (-751.563) [-752.486] * (-752.730) [-751.223] (-754.332) (-751.844) -- 0:00:28
      539000 -- [-751.367] (-754.450) (-754.583) (-756.045) * (-753.164) (-751.224) (-751.110) [-750.921] -- 0:00:28
      539500 -- [-752.833] (-752.072) (-759.478) (-754.349) * (-752.112) (-753.748) (-750.769) [-754.154] -- 0:00:28
      540000 -- (-754.369) [-754.056] (-753.838) (-756.238) * (-751.321) (-754.131) (-753.540) [-754.766] -- 0:00:28

      Average standard deviation of split frequencies: 0.009155

      540500 -- [-752.681] (-753.413) (-751.929) (-754.759) * (-752.580) [-755.877] (-754.085) (-755.455) -- 0:00:28
      541000 -- [-751.454] (-753.772) (-753.143) (-755.023) * [-752.601] (-758.187) (-751.601) (-754.762) -- 0:00:28
      541500 -- (-752.817) [-752.976] (-751.169) (-751.607) * [-752.209] (-757.679) (-752.011) (-751.889) -- 0:00:28
      542000 -- (-751.807) [-752.706] (-752.166) (-750.498) * (-752.539) [-751.646] (-752.792) (-753.456) -- 0:00:28
      542500 -- (-751.531) [-751.649] (-751.012) (-755.592) * (-756.716) (-752.591) (-750.948) [-754.148] -- 0:00:28
      543000 -- (-751.697) (-751.579) [-751.062] (-752.509) * (-754.966) (-752.404) [-751.432] (-751.182) -- 0:00:28
      543500 -- (-754.115) (-751.672) [-756.303] (-750.285) * (-752.730) (-752.618) (-750.556) [-750.542] -- 0:00:28
      544000 -- (-752.472) (-755.693) [-756.005] (-750.905) * [-752.153] (-755.662) (-752.450) (-751.610) -- 0:00:28
      544500 -- [-753.808] (-751.150) (-754.764) (-751.537) * (-751.669) (-752.076) (-751.595) [-750.950] -- 0:00:28
      545000 -- (-751.371) (-753.330) [-756.745] (-752.812) * (-754.152) (-751.890) (-756.058) [-751.446] -- 0:00:28

      Average standard deviation of split frequencies: 0.009659

      545500 -- (-753.627) (-752.552) (-753.710) [-751.691] * [-752.214] (-753.897) (-753.250) (-750.735) -- 0:00:28
      546000 -- (-753.915) (-754.286) [-754.620] (-753.337) * (-753.483) (-755.195) [-750.771] (-752.631) -- 0:00:28
      546500 -- (-751.212) [-751.076] (-751.368) (-751.013) * [-752.520] (-753.547) (-752.049) (-751.987) -- 0:00:28
      547000 -- [-752.709] (-755.117) (-751.387) (-752.409) * (-752.294) [-754.601] (-752.664) (-752.722) -- 0:00:28
      547500 -- (-754.214) (-752.888) [-750.814] (-753.600) * (-755.435) (-753.155) (-754.284) [-753.526] -- 0:00:28
      548000 -- (-756.682) [-753.045] (-750.410) (-751.713) * (-751.283) [-754.985] (-751.831) (-755.213) -- 0:00:28
      548500 -- (-756.454) [-751.821] (-756.202) (-751.861) * (-753.166) [-751.383] (-751.451) (-752.697) -- 0:00:27
      549000 -- (-754.756) [-751.825] (-750.886) (-750.626) * (-756.383) (-751.950) [-751.724] (-752.463) -- 0:00:27
      549500 -- [-751.497] (-750.530) (-752.608) (-752.149) * (-752.937) (-752.859) [-753.876] (-754.856) -- 0:00:27
      550000 -- (-753.804) [-750.763] (-755.799) (-753.103) * [-751.481] (-751.788) (-752.082) (-753.765) -- 0:00:27

      Average standard deviation of split frequencies: 0.010433

      550500 -- (-751.860) [-750.598] (-751.817) (-751.384) * (-753.050) (-750.580) [-757.244] (-756.839) -- 0:00:27
      551000 -- [-751.011] (-753.976) (-752.217) (-752.242) * (-753.250) [-751.326] (-751.179) (-751.452) -- 0:00:27
      551500 -- [-752.523] (-754.686) (-758.841) (-750.900) * (-754.211) (-751.946) (-751.596) [-752.825] -- 0:00:27
      552000 -- [-751.531] (-752.494) (-754.372) (-754.235) * (-756.964) (-751.210) [-751.402] (-751.376) -- 0:00:27
      552500 -- (-751.573) (-751.448) (-752.204) [-751.416] * (-752.375) [-750.629] (-752.648) (-752.995) -- 0:00:27
      553000 -- (-752.011) (-753.373) [-751.595] (-755.511) * (-756.650) (-751.688) [-752.817] (-754.678) -- 0:00:27
      553500 -- [-751.159] (-751.888) (-755.398) (-753.351) * (-753.035) (-755.196) [-751.890] (-755.274) -- 0:00:27
      554000 -- (-755.091) (-752.382) (-753.303) [-753.649] * (-754.569) (-753.451) (-750.696) [-755.297] -- 0:00:27
      554500 -- (-758.363) [-756.846] (-759.470) (-753.456) * (-755.802) (-761.616) [-751.247] (-752.039) -- 0:00:27
      555000 -- (-751.251) (-754.630) (-754.286) [-753.206] * [-753.212] (-753.609) (-752.286) (-757.846) -- 0:00:28

      Average standard deviation of split frequencies: 0.010280

      555500 -- (-751.317) [-753.718] (-752.010) (-752.908) * (-752.593) [-752.039] (-751.203) (-757.324) -- 0:00:28
      556000 -- (-751.565) (-754.212) [-752.431] (-752.641) * (-753.240) (-752.742) [-750.737] (-753.982) -- 0:00:27
      556500 -- (-751.570) [-751.342] (-753.653) (-758.310) * (-751.508) [-752.086] (-751.041) (-753.283) -- 0:00:27
      557000 -- [-753.700] (-757.076) (-754.751) (-752.633) * (-751.621) (-751.558) (-752.446) [-751.205] -- 0:00:27
      557500 -- (-754.508) (-753.630) (-752.175) [-751.300] * (-752.832) (-750.876) (-751.674) [-752.086] -- 0:00:27
      558000 -- [-753.830] (-752.374) (-752.293) (-752.791) * (-753.381) [-751.253] (-751.706) (-752.932) -- 0:00:27
      558500 -- (-753.433) (-750.917) (-754.237) [-752.752] * (-759.412) (-751.112) [-750.445] (-759.699) -- 0:00:27
      559000 -- (-757.405) [-751.198] (-751.878) (-754.053) * (-758.759) [-751.519] (-750.633) (-754.160) -- 0:00:27
      559500 -- (-752.389) (-752.202) [-751.379] (-753.514) * (-751.395) (-755.839) [-751.116] (-754.421) -- 0:00:27
      560000 -- (-750.597) [-752.992] (-753.190) (-752.529) * (-751.896) [-751.607] (-751.603) (-751.159) -- 0:00:27

      Average standard deviation of split frequencies: 0.011193

      560500 -- (-752.049) (-750.949) [-751.798] (-751.600) * (-751.957) (-750.541) (-753.326) [-753.908] -- 0:00:27
      561000 -- (-752.038) (-750.650) (-751.781) [-752.419] * (-752.989) (-750.696) (-754.649) [-754.066] -- 0:00:27
      561500 -- (-753.179) (-750.935) (-750.679) [-752.106] * (-753.526) (-751.231) (-754.098) [-752.450] -- 0:00:27
      562000 -- [-752.262] (-751.364) (-754.590) (-751.423) * (-753.334) (-751.122) (-753.889) [-754.001] -- 0:00:27
      562500 -- (-753.086) [-752.198] (-756.805) (-754.590) * (-752.521) (-752.104) [-752.174] (-751.708) -- 0:00:27
      563000 -- [-750.869] (-754.257) (-753.147) (-752.921) * [-753.810] (-753.119) (-754.524) (-752.411) -- 0:00:27
      563500 -- (-752.609) (-756.753) [-754.251] (-752.228) * [-751.713] (-751.865) (-753.295) (-751.242) -- 0:00:27
      564000 -- (-755.985) (-752.289) [-755.692] (-750.469) * (-752.442) (-751.302) [-750.643] (-751.294) -- 0:00:27
      564500 -- (-757.301) (-752.313) (-753.553) [-754.430] * [-751.014] (-752.240) (-752.493) (-753.246) -- 0:00:27
      565000 -- (-755.901) (-750.996) (-752.829) [-753.904] * [-750.505] (-752.151) (-751.202) (-754.115) -- 0:00:26

