--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:40:09 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2595/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -751.77 -755.71
2 -751.71 -756.61
--------------------------------------
TOTAL -751.74 -756.26
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893682 0.089433 0.376787 1.473395 0.858762 1267.81 1384.41 1.000
r(A<->C){all} 0.151438 0.018127 0.000045 0.429099 0.112447 135.97 142.43 1.002
r(A<->G){all} 0.162229 0.019459 0.000044 0.448539 0.123211 130.41 206.29 1.001
r(A<->T){all} 0.175097 0.019836 0.000066 0.452757 0.141213 199.38 226.73 1.003
r(C<->G){all} 0.165205 0.019835 0.000053 0.453140 0.128112 192.97 247.91 1.000
r(C<->T){all} 0.181197 0.020863 0.000122 0.462222 0.146395 194.88 274.53 1.001
r(G<->T){all} 0.164834 0.020610 0.000008 0.461242 0.123024 147.70 173.63 1.001
pi(A){all} 0.228998 0.000315 0.197952 0.267147 0.228012 1165.68 1257.49 1.000
pi(C){all} 0.281769 0.000362 0.244716 0.318980 0.281851 1208.35 1249.71 1.000
pi(G){all} 0.292588 0.000395 0.250960 0.329721 0.292383 1147.00 1150.49 1.000
pi(T){all} 0.196644 0.000295 0.160887 0.227664 0.196798 1200.02 1299.87 1.000
alpha{1,2} 0.416182 0.228647 0.000188 1.416131 0.238986 1157.33 1246.00 1.000
alpha{3} 0.474805 0.244493 0.000184 1.460005 0.307071 1282.11 1391.56 1.001
pinvar{all} 0.997088 0.000012 0.990845 1.000000 0.998202 1084.35 1112.46 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -724.26471
Model 2: PositiveSelection -724.264662
Model 0: one-ratio -724.26468
Model 7: beta -724.264683
Model 8: beta&w>1 -724.264661
Model 0 vs 1 6.000000007588824E-5
Model 2 vs 1 9.599999998499698E-5
Model 8 vs 7 4.399999988891068E-5
>C1
LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
>C2
LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
>C3
LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
>C4
LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
>C5
LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
>C6
LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=182
C1 LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
C2 LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
C3 LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
C4 LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
C5 LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
C6 LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
**************************************************
C1 QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
C2 QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
C3 QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
C4 QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
C5 QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
C6 QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
**************************************************
C1 ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
C2 ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
C3 ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
C4 ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
C5 ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
C6 ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
**************************************************
C1 RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
C2 RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
C3 RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
C4 RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
C5 RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
C6 RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
********************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 182 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 182 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5460]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5460]--->[5460]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.475 Mb, Max= 30.722 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
C2 LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
C3 LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
C4 LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
C5 LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
C6 LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
**************************************************
C1 QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
C2 QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
C3 QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