      Average standard deviation of split frequencies: 0.010827

      565500 -- (-752.699) (-756.402) (-750.858) [-753.435] * [-752.960] (-753.293) (-757.073) (-753.887) -- 0:00:26
      566000 -- [-751.882] (-753.639) (-752.823) (-754.745) * (-755.507) (-754.015) (-752.611) [-753.977] -- 0:00:26
      566500 -- (-755.071) [-753.361] (-757.252) (-752.961) * (-753.975) (-752.729) [-751.729] (-752.263) -- 0:00:26
      567000 -- (-753.925) (-753.173) (-751.260) [-751.219] * [-754.586] (-751.288) (-750.773) (-751.921) -- 0:00:26
      567500 -- [-753.598] (-751.726) (-751.937) (-753.577) * (-756.310) (-751.162) (-754.291) [-760.057] -- 0:00:26
      568000 -- (-754.672) (-753.293) [-751.088] (-750.524) * (-756.118) (-753.160) [-752.180] (-751.660) -- 0:00:26
      568500 -- (-752.593) (-752.302) (-753.342) [-753.009] * (-752.439) (-751.246) (-750.381) [-752.119] -- 0:00:26
      569000 -- (-751.177) (-752.278) [-752.394] (-752.211) * [-754.165] (-751.306) (-751.114) (-751.656) -- 0:00:26
      569500 -- (-755.759) (-750.891) (-754.420) [-750.964] * (-753.905) [-752.395] (-752.453) (-751.604) -- 0:00:26
      570000 -- (-752.550) (-754.597) [-754.400] (-752.519) * (-755.007) (-753.020) [-762.778] (-752.884) -- 0:00:27

      Average standard deviation of split frequencies: 0.011152

      570500 -- (-753.431) (-751.753) (-751.324) [-751.128] * (-753.678) (-750.681) (-753.719) [-752.506] -- 0:00:27
      571000 -- (-758.387) [-750.931] (-753.751) (-751.740) * [-751.510] (-750.862) (-754.776) (-752.167) -- 0:00:27
      571500 -- (-753.257) (-750.672) (-751.763) [-752.018] * (-751.090) [-752.400] (-754.648) (-752.860) -- 0:00:26
      572000 -- (-751.749) (-751.642) (-752.369) [-757.346] * (-751.669) (-752.489) (-755.076) [-750.493] -- 0:00:26
      572500 -- (-752.493) (-752.225) (-751.289) [-750.708] * (-751.678) (-753.339) (-752.819) [-754.869] -- 0:00:26
      573000 -- (-753.536) (-753.342) (-751.229) [-753.433] * (-751.705) (-754.278) [-751.958] (-752.554) -- 0:00:26
      573500 -- (-751.517) [-752.883] (-753.723) (-753.585) * (-756.000) (-752.139) [-751.648] (-751.891) -- 0:00:26
      574000 -- (-753.539) (-752.087) (-750.822) [-755.534] * [-755.401] (-753.046) (-753.783) (-754.723) -- 0:00:26
      574500 -- (-750.460) (-750.592) [-755.383] (-758.300) * (-754.388) (-751.456) (-752.472) [-752.863] -- 0:00:26
      575000 -- (-751.909) [-751.826] (-752.560) (-755.753) * (-755.056) (-750.715) [-754.944] (-752.102) -- 0:00:26

      Average standard deviation of split frequencies: 0.010639

      575500 -- [-753.249] (-752.425) (-751.235) (-754.774) * (-750.583) [-750.450] (-755.406) (-751.947) -- 0:00:26
      576000 -- [-755.007] (-752.431) (-751.493) (-753.192) * (-750.894) (-751.568) [-751.143] (-751.274) -- 0:00:26
      576500 -- (-752.189) (-753.217) [-751.179] (-754.955) * [-754.359] (-750.540) (-751.196) (-753.485) -- 0:00:26
      577000 -- (-757.424) (-753.752) [-750.613] (-752.630) * (-756.656) [-752.445] (-751.972) (-754.619) -- 0:00:26
      577500 -- [-750.873] (-756.353) (-750.634) (-753.248) * [-751.241] (-754.677) (-751.254) (-751.233) -- 0:00:26
      578000 -- [-751.421] (-752.701) (-750.955) (-752.708) * (-751.827) (-753.438) [-753.593] (-751.865) -- 0:00:26
      578500 -- (-750.051) (-755.535) [-750.428] (-751.871) * (-752.781) [-752.053] (-750.464) (-751.761) -- 0:00:26
      579000 -- (-751.080) (-752.022) [-752.244] (-752.923) * (-751.442) (-752.296) [-750.589] (-752.055) -- 0:00:26
      579500 -- (-751.301) (-750.442) (-754.800) [-753.434] * [-752.489] (-753.242) (-751.627) (-753.067) -- 0:00:26
      580000 -- (-753.381) [-751.511] (-752.479) (-751.342) * [-754.334] (-753.583) (-751.971) (-753.705) -- 0:00:26

      Average standard deviation of split frequencies: 0.010808

      580500 -- [-752.558] (-751.501) (-752.061) (-759.789) * [-750.908] (-751.507) (-750.979) (-751.473) -- 0:00:26
      581000 -- [-751.679] (-753.172) (-752.951) (-759.433) * (-753.325) (-751.233) (-752.169) [-752.520] -- 0:00:25
      581500 -- (-751.191) (-755.083) (-753.366) [-753.546] * (-753.126) (-751.430) [-751.898] (-755.738) -- 0:00:25
      582000 -- [-752.713] (-753.775) (-752.003) (-752.746) * (-751.548) (-753.174) (-752.638) [-754.814] -- 0:00:25
      582500 -- (-755.314) (-754.197) [-752.531] (-752.156) * [-751.472] (-752.061) (-752.914) (-753.884) -- 0:00:25
      583000 -- [-752.858] (-752.797) (-753.000) (-755.841) * (-756.618) [-753.479] (-753.572) (-756.089) -- 0:00:25
      583500 -- (-752.043) [-756.178] (-751.606) (-754.658) * (-753.632) (-753.968) [-754.540] (-752.658) -- 0:00:25
      584000 -- [-751.701] (-750.402) (-750.930) (-754.971) * (-750.378) (-751.804) (-751.895) [-752.344] -- 0:00:25
      584500 -- (-751.491) (-752.451) [-751.456] (-754.467) * (-753.224) (-750.988) (-752.635) [-755.528] -- 0:00:25
      585000 -- (-750.539) [-751.043] (-751.203) (-751.389) * (-751.509) [-756.791] (-752.443) (-751.999) -- 0:00:26

      Average standard deviation of split frequencies: 0.010810

      585500 -- [-753.960] (-752.122) (-751.577) (-755.312) * (-752.167) (-753.987) (-750.805) [-753.623] -- 0:00:26
      586000 -- [-751.796] (-752.650) (-755.181) (-754.945) * (-751.261) [-751.230] (-755.349) (-752.637) -- 0:00:26
      586500 -- (-750.501) (-753.901) (-753.350) [-754.214] * (-754.837) (-753.379) [-752.259] (-754.501) -- 0:00:26
      587000 -- [-751.084] (-754.631) (-754.415) (-755.442) * (-750.344) (-752.800) (-752.285) [-751.259] -- 0:00:26
      587500 -- (-751.190) (-753.446) (-751.252) [-754.043] * (-751.566) (-752.153) [-756.041] (-751.006) -- 0:00:25
      588000 -- (-752.530) (-752.655) [-754.863] (-753.433) * (-750.656) (-757.208) (-750.504) [-751.696] -- 0:00:25
      588500 -- (-753.584) (-752.484) (-751.200) [-752.222] * (-752.151) (-753.996) [-751.070] (-751.402) -- 0:00:25
      589000 -- [-750.754] (-751.505) (-752.865) (-754.139) * (-751.589) (-752.923) (-753.052) [-752.197] -- 0:00:25
      589500 -- [-750.939] (-753.766) (-751.702) (-753.032) * [-753.086] (-750.977) (-751.506) (-753.823) -- 0:00:25
      590000 -- (-751.369) [-753.860] (-756.246) (-751.907) * (-751.600) [-750.372] (-752.914) (-752.109) -- 0:00:25

      Average standard deviation of split frequencies: 0.010275

      590500 -- (-751.593) [-751.935] (-755.336) (-753.433) * (-751.337) [-750.672] (-754.011) (-751.328) -- 0:00:25
      591000 -- [-753.005] (-755.406) (-755.898) (-756.090) * (-751.573) (-752.549) [-751.477] (-752.977) -- 0:00:25
      591500 -- (-751.149) (-753.009) (-753.877) [-755.503] * (-754.393) (-752.811) [-753.359] (-753.774) -- 0:00:25
      592000 -- (-752.818) (-753.736) [-751.993] (-758.171) * [-753.871] (-753.430) (-751.745) (-753.825) -- 0:00:25
      592500 -- (-754.918) (-755.156) [-752.667] (-751.058) * (-757.110) (-754.923) [-750.268] (-755.973) -- 0:00:25
      593000 -- (-753.400) (-751.789) [-752.843] (-752.889) * (-757.956) [-755.897] (-751.456) (-754.767) -- 0:00:25
      593500 -- (-751.423) (-751.567) (-751.828) [-751.379] * (-751.692) (-755.285) (-753.015) [-753.938] -- 0:00:25
      594000 -- [-755.691] (-751.177) (-752.798) (-753.148) * (-752.432) [-755.806] (-754.168) (-751.836) -- 0:00:25
      594500 -- (-753.192) [-752.232] (-750.670) (-756.013) * [-750.650] (-752.775) (-756.456) (-751.094) -- 0:00:25
      595000 -- [-752.483] (-754.884) (-751.286) (-755.698) * (-754.395) (-754.256) (-752.062) [-753.626] -- 0:00:25

      Average standard deviation of split frequencies: 0.010085

      595500 -- (-753.955) (-755.912) [-751.571] (-750.755) * (-753.354) (-750.967) [-752.613] (-751.946) -- 0:00:25
      596000 -- (-755.987) [-750.705] (-761.936) (-752.708) * [-753.111] (-755.536) (-753.638) (-752.386) -- 0:00:25
      596500 -- [-753.079] (-754.309) (-754.581) (-754.032) * (-751.883) (-751.154) [-750.774] (-751.366) -- 0:00:25
      597000 -- (-758.462) [-754.064] (-751.301) (-754.718) * (-752.458) [-751.725] (-752.620) (-751.066) -- 0:00:24
      597500 -- (-752.858) [-752.033] (-756.657) (-752.053) * [-753.007] (-750.508) (-751.492) (-751.405) -- 0:00:24
      598000 -- (-760.257) (-753.300) (-752.436) [-750.904] * (-755.086) (-755.588) (-751.707) [-753.622] -- 0:00:24
      598500 -- [-751.289] (-751.475) (-754.831) (-755.355) * (-757.972) [-751.397] (-754.632) (-755.285) -- 0:00:24
      599000 -- (-750.960) [-755.196] (-751.623) (-757.221) * (-752.329) (-751.235) [-757.736] (-754.972) -- 0:00:24
      599500 -- (-754.214) [-751.442] (-751.891) (-753.641) * (-754.286) [-751.262] (-754.264) (-754.392) -- 0:00:24
      600000 -- [-750.296] (-755.868) (-752.245) (-752.424) * (-751.237) (-751.247) (-752.342) [-751.579] -- 0:00:25

      Average standard deviation of split frequencies: 0.009810

      600500 -- (-751.407) [-752.093] (-752.284) (-751.450) * (-752.617) (-754.287) [-752.015] (-752.036) -- 0:00:25
      601000 -- [-751.407] (-753.075) (-752.077) (-752.679) * (-751.517) (-753.884) (-755.115) [-751.083] -- 0:00:25
      601500 -- (-750.457) [-752.632] (-752.627) (-751.488) * (-754.354) (-754.183) [-752.648] (-751.183) -- 0:00:25
      602000 -- (-750.292) (-753.209) [-751.750] (-757.823) * (-750.890) (-752.608) (-755.531) [-753.698] -- 0:00:25
      602500 -- (-750.521) (-751.665) [-750.676] (-751.536) * (-753.074) [-753.047] (-752.294) (-755.387) -- 0:00:25
      603000 -- [-751.125] (-752.381) (-751.893) (-752.659) * [-754.820] (-752.397) (-750.663) (-753.027) -- 0:00:25
      603500 -- [-752.950] (-753.329) (-752.179) (-754.613) * (-753.603) (-750.982) [-750.684] (-753.822) -- 0:00:24
      604000 -- (-756.211) (-751.352) [-753.188] (-753.206) * [-751.189] (-750.859) (-754.706) (-755.758) -- 0:00:24
      604500 -- [-753.884] (-752.308) (-753.813) (-758.620) * (-758.979) [-757.393] (-752.955) (-753.481) -- 0:00:24
      605000 -- [-751.527] (-752.704) (-753.983) (-759.020) * (-754.774) (-756.910) (-757.820) [-757.895] -- 0:00:24

      Average standard deviation of split frequencies: 0.009432

      605500 -- [-750.759] (-758.302) (-757.496) (-753.019) * [-751.906] (-752.114) (-751.269) (-756.996) -- 0:00:24
      606000 -- (-750.524) (-756.716) [-751.548] (-751.449) * [-754.100] (-753.694) (-752.762) (-751.744) -- 0:00:24
      606500 -- (-754.511) (-753.966) (-752.436) [-751.927] * [-753.533] (-756.216) (-751.427) (-753.300) -- 0:00:24
      607000 -- (-752.126) (-752.007) (-752.476) [-751.633] * (-753.221) [-756.424] (-752.170) (-752.587) -- 0:00:24
      607500 -- (-753.365) (-751.417) (-752.281) [-752.424] * (-750.585) (-755.444) [-755.810] (-753.015) -- 0:00:24
      608000 -- [-752.742] (-751.812) (-751.727) (-754.309) * (-751.136) (-753.745) [-754.162] (-752.502) -- 0:00:24
      608500 -- (-753.282) [-752.663] (-754.061) (-753.313) * (-755.139) (-751.338) (-753.046) [-752.847] -- 0:00:24
      609000 -- [-751.801] (-752.078) (-752.150) (-751.756) * (-753.123) [-754.210] (-754.963) (-750.816) -- 0:00:24
      609500 -- (-752.120) (-752.615) [-753.887] (-751.079) * [-750.410] (-759.568) (-751.885) (-751.993) -- 0:00:24
      610000 -- (-751.126) (-752.091) (-751.956) [-751.998] * (-755.439) [-754.539] (-750.412) (-751.106) -- 0:00:24

      Average standard deviation of split frequencies: 0.008974

      610500 -- (-754.961) [-751.334] (-752.493) (-754.978) * (-751.096) [-752.030] (-750.727) (-750.521) -- 0:00:24
      611000 -- (-755.132) (-752.717) [-755.201] (-751.367) * (-755.108) [-752.049] (-751.349) (-751.690) -- 0:00:24
      611500 -- (-754.194) (-752.487) (-754.944) [-751.036] * [-754.074] (-751.774) (-752.146) (-750.697) -- 0:00:24
      612000 -- [-755.255] (-751.894) (-753.482) (-750.704) * (-755.301) (-753.568) [-751.151] (-754.334) -- 0:00:24
      612500 -- (-752.995) [-751.655] (-754.071) (-753.591) * (-753.989) (-753.297) [-755.525] (-751.661) -- 0:00:24
      613000 -- (-753.425) (-751.815) (-753.444) [-750.896] * (-752.810) (-753.152) (-760.343) [-751.909] -- 0:00:23
      613500 -- (-759.614) [-753.407] (-752.500) (-752.561) * (-753.538) (-754.831) [-751.409] (-750.378) -- 0:00:24
      614000 -- [-751.661] (-753.090) (-752.774) (-751.427) * [-751.340] (-752.899) (-751.278) (-752.166) -- 0:00:24
      614500 -- (-751.375) (-752.177) (-751.170) [-752.206] * (-757.342) (-752.118) (-752.957) [-752.677] -- 0:00:24
      615000 -- (-750.940) (-750.919) (-752.657) [-752.222] * (-751.030) [-752.588] (-753.550) (-753.313) -- 0:00:24