C4 QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
C5 QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
C6 QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
**************************************************
C1 ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
C2 ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
C3 ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
C4 ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
C5 ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
C6 ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
**************************************************
C1 RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
C2 RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
C3 RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
C4 RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
C5 RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
C6 RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
********************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG
C2 TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG
C3 TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG
C4 TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG
C5 TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG
C6 TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG
**************************************************
C1 GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC
C2 GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC
C3 GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC
C4 GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC
C5 GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC
C6 GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC
**************************************************
C1 TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC
C2 TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC
C3 TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC
C4 TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC
C5 TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC
C6 TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC
**************************************************
C1 CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC
C2 CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC
C3 CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC
C4 CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC
C5 CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC
C6 CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC
**************************************************
C1 GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG
C2 GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG
C3 GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG
C4 GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG
C5 GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG
C6 GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG
**************************************************
C1 CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA
C2 CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA
C3 CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA
C4 CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA
C5 CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA
C6 CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA
**************************************************
C1 GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT
C2 GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT
C3 GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT
C4 GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT
C5 GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT
C6 GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT
**************************************************
C1 ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG
C2 ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG
C3 ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG
C4 ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG
C5 ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG
C6 ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG
**************************************************
C1 ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT
C2 ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT
C3 ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT
C4 ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT
C5 ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT
C6 ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT
**************************************************
C1 CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT
C2 CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT
C3 CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT
C4 CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT
C5 CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT
C6 CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT
**************************************************
C1 CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG
C2 CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG
C3 CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG
C4 CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG
C5 CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG
C6 CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG
**********************************************
>C1
TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG
GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC
TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC
CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC
GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG
CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA
GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT
ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG
ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT
CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT
CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG
>C2
TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG
GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC
TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC
CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC
GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG
CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA
GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT
ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG
ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT
CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT
CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG
>C3
TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG
GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC
TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC
CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC
GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG
CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA
GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT
ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG
ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT
CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT
CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG
>C4
TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG
GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC
TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC
CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC
GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG
CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA
GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT
ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG
ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT
CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT
CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG
>C5
TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG
GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC
TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC
CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC
GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG
CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA
GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT
ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG
ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT
CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT
CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG
>C6
TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG
GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC
TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC
CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC
GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG
CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA
GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT
ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG
ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT
CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT
CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG
>C1
LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
>C2
LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
>C3
LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
>C4
LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
>C5
LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
>C6
LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 546 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579858730
Setting output file names to "/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1946369564
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5979006405
Seed = 341386789
Swapseed = 1579858730
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1221.973991 -- -24.965149
Chain 2 -- -1221.974177 -- -24.965149
Chain 3 -- -1221.974177 -- -24.965149
Chain 4 -- -1221.974107 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1221.974177 -- -24.965149
Chain 2 -- -1221.974177 -- -24.965149
Chain 3 -- -1221.974107 -- -24.965149
Chain 4 -- -1221.974177 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1221.974] (-1221.974) (-1221.974) (-1221.974) * [-1221.974] (-1221.974) (-1221.974) (-1221.974)
500 -- (-755.502) (-759.874) [-758.823] (-774.088) * (-764.415) [-757.628] (-758.030) (-764.142) -- 0:00:00
1000 -- (-759.671) (-759.643) [-763.960] (-761.857) * [-764.612] (-757.547) (-759.275) (-762.222) -- 0:00:00
1500 -- [-766.942] (-760.597) (-766.089) (-772.971) * [-758.207] (-764.896) (-759.394) (-764.240) -- 0:00:00
2000 -- [-764.336] (-761.208) (-761.195) (-764.728) * [-759.931] (-761.418) (-761.392) (-761.097) -- 0:00:00
2500 -- (-773.023) (-762.568) [-759.060] (-763.238) * [-759.612] (-766.036) (-762.883) (-759.085) -- 0:00:00
3000 -- (-757.655) [-758.285] (-775.557) (-759.885) * (-759.962) (-758.960) [-765.319] (-758.031) -- 0:05:32
3500 -- (-764.535) [-761.253] (-760.298) (-759.457) * [-761.804] (-760.410) (-767.311) (-765.427) -- 0:04:44
4000 -- (-764.891) [-760.788] (-766.045) (-762.104) * (-767.529) (-758.376) (-766.516) [-757.567] -- 0:04:09
4500 -- (-766.137) (-774.140) [-766.678] (-768.498) * (-760.796) (-765.790) [-761.581] (-766.547) -- 0:03:41
5000 -- (-755.060) (-761.017) [-762.336] (-766.506) * [-755.448] (-754.868) (-757.947) (-765.663) -- 0:03:19
Average standard deviation of split frequencies: 0.133565
5500 -- [-760.621] (-767.306) (-763.493) (-759.134) * [-760.653] (-763.810) (-762.090) (-759.023) -- 0:03:00
6000 -- (-754.673) (-767.433) (-757.635) [-759.889] * (-771.936) (-766.274) [-762.915] (-763.589) -- 0:02:45
6500 -- (-763.092) [-762.752] (-757.382) (-761.603) * (-765.024) (-765.944) (-759.943) [-760.946] -- 0:02:32
7000 -- [-759.970] (-763.248) (-753.337) (-765.371) * (-761.142) [-762.126] (-763.061) (-785.292) -- 0:02:21
7500 -- (-761.690) [-759.001] (-753.708) (-755.689) * (-759.341) (-762.432) (-758.653) [-757.822] -- 0:02:12
8000 -- (-763.562) (-765.211) [-753.411] (-756.535) * (-760.139) [-757.163] (-759.116) (-758.822) -- 0:02:04
8500 -- (-759.803) (-762.121) [-752.184] (-759.453) * (-758.164) [-764.163] (-762.644) (-758.798) -- 0:01:56
9000 -- [-764.294] (-772.873) (-752.389) (-756.547) * (-761.641) (-789.189) [-760.525] (-760.376) -- 0:01:50
9500 -- (-756.839) (-767.408) (-752.622) [-759.496] * (-759.514) (-776.847) [-761.178] (-767.716) -- 0:01:44
10000 -- (-761.811) [-759.251] (-751.442) (-758.596) * [-758.833] (-751.184) (-761.104) (-769.522) -- 0:01:39
Average standard deviation of split frequencies: 0.079084
10500 -- [-760.360] (-762.961) (-750.716) (-762.300) * (-760.628) (-753.544) [-759.853] (-762.047) -- 0:01:34
11000 -- (-769.513) (-759.869) [-752.788] (-771.911) * [-762.812] (-754.972) (-765.307) (-762.324) -- 0:01:29
11500 -- (-759.721) (-762.678) (-752.869) [-760.950] * [-757.695] (-753.533) (-760.238) (-760.186) -- 0:01:25
12000 -- (-763.107) (-775.055) [-752.891] (-761.674) * (-761.232) (-751.596) [-757.135] (-758.083) -- 0:01:22
12500 -- [-764.955] (-773.865) (-753.852) (-756.532) * (-771.211) (-751.160) (-765.237) [-763.234] -- 0:01:19
13000 -- (-767.075) (-764.811) (-754.029) [-760.524] * (-763.191) (-752.269) (-760.470) [-757.748] -- 0:01:15
13500 -- [-762.994] (-762.977) (-754.813) (-760.632) * [-765.353] (-750.374) (-758.684) (-759.662) -- 0:01:13
14000 -- [-757.269] (-753.208) (-751.194) (-761.123) * (-763.749) (-750.614) (-761.321) [-760.932] -- 0:01:10