      Average standard deviation of split frequencies: 0.009279

      615500 -- (-751.216) (-752.713) (-752.363) [-754.342] * (-750.868) (-755.546) (-751.729) [-751.786] -- 0:00:24
      616000 -- [-753.959] (-752.675) (-750.721) (-751.929) * [-751.476] (-752.178) (-753.971) (-754.910) -- 0:00:24
      616500 -- (-754.062) [-752.939] (-751.497) (-754.292) * [-751.608] (-751.387) (-753.540) (-750.451) -- 0:00:24
      617000 -- (-753.425) (-751.943) [-753.119] (-751.512) * (-753.261) [-755.916] (-750.757) (-750.714) -- 0:00:24
      617500 -- (-754.182) (-752.415) (-752.089) [-751.385] * (-754.366) [-752.251] (-751.473) (-754.385) -- 0:00:24
      618000 -- [-751.497] (-752.330) (-752.973) (-754.107) * (-753.732) [-750.506] (-752.928) (-752.931) -- 0:00:24
      618500 -- [-751.679] (-752.258) (-753.130) (-753.492) * (-753.874) (-751.747) (-753.119) [-750.666] -- 0:00:24
      619000 -- [-752.865] (-751.832) (-755.064) (-751.507) * (-752.440) [-752.304] (-753.983) (-750.731) -- 0:00:24
      619500 -- [-752.690] (-750.572) (-752.607) (-750.825) * (-750.980) [-751.049] (-750.436) (-751.121) -- 0:00:23
      620000 -- (-753.358) (-752.533) (-750.782) [-751.302] * (-752.587) (-754.003) (-751.327) [-752.260] -- 0:00:23

      Average standard deviation of split frequencies: 0.009162

      620500 -- (-752.260) (-753.648) (-756.975) [-751.052] * (-752.930) [-753.297] (-751.320) (-750.955) -- 0:00:23
      621000 -- (-751.469) (-751.348) [-752.220] (-751.919) * (-751.561) [-752.719] (-754.174) (-751.456) -- 0:00:23
      621500 -- [-751.044] (-751.647) (-751.397) (-751.822) * (-753.006) (-753.105) (-752.871) [-753.760] -- 0:00:23
      622000 -- (-751.004) (-751.461) (-753.970) [-751.513] * [-752.494] (-755.241) (-753.566) (-754.116) -- 0:00:23
      622500 -- (-754.536) [-751.111] (-752.084) (-754.948) * [-751.492] (-751.784) (-751.948) (-752.056) -- 0:00:23
      623000 -- (-750.951) (-754.164) (-752.771) [-751.748] * (-752.317) (-754.134) [-750.946] (-751.091) -- 0:00:23
      623500 -- [-751.998] (-752.670) (-752.557) (-756.009) * [-752.425] (-756.806) (-754.555) (-751.984) -- 0:00:23
      624000 -- (-751.391) (-755.778) [-752.972] (-753.708) * (-755.470) [-755.376] (-752.359) (-754.429) -- 0:00:23
      624500 -- [-753.671] (-761.670) (-752.021) (-752.739) * (-751.729) [-751.986] (-751.584) (-754.085) -- 0:00:23
      625000 -- (-750.973) (-762.293) [-750.657] (-753.297) * [-754.186] (-752.164) (-751.397) (-751.474) -- 0:00:23

      Average standard deviation of split frequencies: 0.008989

      625500 -- (-751.132) [-753.060] (-752.826) (-753.484) * (-750.334) [-753.095] (-756.066) (-753.708) -- 0:00:23
      626000 -- (-751.221) (-753.418) (-751.924) [-752.017] * (-751.526) [-751.684] (-754.844) (-755.995) -- 0:00:23
      626500 -- (-752.966) [-750.889] (-752.702) (-751.881) * (-750.685) [-751.826] (-754.418) (-754.664) -- 0:00:23
      627000 -- (-757.160) [-750.790] (-756.773) (-753.830) * [-750.689] (-754.598) (-750.750) (-755.135) -- 0:00:23
      627500 -- (-751.953) (-751.059) (-753.807) [-753.621] * [-750.282] (-752.506) (-751.687) (-757.242) -- 0:00:23
      628000 -- [-754.161] (-755.595) (-753.624) (-753.577) * (-750.708) [-752.354] (-756.315) (-757.318) -- 0:00:23
      628500 -- (-751.306) (-752.649) (-751.754) [-751.084] * (-752.758) [-752.098] (-756.577) (-756.321) -- 0:00:23
      629000 -- [-750.815] (-750.543) (-751.837) (-750.781) * (-753.983) (-755.004) [-751.678] (-750.809) -- 0:00:23
      629500 -- (-750.889) [-751.476] (-752.084) (-750.876) * (-751.683) (-754.486) [-756.308] (-750.738) -- 0:00:23
      630000 -- (-750.888) (-754.131) (-751.690) [-751.485] * (-751.074) (-754.699) [-751.448] (-754.007) -- 0:00:23

      Average standard deviation of split frequencies: 0.008409

      630500 -- (-751.135) (-761.821) (-751.742) [-752.070] * [-750.784] (-750.914) (-756.228) (-752.205) -- 0:00:23
      631000 -- [-751.001] (-752.885) (-753.349) (-756.851) * (-750.885) (-756.667) (-754.973) [-752.583] -- 0:00:23
      631500 -- (-751.409) (-753.505) (-758.662) [-754.581] * (-753.608) [-751.079] (-754.629) (-753.538) -- 0:00:23
      632000 -- (-754.726) [-752.572] (-753.404) (-750.818) * (-751.193) [-752.082] (-752.927) (-754.322) -- 0:00:23
      632500 -- (-753.273) (-752.387) [-752.558] (-757.150) * [-751.369] (-756.657) (-752.961) (-753.654) -- 0:00:23
      633000 -- (-754.527) (-755.300) (-754.273) [-754.035] * (-751.978) [-753.536] (-754.467) (-755.537) -- 0:00:23
      633500 -- (-751.668) [-753.283] (-753.533) (-754.357) * [-752.291] (-752.522) (-757.383) (-752.702) -- 0:00:23
      634000 -- [-751.162] (-754.687) (-751.988) (-751.812) * (-751.594) [-750.978] (-755.951) (-752.584) -- 0:00:23
      634500 -- (-750.739) (-757.700) [-752.460] (-752.097) * (-750.908) [-751.530] (-751.646) (-755.578) -- 0:00:23
      635000 -- (-754.845) [-758.241] (-752.298) (-751.953) * (-754.147) (-755.505) (-753.354) [-753.514] -- 0:00:22

      Average standard deviation of split frequencies: 0.009033

      635500 -- (-752.228) [-752.816] (-752.254) (-759.157) * [-752.424] (-752.086) (-753.694) (-752.093) -- 0:00:22
      636000 -- [-751.734] (-753.027) (-751.308) (-750.875) * (-750.682) (-752.309) [-752.780] (-753.113) -- 0:00:22
      636500 -- (-752.776) [-752.406] (-755.101) (-752.853) * (-759.078) (-752.745) (-754.358) [-751.844] -- 0:00:22
      637000 -- (-751.814) (-754.602) [-751.065] (-751.647) * (-751.619) (-753.987) (-752.413) [-751.571] -- 0:00:22
      637500 -- (-751.486) (-753.238) [-750.480] (-755.705) * (-756.731) (-751.176) [-752.951] (-752.669) -- 0:00:22
      638000 -- (-753.048) (-753.596) [-753.375] (-751.193) * [-753.242] (-752.596) (-753.015) (-754.158) -- 0:00:22
      638500 -- (-756.043) [-751.756] (-752.203) (-750.779) * (-752.089) (-752.739) [-751.163] (-752.836) -- 0:00:22
      639000 -- (-755.628) (-752.881) [-751.911] (-752.972) * (-750.444) (-752.784) (-750.830) [-751.006] -- 0:00:22
      639500 -- (-756.863) [-752.336] (-751.350) (-753.637) * (-750.418) (-752.180) (-751.397) [-754.088] -- 0:00:22
      640000 -- (-752.778) (-753.244) (-754.829) [-755.967] * (-751.964) [-752.090] (-753.441) (-754.399) -- 0:00:22

      Average standard deviation of split frequencies: 0.008462

      640500 -- (-752.759) (-752.820) [-753.201] (-751.126) * (-751.916) (-753.153) [-752.112] (-751.702) -- 0:00:22
      641000 -- [-753.962] (-755.271) (-756.825) (-751.543) * (-754.083) (-753.567) [-751.727] (-751.399) -- 0:00:22
      641500 -- (-752.339) [-753.414] (-752.021) (-752.161) * (-752.072) (-754.242) [-751.112] (-752.814) -- 0:00:22
      642000 -- (-755.771) [-752.446] (-753.049) (-750.577) * (-754.538) (-750.648) (-754.769) [-752.646] -- 0:00:22
      642500 -- (-751.528) (-759.557) [-750.397] (-755.621) * (-751.147) [-750.657] (-750.734) (-752.103) -- 0:00:22
      643000 -- (-753.435) (-752.414) [-751.482] (-751.318) * (-753.796) [-755.185] (-751.055) (-750.250) -- 0:00:22
      643500 -- (-753.439) [-752.338] (-753.373) (-752.332) * (-753.544) [-752.122] (-753.020) (-753.675) -- 0:00:22
      644000 -- (-754.114) (-751.345) (-754.801) [-752.258] * (-756.756) (-753.934) [-755.379] (-750.931) -- 0:00:22
      644500 -- [-751.216] (-753.545) (-755.519) (-751.630) * (-753.130) (-753.709) (-754.646) [-755.305] -- 0:00:22
      645000 -- [-751.523] (-754.036) (-753.469) (-752.965) * [-752.874] (-753.120) (-751.356) (-751.730) -- 0:00:22

      Average standard deviation of split frequencies: 0.008209

      645500 -- (-755.169) (-751.953) [-751.619] (-750.556) * (-759.105) (-752.953) (-752.407) [-750.643] -- 0:00:22
      646000 -- (-753.845) (-751.133) (-750.122) [-751.606] * (-755.165) [-752.986] (-753.753) (-754.478) -- 0:00:22
      646500 -- (-751.691) (-752.544) (-752.284) [-752.091] * [-752.004] (-751.931) (-751.681) (-755.068) -- 0:00:22
      647000 -- (-756.581) (-752.504) (-753.101) [-751.826] * (-751.935) (-751.203) (-755.813) [-752.111] -- 0:00:22
      647500 -- (-750.289) (-752.066) (-752.270) [-755.769] * (-753.665) (-751.369) (-760.406) [-751.317] -- 0:00:22
      648000 -- [-752.095] (-752.199) (-753.332) (-753.861) * (-753.217) (-755.509) (-751.355) [-751.317] -- 0:00:22
      648500 -- [-752.459] (-752.738) (-754.608) (-755.726) * [-755.992] (-751.262) (-752.565) (-754.594) -- 0:00:22
      649000 -- (-751.157) (-755.540) (-750.899) [-756.457] * (-760.450) (-753.292) (-752.441) [-754.822] -- 0:00:22
      649500 -- (-752.414) (-753.485) [-754.676] (-752.413) * (-755.928) (-753.027) (-751.525) [-751.047] -- 0:00:22
      650000 -- [-751.953] (-752.731) (-751.270) (-756.447) * [-752.110] (-751.866) (-752.915) (-751.047) -- 0:00:22

      Average standard deviation of split frequencies: 0.008830

      650500 -- (-758.247) (-752.601) [-752.521] (-752.317) * (-750.929) [-752.979] (-753.364) (-752.195) -- 0:00:22
      651000 -- (-752.514) [-753.118] (-753.158) (-751.488) * (-750.791) (-753.504) [-753.871] (-752.569) -- 0:00:21
      651500 -- [-755.387] (-751.859) (-754.981) (-752.730) * (-751.884) [-752.161] (-750.545) (-751.832) -- 0:00:21
      652000 -- [-757.411] (-753.936) (-754.880) (-754.268) * (-754.539) [-750.367] (-750.803) (-751.990) -- 0:00:21
      652500 -- (-752.064) [-753.015] (-754.063) (-750.568) * (-751.515) (-752.015) (-751.883) [-753.133] -- 0:00:21
      653000 -- (-752.795) (-754.236) (-752.827) [-752.429] * (-750.366) (-751.113) (-752.029) [-750.205] -- 0:00:21
      653500 -- (-754.490) (-755.908) [-751.008] (-752.676) * [-751.183] (-750.805) (-754.888) (-754.036) -- 0:00:21
      654000 -- (-751.310) (-754.509) (-752.883) [-753.902] * (-751.765) (-754.958) [-755.105] (-751.690) -- 0:00:21
      654500 -- (-751.212) (-752.150) [-751.150] (-752.364) * (-751.290) [-753.609] (-753.569) (-756.567) -- 0:00:21
      655000 -- (-754.971) (-753.597) [-751.385] (-756.364) * (-755.655) (-754.159) [-753.780] (-755.137) -- 0:00:21

      Average standard deviation of split frequencies: 0.008803

      655500 -- (-753.149) (-751.357) [-751.879] (-752.622) * (-750.669) (-752.395) [-754.332] (-753.271) -- 0:00:21
      656000 -- [-753.655] (-753.388) (-753.309) (-751.824) * (-750.722) (-751.185) [-755.855] (-752.423) -- 0:00:21
      656500 -- (-754.482) (-751.556) [-756.132] (-752.538) * [-750.273] (-750.935) (-752.861) (-754.642) -- 0:00:21
      657000 -- [-753.166] (-753.228) (-752.775) (-751.598) * (-750.255) [-750.907] (-753.045) (-753.879) -- 0:00:21
      657500 -- (-752.738) (-754.413) [-752.794] (-750.603) * (-750.191) (-750.725) [-753.702] (-750.301) -- 0:00:21
      658000 -- (-752.619) (-755.094) [-753.828] (-750.796) * [-750.160] (-750.693) (-752.755) (-751.176) -- 0:00:21
      658500 -- [-752.276] (-751.562) (-750.637) (-751.576) * (-752.760) [-753.081] (-754.552) (-751.404) -- 0:00:21
      659000 -- (-753.220) (-755.263) (-751.353) [-755.199] * (-752.561) (-754.109) [-751.770] (-756.607) -- 0:00:21
      659500 -- (-753.057) (-754.134) [-752.475] (-758.849) * [-753.029] (-750.917) (-750.901) (-755.975) -- 0:00:21
      660000 -- (-752.344) [-753.250] (-753.733) (-754.418) * [-754.357] (-750.780) (-752.353) (-752.843) -- 0:00:21

      Average standard deviation of split frequencies: 0.008919

      660500 -- (-752.999) (-751.787) (-755.324) [-751.484] * (-753.482) (-752.040) (-751.379) [-750.898] -- 0:00:21
      661000 -- (-754.324) [-750.851] (-756.871) (-752.123) * [-753.911] (-752.938) (-751.720) (-752.446) -- 0:00:21
      661500 -- (-752.641) (-751.322) (-750.885) [-750.905] * (-757.214) (-751.835) (-755.245) [-754.888] -- 0:00:21
      662000 -- (-752.637) (-750.606) (-751.873) [-752.220] * [-751.701] (-752.132) (-752.676) (-753.875) -- 0:00:21
      662500 -- (-753.275) (-751.995) [-752.561] (-754.843) * (-752.246) (-750.596) [-750.712] (-751.866) -- 0:00:21
      663000 -- (-751.603) (-751.971) (-751.882) [-751.698] * (-752.110) [-753.272] (-750.809) (-751.435) -- 0:00:21
      663500 -- (-753.717) (-751.535) [-751.431] (-751.573) * (-752.331) [-753.985] (-751.886) (-753.040) -- 0:00:21
      664000 -- (-752.324) (-752.296) (-752.647) [-753.059] * (-750.797) (-753.514) (-752.502) [-754.540] -- 0:00:21
      664500 -- [-752.635] (-752.322) (-751.070) (-752.958) * (-753.379) (-751.196) [-752.217] (-752.402) -- 0:00:21
      665000 -- [-753.795] (-753.391) (-751.181) (-750.251) * [-750.905] (-751.438) (-751.681) (-752.029) -- 0:00:21