14500 -- [-759.169] (-751.055) (-751.170) (-762.847) * (-762.113) (-755.033) [-758.995] (-759.297) -- 0:01:07
15000 -- (-770.262) (-752.206) (-751.965) [-767.538] * (-758.883) [-753.389] (-754.165) (-758.425) -- 0:01:05
Average standard deviation of split frequencies: 0.068746
15500 -- (-763.186) (-755.156) [-751.110] (-765.421) * [-758.261] (-751.658) (-757.538) (-762.931) -- 0:01:03
16000 -- (-757.729) [-752.643] (-752.668) (-769.587) * [-760.916] (-751.012) (-757.391) (-769.525) -- 0:02:03
16500 -- (-762.352) (-752.861) (-752.837) [-761.422] * (-763.638) [-751.759] (-762.945) (-768.406) -- 0:01:59
17000 -- (-760.127) (-750.423) [-751.709] (-758.911) * (-759.044) (-752.440) [-756.956] (-772.051) -- 0:01:55
17500 -- [-757.363] (-750.964) (-751.172) (-764.034) * (-766.302) (-752.129) [-759.629] (-757.566) -- 0:01:52
18000 -- [-765.075] (-751.632) (-751.552) (-763.030) * (-764.519) (-755.424) (-766.742) [-755.790] -- 0:01:49
18500 -- [-757.934] (-750.465) (-750.495) (-758.120) * (-762.043) [-754.585] (-779.121) (-752.228) -- 0:01:46
19000 -- (-764.474) (-751.342) [-752.301] (-754.966) * (-767.598) (-753.254) (-752.213) [-751.237] -- 0:01:43
19500 -- (-762.310) (-750.742) (-751.173) [-759.580] * [-761.601] (-752.945) (-752.244) (-756.762) -- 0:01:40
20000 -- (-760.091) (-750.622) (-758.437) [-761.801] * (-758.143) (-751.539) (-753.916) [-751.197] -- 0:01:38
Average standard deviation of split frequencies: 0.052748
20500 -- [-757.375] (-751.457) (-755.024) (-762.011) * (-759.905) (-751.059) [-752.616] (-751.611) -- 0:01:35
21000 -- [-761.166] (-752.486) (-754.134) (-761.937) * (-762.900) [-751.212] (-752.884) (-751.418) -- 0:01:33
21500 -- [-759.093] (-751.020) (-755.619) (-758.731) * [-759.575] (-751.337) (-754.099) (-751.390) -- 0:01:31
22000 -- (-760.983) (-754.495) (-756.773) [-758.940] * (-760.923) (-751.990) [-751.921] (-750.957) -- 0:01:28
22500 -- (-759.289) (-750.657) [-751.178] (-761.325) * [-760.662] (-751.169) (-753.131) (-750.746) -- 0:01:26
23000 -- (-757.263) (-750.404) [-751.738] (-762.699) * (-768.685) (-751.683) [-752.304] (-753.604) -- 0:01:24
23500 -- (-761.935) (-750.525) [-750.752] (-765.064) * (-761.332) [-752.525] (-754.914) (-753.770) -- 0:01:23
24000 -- (-760.285) [-753.478] (-750.737) (-756.065) * [-757.683] (-751.276) (-753.703) (-751.590) -- 0:01:21
24500 -- (-766.747) (-753.166) (-750.951) [-763.772] * [-761.752] (-753.577) (-755.356) (-755.008) -- 0:01:19
25000 -- (-758.895) (-754.456) (-751.623) [-764.927] * [-760.175] (-752.256) (-753.877) (-750.990) -- 0:01:18
Average standard deviation of split frequencies: 0.037125
25500 -- (-764.646) [-751.226] (-754.837) (-758.376) * [-764.715] (-752.660) (-752.416) (-755.583) -- 0:01:16
26000 -- (-764.034) (-754.098) [-754.819] (-758.793) * (-761.806) (-751.759) [-757.437] (-752.846) -- 0:01:14
26500 -- [-758.945] (-754.521) (-753.015) (-770.380) * [-759.924] (-753.054) (-756.287) (-750.732) -- 0:01:13
27000 -- [-758.072] (-752.826) (-754.711) (-772.165) * [-771.323] (-752.891) (-753.825) (-752.530) -- 0:01:12
27500 -- (-757.915) (-751.577) [-753.495] (-760.962) * (-769.392) (-752.063) (-755.241) [-751.721] -- 0:01:10
28000 -- [-759.750] (-757.606) (-755.351) (-759.866) * (-757.982) (-753.761) (-753.534) [-751.589] -- 0:01:09
28500 -- (-762.325) (-755.124) [-755.296] (-765.252) * (-769.830) [-752.443] (-752.472) (-756.848) -- 0:01:08
29000 -- (-762.471) (-757.219) (-751.516) [-756.291] * (-766.029) (-751.673) (-750.266) [-754.378] -- 0:01:40
29500 -- (-766.248) (-751.098) (-751.279) [-758.052] * [-758.621] (-757.358) (-751.428) (-756.781) -- 0:01:38
30000 -- (-763.374) (-753.737) (-752.447) [-758.626] * [-757.899] (-755.680) (-750.429) (-751.752) -- 0:01:37
Average standard deviation of split frequencies: 0.033818
30500 -- [-751.344] (-752.789) (-751.893) (-756.388) * (-753.326) (-750.658) [-750.248] (-758.736) -- 0:01:35
31000 -- (-751.165) (-750.139) [-751.266] (-760.391) * (-751.319) (-751.885) (-754.179) [-753.343] -- 0:01:33
31500 -- (-751.166) (-753.855) (-752.089) [-759.632] * (-750.691) (-751.024) (-751.440) [-751.198] -- 0:01:32
32000 -- (-753.498) (-751.099) (-752.245) [-762.161] * (-750.897) [-751.826] (-754.303) (-754.749) -- 0:01:30
32500 -- (-751.753) (-751.798) (-751.787) [-760.317] * (-750.680) (-752.283) (-753.667) [-750.707] -- 0:01:29
33000 -- (-751.767) (-756.020) [-750.506] (-758.453) * (-751.248) (-756.407) [-750.923] (-750.832) -- 0:01:27
33500 -- (-752.386) (-750.832) (-750.705) [-759.225] * (-751.800) (-753.689) [-752.967] (-752.966) -- 0:01:26
34000 -- (-753.738) [-751.564] (-750.519) (-764.230) * [-751.878] (-753.892) (-751.884) (-751.915) -- 0:01:25
34500 -- [-750.801] (-754.970) (-751.742) (-772.675) * (-752.988) (-755.500) [-750.819] (-752.764) -- 0:01:23
35000 -- (-750.722) (-756.519) (-752.385) [-754.466] * (-751.277) [-755.888] (-750.752) (-751.072) -- 0:01:22
Average standard deviation of split frequencies: 0.032082
35500 -- [-751.953] (-753.009) (-751.397) (-751.818) * [-754.692] (-753.014) (-750.557) (-751.714) -- 0:01:21
36000 -- (-751.171) (-752.355) [-750.458] (-753.160) * (-754.642) [-756.215] (-750.548) (-751.356) -- 0:01:20
36500 -- [-752.781] (-753.016) (-751.718) (-751.035) * (-752.243) (-753.472) (-755.768) [-751.844] -- 0:01:19
37000 -- [-751.416] (-751.869) (-752.307) (-750.869) * (-754.455) (-754.310) (-751.920) [-756.755] -- 0:01:18
37500 -- (-750.849) (-752.663) (-756.454) [-750.950] * (-755.190) (-751.807) (-751.439) [-752.638] -- 0:01:17
38000 -- (-751.334) (-754.555) [-753.532] (-750.861) * [-751.545] (-751.410) (-752.720) (-754.277) -- 0:01:15
38500 -- (-754.584) (-752.517) (-754.053) [-753.470] * [-750.637] (-753.895) (-753.244) (-755.269) -- 0:01:14
39000 -- (-752.214) [-751.021] (-751.301) (-754.387) * [-751.612] (-751.650) (-754.297) (-752.332) -- 0:01:13
39500 -- [-751.792] (-750.915) (-751.316) (-752.933) * (-753.177) (-751.027) (-751.547) [-750.322] -- 0:01:12
40000 -- (-750.391) [-752.386] (-753.642) (-751.566) * (-752.309) (-753.200) (-753.031) [-750.332] -- 0:01:12
Average standard deviation of split frequencies: 0.034132
40500 -- (-750.349) [-751.128] (-757.171) (-755.004) * [-751.269] (-753.698) (-758.592) (-752.998) -- 0:01:11
41000 -- (-752.025) [-751.680] (-756.011) (-750.785) * (-752.084) (-751.600) [-754.307] (-751.068) -- 0:01:10
41500 -- (-750.235) [-751.680] (-753.779) (-754.634) * (-753.963) (-751.229) [-753.119] (-750.944) -- 0:01:09
42000 -- (-754.575) [-751.854] (-753.187) (-753.156) * (-756.156) (-751.146) (-757.097) [-753.316] -- 0:01:08
42500 -- (-754.417) (-752.271) [-754.025] (-753.598) * (-752.856) [-753.694] (-753.700) (-753.966) -- 0:01:07
43000 -- (-751.312) [-751.073] (-751.419) (-752.925) * [-751.976] (-753.731) (-752.401) (-755.485) -- 0:01:06
43500 -- (-750.659) (-751.955) [-752.059] (-752.862) * (-751.782) [-752.332] (-752.593) (-752.346) -- 0:01:05
44000 -- [-751.112] (-750.730) (-753.129) (-754.171) * (-752.147) (-751.804) (-752.221) [-754.440] -- 0:01:26
44500 -- (-751.264) [-751.296] (-752.761) (-752.685) * [-753.742] (-752.261) (-753.966) (-754.977) -- 0:01:25
45000 -- (-752.065) [-753.695] (-752.048) (-755.922) * (-751.808) (-752.253) (-752.148) [-753.293] -- 0:01:24
Average standard deviation of split frequencies: 0.031675
45500 -- (-750.392) (-756.272) [-751.503] (-752.934) * (-752.158) (-751.335) (-752.356) [-753.915] -- 0:01:23
46000 -- [-752.417] (-750.855) (-752.010) (-752.678) * [-750.662] (-750.879) (-750.977) (-751.381) -- 0:01:22
46500 -- (-753.224) (-751.034) [-752.081] (-751.903) * (-751.650) [-750.881] (-751.397) (-751.780) -- 0:01:22
47000 -- (-754.197) (-751.646) (-751.574) [-753.382] * (-750.831) (-753.167) [-751.908] (-752.924) -- 0:01:21
47500 -- [-754.677] (-752.389) (-757.452) (-751.593) * (-753.446) (-751.221) [-751.528] (-753.427) -- 0:01:20
48000 -- [-752.198] (-751.894) (-757.096) (-752.935) * (-753.693) (-751.006) [-752.586] (-753.560) -- 0:01:19
48500 -- (-752.635) (-750.791) (-753.988) [-751.262] * (-755.129) (-755.026) (-751.617) [-751.705] -- 0:01:18
49000 -- (-756.222) (-751.689) [-754.429] (-750.732) * (-752.875) (-753.650) (-754.483) [-756.072] -- 0:01:17
49500 -- (-755.526) [-752.572] (-755.344) (-751.710) * [-753.346] (-752.440) (-753.621) (-753.720) -- 0:01:16
50000 -- [-752.867] (-753.977) (-754.836) (-751.065) * [-752.982] (-752.275) (-753.319) (-752.685) -- 0:01:16
Average standard deviation of split frequencies: 0.023925
50500 -- (-754.629) [-752.521] (-754.273) (-753.474) * (-752.708) (-750.046) (-752.888) [-751.780] -- 0:01:15
51000 -- [-751.938] (-752.457) (-754.823) (-755.654) * (-759.162) (-753.675) (-754.768) [-752.141] -- 0:01:14
51500 -- (-752.511) (-753.779) (-751.728) [-756.323] * (-757.086) (-750.869) [-754.327] (-753.497) -- 0:01:13
52000 -- [-751.858] (-751.324) (-752.286) (-758.161) * (-751.468) [-752.966] (-754.400) (-756.295) -- 0:01:12
52500 -- [-751.156] (-754.890) (-753.621) (-758.220) * [-750.626] (-753.154) (-752.982) (-753.777) -- 0:01:12
53000 -- (-751.177) (-754.555) [-752.230] (-755.496) * [-750.778] (-750.941) (-754.986) (-756.299) -- 0:01:11