      Average standard deviation of split frequencies: 0.008892

      665500 -- (-756.936) (-756.227) [-752.663] (-752.666) * (-751.320) (-761.960) [-751.177] (-751.788) -- 0:00:21
      666000 -- (-752.915) [-752.226] (-752.936) (-752.915) * [-750.738] (-754.262) (-751.411) (-752.904) -- 0:00:21
      666500 -- (-753.167) [-752.391] (-751.972) (-752.557) * (-752.838) [-751.732] (-757.561) (-752.461) -- 0:00:21
      667000 -- (-753.221) (-753.309) (-753.766) [-758.288] * [-753.685] (-751.139) (-752.942) (-753.208) -- 0:00:20
      667500 -- (-756.678) [-752.048] (-752.133) (-752.475) * (-753.024) [-750.307] (-751.933) (-753.273) -- 0:00:20
      668000 -- (-752.362) (-751.043) [-750.623] (-756.845) * (-753.634) [-753.183] (-751.869) (-752.267) -- 0:00:20
      668500 -- (-752.247) (-751.563) [-752.741] (-752.514) * (-753.461) [-754.963] (-751.531) (-752.276) -- 0:00:20
      669000 -- (-752.162) (-755.813) (-752.759) [-752.358] * (-754.588) (-755.938) (-751.394) [-750.845] -- 0:00:20
      669500 -- (-751.268) (-753.207) (-753.911) [-751.861] * (-755.164) (-757.676) [-754.899] (-753.458) -- 0:00:20
      670000 -- [-751.025] (-754.429) (-752.938) (-751.946) * (-755.889) [-752.594] (-756.656) (-752.188) -- 0:00:20

      Average standard deviation of split frequencies: 0.008830

      670500 -- (-752.921) [-751.880] (-752.250) (-752.153) * (-751.478) (-752.177) (-752.109) [-752.693] -- 0:00:20
      671000 -- (-752.143) (-750.799) [-751.749] (-752.194) * [-751.452] (-757.427) (-752.872) (-751.587) -- 0:00:20
      671500 -- (-750.939) (-752.293) (-751.210) [-751.874] * (-757.535) (-753.922) (-752.520) [-750.722] -- 0:00:20
      672000 -- [-751.317] (-752.750) (-750.857) (-751.843) * (-757.845) [-752.221] (-751.683) (-753.028) -- 0:00:20
      672500 -- (-750.899) [-752.360] (-751.374) (-750.930) * [-751.881] (-750.627) (-751.929) (-755.459) -- 0:00:20
      673000 -- (-751.007) (-751.374) [-751.396] (-752.096) * [-750.907] (-751.140) (-752.543) (-751.635) -- 0:00:20
      673500 -- (-750.981) (-751.571) (-750.854) [-753.091] * (-751.338) (-750.736) (-753.911) [-751.741] -- 0:00:20
      674000 -- (-750.722) (-751.461) [-751.698] (-751.595) * [-752.950] (-750.404) (-750.990) (-753.257) -- 0:00:20
      674500 -- (-752.625) [-753.332] (-751.196) (-753.164) * (-752.005) [-753.054] (-750.665) (-756.195) -- 0:00:20
      675000 -- (-753.853) [-752.461] (-751.891) (-752.182) * [-753.582] (-752.451) (-751.632) (-756.025) -- 0:00:20

      Average standard deviation of split frequencies: 0.008848

      675500 -- (-753.522) (-752.750) (-750.814) [-752.221] * [-753.269] (-753.908) (-751.889) (-752.077) -- 0:00:20
      676000 -- (-754.150) (-751.235) (-752.310) [-753.223] * (-751.310) (-752.925) (-752.137) [-751.894] -- 0:00:20
      676500 -- (-753.218) (-753.077) (-752.191) [-751.954] * [-752.373] (-752.504) (-750.847) (-750.785) -- 0:00:20
      677000 -- (-754.240) (-751.278) (-754.004) [-752.038] * (-750.582) (-752.490) (-754.118) [-750.247] -- 0:00:20
      677500 -- [-751.742] (-751.877) (-750.657) (-752.032) * (-759.935) [-753.974] (-753.848) (-753.398) -- 0:00:20
      678000 -- (-750.757) (-750.754) [-752.206] (-757.381) * [-753.040] (-757.023) (-757.453) (-752.692) -- 0:00:20
      678500 -- [-752.755] (-750.562) (-757.413) (-756.325) * (-751.811) [-753.231] (-753.178) (-750.407) -- 0:00:20
      679000 -- (-754.434) (-752.559) (-756.157) [-753.917] * (-751.641) (-752.297) (-751.793) [-752.072] -- 0:00:20
      679500 -- [-755.476] (-753.014) (-753.726) (-755.903) * (-750.756) (-752.345) [-752.156] (-752.014) -- 0:00:20
      680000 -- (-754.674) (-755.784) (-752.070) [-752.519] * (-751.541) (-750.548) [-751.390] (-752.015) -- 0:00:20

      Average standard deviation of split frequencies: 0.008960

      680500 -- (-757.385) (-760.020) [-750.708] (-752.587) * (-752.561) (-752.063) (-753.047) [-750.988] -- 0:00:20
      681000 -- (-754.301) [-750.255] (-752.288) (-753.295) * (-753.175) [-750.836] (-754.671) (-752.731) -- 0:00:20
      681500 -- (-750.776) (-753.431) (-752.517) [-754.195] * [-753.486] (-752.592) (-752.289) (-752.190) -- 0:00:20
      682000 -- (-752.442) [-752.862] (-754.507) (-754.181) * (-752.389) (-752.240) (-750.376) [-754.635] -- 0:00:20
      682500 -- (-751.201) [-751.033] (-754.616) (-753.521) * (-751.807) (-752.311) [-751.165] (-752.573) -- 0:00:20
      683000 -- (-758.544) (-753.232) (-751.146) [-753.023] * (-753.592) [-750.152] (-751.124) (-753.153) -- 0:00:19
      683500 -- [-752.243] (-755.355) (-752.981) (-750.988) * (-753.382) (-757.006) (-751.611) [-752.136] -- 0:00:19
      684000 -- [-751.049] (-755.496) (-752.698) (-752.351) * (-752.120) [-751.434] (-752.578) (-753.086) -- 0:00:19
      684500 -- (-751.866) [-752.895] (-751.367) (-756.186) * [-751.182] (-750.969) (-750.921) (-753.576) -- 0:00:19
      685000 -- (-751.016) (-752.040) [-754.466] (-755.399) * (-751.244) (-750.270) [-750.889] (-753.804) -- 0:00:19

      Average standard deviation of split frequencies: 0.009234

      685500 -- (-753.683) [-755.850] (-751.913) (-750.734) * (-751.071) (-753.128) (-753.029) [-752.090] -- 0:00:19
      686000 -- (-751.290) [-751.557] (-758.393) (-750.977) * (-750.912) (-750.386) (-753.171) [-751.349] -- 0:00:19
      686500 -- (-753.958) (-755.145) [-756.660] (-753.904) * [-751.744] (-752.422) (-753.911) (-752.472) -- 0:00:19
      687000 -- (-753.338) [-752.706] (-751.352) (-754.261) * (-752.376) (-753.405) (-751.274) [-751.975] -- 0:00:19
      687500 -- (-753.847) (-754.805) [-753.643] (-755.168) * (-753.036) [-751.761] (-753.012) (-751.541) -- 0:00:19
      688000 -- (-751.377) (-752.916) (-751.336) [-752.182] * [-753.120] (-751.890) (-753.092) (-753.098) -- 0:00:19
      688500 -- (-752.450) [-752.280] (-751.592) (-751.691) * [-752.765] (-753.332) (-750.602) (-750.541) -- 0:00:19
      689000 -- (-754.099) (-753.321) (-752.437) [-755.647] * (-751.088) (-754.576) [-750.686] (-751.425) -- 0:00:19
      689500 -- (-754.553) [-751.824] (-753.344) (-750.769) * (-750.246) (-753.897) [-751.345] (-751.201) -- 0:00:19
      690000 -- (-755.146) (-756.732) (-755.471) [-751.670] * [-750.239] (-755.974) (-753.629) (-751.759) -- 0:00:19

      Average standard deviation of split frequencies: 0.009683

      690500 -- [-753.022] (-753.337) (-756.511) (-754.543) * [-750.321] (-754.031) (-754.332) (-752.076) -- 0:00:19
      691000 -- (-752.149) (-754.599) (-753.521) [-753.602] * (-751.759) (-756.102) (-751.342) [-754.020] -- 0:00:19
      691500 -- (-755.012) [-752.049] (-754.488) (-751.593) * (-753.281) (-754.461) [-751.938] (-751.512) -- 0:00:19
      692000 -- (-752.098) [-753.968] (-754.465) (-753.049) * (-751.173) (-755.230) (-750.533) [-750.842] -- 0:00:19
      692500 -- (-754.586) (-756.492) (-750.774) [-751.975] * (-751.196) [-753.203] (-751.253) (-751.329) -- 0:00:19
      693000 -- (-752.496) (-751.044) [-750.285] (-750.855) * (-755.053) [-751.707] (-751.458) (-752.040) -- 0:00:19
      693500 -- (-753.609) (-751.303) [-755.842] (-751.697) * (-755.079) [-751.765] (-755.241) (-751.398) -- 0:00:19
      694000 -- [-751.573] (-753.783) (-750.437) (-752.086) * (-752.785) (-751.472) [-752.384] (-751.894) -- 0:00:19
      694500 -- (-751.970) (-755.406) [-753.036] (-758.111) * (-751.681) (-754.136) [-752.573] (-756.915) -- 0:00:19
      695000 -- (-752.151) (-752.202) [-754.868] (-759.679) * (-751.891) (-750.706) (-751.711) [-754.920] -- 0:00:19

      Average standard deviation of split frequencies: 0.009779

      695500 -- (-754.222) [-751.253] (-752.831) (-755.748) * (-751.766) [-752.148] (-751.589) (-757.461) -- 0:00:19
      696000 -- (-754.990) (-757.839) [-755.668] (-751.957) * [-751.300] (-752.789) (-750.764) (-750.351) -- 0:00:19
      696500 -- [-754.828] (-752.975) (-753.149) (-754.165) * [-754.119] (-752.053) (-752.080) (-751.022) -- 0:00:19
      697000 -- (-752.790) [-756.159] (-752.365) (-754.590) * (-751.927) (-754.912) [-751.865] (-752.419) -- 0:00:19
      697500 -- (-750.198) [-750.969] (-753.614) (-751.469) * (-750.899) (-753.870) [-750.955] (-750.889) -- 0:00:19
      698000 -- (-751.790) [-750.304] (-753.748) (-752.482) * (-752.845) [-753.633] (-752.800) (-751.724) -- 0:00:19
      698500 -- (-751.274) (-750.724) (-751.918) [-751.622] * (-751.353) (-754.418) [-751.548] (-752.668) -- 0:00:18
      699000 -- (-755.981) (-755.450) (-751.922) [-751.566] * (-753.475) (-750.959) (-753.659) [-754.784] -- 0:00:18
      699500 -- [-752.383] (-752.946) (-751.347) (-752.944) * (-757.944) [-750.114] (-756.682) (-752.117) -- 0:00:18
      700000 -- (-750.356) (-753.010) (-753.591) [-752.048] * (-752.036) [-750.359] (-758.121) (-754.381) -- 0:00:18

      Average standard deviation of split frequencies: 0.009419

      700500 -- (-752.630) (-751.803) [-750.352] (-755.322) * [-751.405] (-750.369) (-752.641) (-755.686) -- 0:00:18
      701000 -- (-751.937) (-750.199) (-750.695) [-751.806] * (-751.774) (-755.500) (-755.955) [-754.016] -- 0:00:18
      701500 -- [-752.344] (-760.352) (-754.742) (-750.393) * (-750.859) (-752.309) (-754.474) [-754.983] -- 0:00:18
      702000 -- (-757.150) (-757.347) (-752.239) [-752.225] * [-753.601] (-751.559) (-751.404) (-754.595) -- 0:00:18
      702500 -- (-753.514) (-758.310) (-758.056) [-750.963] * (-751.236) [-750.730] (-752.476) (-750.735) -- 0:00:18
      703000 -- (-755.718) [-754.531] (-756.730) (-751.675) * (-753.406) [-752.733] (-756.176) (-754.911) -- 0:00:18
      703500 -- (-750.743) [-752.123] (-752.424) (-751.328) * (-752.994) [-750.880] (-757.473) (-753.146) -- 0:00:18
      704000 -- (-750.757) (-751.892) (-753.984) [-756.456] * [-753.931] (-750.827) (-751.225) (-750.603) -- 0:00:18
      704500 -- (-754.808) (-751.449) [-754.016] (-759.111) * (-753.683) [-750.666] (-751.116) (-752.323) -- 0:00:18
      705000 -- (-751.152) [-751.287] (-754.822) (-752.548) * (-753.668) (-751.811) [-752.297] (-752.358) -- 0:00:18

      Average standard deviation of split frequencies: 0.009390

      705500 -- [-751.475] (-751.743) (-752.980) (-753.210) * (-755.435) (-754.801) (-755.865) [-758.289] -- 0:00:18
      706000 -- [-751.846] (-754.930) (-754.052) (-750.921) * [-752.440] (-753.235) (-755.547) (-753.112) -- 0:00:18
      706500 -- (-751.241) (-754.200) (-755.695) [-751.329] * (-755.360) (-755.069) (-754.066) [-752.108] -- 0:00:18
      707000 -- [-751.972] (-755.291) (-754.460) (-758.303) * (-752.055) (-752.279) (-753.384) [-753.984] -- 0:00:18
      707500 -- [-750.651] (-752.541) (-751.888) (-762.655) * (-756.585) (-753.239) [-751.239] (-753.048) -- 0:00:18
      708000 -- (-752.351) (-752.768) (-752.029) [-753.494] * [-753.691] (-752.561) (-754.151) (-751.350) -- 0:00:18
      708500 -- (-751.264) [-751.238] (-751.269) (-753.343) * (-755.776) (-754.527) (-755.297) [-750.621] -- 0:00:18
      709000 -- (-750.905) [-751.825] (-753.951) (-753.351) * (-755.005) (-756.666) (-753.050) [-750.497] -- 0:00:18
      709500 -- [-752.134] (-752.799) (-750.347) (-752.553) * (-754.609) (-751.057) (-751.653) [-751.226] -- 0:00:18
      710000 -- (-753.689) [-751.038] (-752.986) (-751.415) * (-752.091) (-753.109) [-752.137] (-751.716) -- 0:00:18

      Average standard deviation of split frequencies: 0.008996

      710500 -- (-751.783) (-752.758) (-753.312) [-752.907] * (-753.674) (-752.615) (-750.845) [-751.223] -- 0:00:18
      711000 -- (-751.737) [-753.371] (-751.827) (-752.773) * [-750.740] (-751.641) (-751.653) (-753.311) -- 0:00:18
      711500 -- (-751.057) (-755.071) [-750.834] (-751.317) * (-753.981) (-751.704) [-750.914] (-751.000) -- 0:00:18
      712000 -- (-750.411) (-756.292) (-753.209) [-752.455] * (-752.172) [-751.884] (-753.876) (-751.028) -- 0:00:18
      712500 -- (-750.818) (-752.464) [-752.009] (-754.384) * (-753.352) (-753.726) [-752.047] (-753.429) -- 0:00:18
      713000 -- (-751.821) (-754.548) [-750.565] (-752.906) * (-753.694) [-751.440] (-754.859) (-752.877) -- 0:00:18
      713500 -- [-753.090] (-751.800) (-751.108) (-753.265) * (-750.648) (-752.634) (-751.327) [-751.374] -- 0:00:18
      714000 -- (-753.102) (-754.813) [-751.402] (-754.421) * (-754.752) [-751.544] (-755.135) (-753.645) -- 0:00:18
      714500 -- (-755.185) [-752.717] (-753.096) (-752.780) * (-752.017) (-751.563) (-760.061) [-752.313] -- 0:00:17
      715000 -- (-752.672) (-751.837) (-756.658) [-751.140] * (-752.359) [-750.705] (-751.405) (-750.495) -- 0:00:17

      Average standard deviation of split frequencies: 0.008971

      715500 -- (-751.804) (-751.072) [-761.469] (-752.899) * [-753.144] (-752.423) (-754.297) (-750.763) -- 0:00:17
      716000 -- [-752.532] (-753.204) (-755.839) (-751.897) * [-753.364] (-751.953) (-752.067) (-756.967) -- 0:00:17
      716500 -- [-751.745] (-752.331) (-760.254) (-753.893) * (-751.685) [-750.555] (-754.128) (-754.853) -- 0:00:17
      717000 -- (-751.745) (-754.185) (-754.760) [-751.580] * [-752.559] (-753.292) (-753.342) (-753.801) -- 0:00:17
      717500 -- (-753.050) [-752.056] (-754.148) (-751.542) * [-750.730] (-753.864) (-754.500) (-750.666) -- 0:00:17
      718000 -- [-751.848] (-752.186) (-751.117) (-753.615) * (-750.538) (-753.865) [-753.071] (-750.467) -- 0:00:17
      718500 -- (-751.363) (-752.810) (-751.194) [-750.335] * [-752.384] (-751.378) (-751.243) (-754.698) -- 0:00:17
      719000 -- (-751.667) (-752.918) [-751.237] (-751.700) * [-751.377] (-755.749) (-751.710) (-751.650) -- 0:00:17
      719500 -- (-753.490) (-752.047) [-759.205] (-752.658) * (-752.742) (-761.245) (-751.499) [-752.855] -- 0:00:17
      720000 -- (-753.502) [-752.723] (-756.959) (-752.947) * (-751.325) [-754.571] (-752.744) (-754.906) -- 0:00:17

      Average standard deviation of split frequencies: 0.008912

      720500 -- [-750.188] (-755.357) (-752.865) (-752.575) * (-750.895) (-754.550) (-758.642) [-751.481] -- 0:00:17
      721000 -- (-751.918) (-751.679) (-751.535) [-753.370] * [-751.328] (-757.000) (-754.533) (-751.244) -- 0:00:17
      721500 -- (-751.668) (-753.568) (-753.537) [-752.546] * (-752.044) [-753.898] (-752.547) (-751.959) -- 0:00:17
      722000 -- (-751.471) (-753.815) [-751.734] (-751.814) * [-753.315] (-752.336) (-754.625) (-752.562) -- 0:00:17
      722500 -- (-751.006) [-754.329] (-751.022) (-751.651) * (-752.198) (-752.787) [-751.491] (-753.256) -- 0:00:17
      723000 -- (-754.154) (-750.766) [-754.217] (-755.544) * (-750.733) (-755.044) [-751.659] (-755.733) -- 0:00:17
      723500 -- (-753.237) (-754.984) (-751.483) [-751.829] * [-755.093] (-752.746) (-752.991) (-755.900) -- 0:00:17
      724000 -- (-751.748) (-753.455) (-752.631) [-751.668] * (-753.982) (-751.830) [-756.661] (-751.991) -- 0:00:17
      724500 -- (-753.810) (-756.424) (-753.000) [-750.332] * (-755.526) (-753.259) (-762.404) [-752.921] -- 0:00:17
      725000 -- (-753.541) [-751.444] (-752.125) (-752.046) * (-755.730) [-752.210] (-751.450) (-754.431) -- 0:00:17

      Average standard deviation of split frequencies: 0.008847

      725500 -- (-752.427) (-757.538) [-752.470] (-757.731) * [-751.509] (-750.986) (-753.094) (-757.216) -- 0:00:17
      726000 -- (-756.641) [-752.500] (-751.286) (-754.145) * [-752.563] (-751.669) (-751.693) (-752.095) -- 0:00:17
      726500 -- [-751.656] (-753.859) (-751.913) (-754.575) * (-752.396) [-751.295] (-753.991) (-753.579) -- 0:00:17
      727000 -- [-751.939] (-750.925) (-751.281) (-753.968) * (-754.324) [-751.582] (-751.322) (-753.604) -- 0:00:17
      727500 -- (-756.547) [-750.943] (-755.033) (-755.487) * (-750.864) [-753.876] (-753.890) (-754.264) -- 0:00:17
      728000 -- (-753.650) [-752.280] (-755.182) (-753.512) * [-753.575] (-753.026) (-751.645) (-752.931) -- 0:00:17
      728500 -- [-752.992] (-756.940) (-754.492) (-751.745) * [-752.514] (-753.412) (-751.199) (-753.162) -- 0:00:17
      729000 -- (-752.552) (-756.664) [-751.672] (-756.048) * (-754.570) (-753.473) (-753.495) [-752.677] -- 0:00:17
      729500 -- (-754.336) (-752.095) [-750.671] (-754.465) * [-752.631] (-752.971) (-753.266) (-750.675) -- 0:00:17
      730000 -- (-753.420) [-751.452] (-753.732) (-751.869) * (-752.221) (-752.634) (-754.899) [-752.687] -- 0:00:17

      Average standard deviation of split frequencies: 0.008549

      730500 -- (-751.738) [-752.417] (-752.072) (-755.157) * [-753.767] (-750.912) (-751.520) (-752.671) -- 0:00:16
      731000 -- (-754.918) (-758.423) (-752.181) [-751.941] * [-753.265] (-755.312) (-755.092) (-754.765) -- 0:00:16
      731500 -- (-754.024) (-759.728) (-753.472) [-751.169] * (-752.937) [-755.326] (-752.179) (-753.341) -- 0:00:16
      732000 -- [-751.324] (-753.941) (-751.150) (-752.925) * (-750.773) [-754.292] (-753.626) (-754.498) -- 0:00:16
      732500 -- (-751.326) (-750.647) [-752.346] (-752.395) * (-753.305) (-755.902) (-752.690) [-754.550] -- 0:00:16
      733000 -- (-759.944) (-751.827) [-752.969] (-752.997) * (-751.232) (-756.540) (-754.822) [-753.028] -- 0:00:16
      733500 -- (-758.844) [-752.437] (-753.072) (-752.134) * (-755.822) (-751.239) (-751.384) [-754.149] -- 0:00:17
      734000 -- [-752.893] (-753.655) (-751.835) (-750.784) * (-756.590) (-752.299) [-753.182] (-753.035) -- 0:00:17
      734500 -- (-753.186) (-752.328) (-750.992) [-752.069] * (-751.272) (-753.086) (-753.563) [-752.026] -- 0:00:16
      735000 -- (-754.495) (-751.821) [-751.837] (-753.973) * [-752.749] (-754.941) (-753.221) (-755.112) -- 0:00:16

      Average standard deviation of split frequencies: 0.008687

      735500 -- [-751.026] (-752.945) (-751.154) (-753.597) * (-751.018) (-754.635) (-752.202) [-751.060] -- 0:00:16
      736000 -- (-751.281) (-752.828) [-750.807] (-753.849) * [-751.066] (-750.703) (-750.463) (-754.780) -- 0:00:16
      736500 -- [-751.083] (-753.530) (-752.495) (-752.694) * (-754.698) [-752.799] (-752.083) (-753.440) -- 0:00:16
      737000 -- (-754.245) (-753.928) [-752.046] (-752.328) * [-755.134] (-756.754) (-751.291) (-753.146) -- 0:00:16
      737500 -- [-755.814] (-751.948) (-750.986) (-754.833) * [-751.318] (-753.237) (-751.918) (-756.228) -- 0:00:16
      738000 -- (-754.361) [-751.428] (-753.895) (-754.112) * [-753.989] (-751.694) (-751.928) (-755.316) -- 0:00:16
      738500 -- [-751.468] (-756.468) (-750.479) (-756.047) * [-752.652] (-751.411) (-751.958) (-757.032) -- 0:00:16
      739000 -- (-751.845) [-750.785] (-752.228) (-752.417) * (-751.866) [-751.996] (-751.670) (-752.381) -- 0:00:16
      739500 -- (-754.321) (-753.430) [-752.432] (-752.993) * (-752.882) (-753.538) (-754.809) [-754.428] -- 0:00:16
      740000 -- (-758.723) (-753.538) (-753.741) [-752.641] * [-751.420] (-756.130) (-752.577) (-751.102) -- 0:00:16