53500 -- [-752.160] (-751.856) (-754.344) (-752.879) * [-751.244] (-750.938) (-757.240) (-755.085) -- 0:01:10
54000 -- (-751.523) (-758.190) [-754.500] (-757.286) * (-751.254) (-757.218) (-752.288) [-752.514] -- 0:01:10
54500 -- (-751.516) (-751.687) [-751.086] (-752.816) * [-750.685] (-755.292) (-750.586) (-754.134) -- 0:01:09
55000 -- [-754.230] (-753.416) (-752.597) (-752.222) * (-750.809) (-753.668) (-750.341) [-751.640] -- 0:01:08
Average standard deviation of split frequencies: 0.033289
55500 -- [-752.683] (-753.337) (-752.964) (-750.756) * [-750.443] (-756.128) (-750.948) (-760.050) -- 0:01:08
56000 -- (-750.692) (-754.206) (-751.179) [-752.387] * (-751.783) (-750.406) [-752.616] (-753.475) -- 0:01:07
56500 -- [-750.705] (-753.482) (-751.892) (-755.205) * (-753.136) [-752.184] (-754.074) (-755.693) -- 0:01:06
57000 -- (-750.984) [-750.670] (-754.694) (-751.251) * (-751.055) (-754.057) [-751.682] (-759.474) -- 0:01:06
57500 -- (-755.832) (-756.394) (-752.264) [-751.152] * [-750.944] (-753.019) (-753.760) (-751.820) -- 0:01:05
58000 -- (-753.852) (-751.398) [-754.291] (-751.201) * (-752.207) [-752.336] (-752.649) (-753.783) -- 0:01:04
58500 -- (-752.695) (-751.044) (-750.860) [-752.041] * (-755.012) [-752.538] (-753.210) (-755.779) -- 0:01:04
59000 -- (-751.112) [-752.583] (-751.029) (-752.017) * [-751.369] (-751.864) (-751.940) (-751.812) -- 0:01:03
59500 -- [-750.873] (-752.894) (-752.098) (-753.029) * (-756.342) [-752.049] (-753.040) (-752.442) -- 0:01:03
60000 -- (-751.593) (-751.214) [-751.399] (-754.073) * (-754.981) (-752.519) [-754.359] (-751.635) -- 0:01:02
Average standard deviation of split frequencies: 0.030712
60500 -- (-752.882) (-752.328) [-751.449] (-751.266) * (-753.961) [-751.324] (-753.904) (-752.770) -- 0:01:17
61000 -- [-753.520] (-754.327) (-753.870) (-752.468) * (-750.586) (-751.189) [-751.813] (-756.624) -- 0:01:16
61500 -- [-757.541] (-751.461) (-753.879) (-756.559) * (-753.452) (-751.430) (-754.055) [-754.814] -- 0:01:16
62000 -- [-754.916] (-751.782) (-756.826) (-754.268) * (-751.412) (-751.320) [-752.597] (-753.516) -- 0:01:15
62500 -- [-753.358] (-751.381) (-752.738) (-754.857) * (-753.276) [-751.503] (-754.284) (-761.346) -- 0:01:15
63000 -- (-754.276) [-750.184] (-752.824) (-752.255) * (-754.611) (-750.751) [-751.275] (-756.898) -- 0:01:14
63500 -- (-755.371) [-752.032] (-757.027) (-753.240) * (-752.516) [-750.956] (-750.733) (-755.275) -- 0:01:13
64000 -- (-753.789) (-753.284) (-753.396) [-753.124] * [-751.705] (-752.240) (-751.713) (-753.037) -- 0:01:13
64500 -- [-751.668] (-755.629) (-752.973) (-751.463) * (-751.050) [-753.157] (-752.657) (-754.236) -- 0:01:12
65000 -- (-752.939) [-751.965] (-753.723) (-751.249) * (-751.974) (-752.998) (-752.983) [-754.474] -- 0:01:11
Average standard deviation of split frequencies: 0.035712
65500 -- (-753.666) (-756.716) (-757.474) [-752.334] * (-752.452) [-751.864] (-755.475) (-751.987) -- 0:01:11
66000 -- (-751.722) [-751.668] (-752.872) (-751.120) * (-753.281) (-751.830) [-752.573] (-761.618) -- 0:01:10
66500 -- (-750.633) (-757.031) (-755.740) [-754.732] * (-755.987) [-752.993] (-750.519) (-757.524) -- 0:01:10
67000 -- [-751.657] (-753.446) (-753.432) (-751.518) * (-751.110) [-756.078] (-750.558) (-762.275) -- 0:01:09
67500 -- (-751.063) (-753.189) (-753.380) [-751.478] * [-752.837] (-751.049) (-750.524) (-759.386) -- 0:01:09
68000 -- [-754.527] (-753.045) (-754.803) (-755.410) * (-750.667) [-752.775] (-754.729) (-753.206) -- 0:01:08
68500 -- (-752.510) (-750.987) [-750.559] (-753.492) * (-750.762) (-751.101) [-753.339] (-753.185) -- 0:01:07
69000 -- (-755.743) (-751.985) (-754.467) [-752.839] * (-751.739) (-753.802) (-754.621) [-753.483] -- 0:01:07
69500 -- (-751.119) [-752.996] (-751.351) (-757.473) * (-750.722) (-755.926) [-753.451] (-759.883) -- 0:01:06
70000 -- [-753.025] (-755.074) (-750.707) (-756.099) * [-753.073] (-755.830) (-752.055) (-757.393) -- 0:01:06
Average standard deviation of split frequencies: 0.035110
70500 -- (-753.869) [-751.139] (-750.845) (-752.328) * (-752.925) (-750.719) (-752.122) [-750.951] -- 0:01:05
71000 -- [-751.650] (-754.267) (-751.246) (-751.321) * (-752.625) (-755.013) (-753.356) [-752.171] -- 0:01:05
71500 -- (-754.196) (-752.323) (-750.749) [-751.163] * (-751.919) (-753.509) (-754.020) [-750.515] -- 0:01:04
72000 -- (-752.022) (-752.006) [-751.016] (-750.850) * (-758.077) [-756.312] (-751.182) (-752.047) -- 0:01:04
72500 -- (-755.893) (-751.202) [-752.828] (-757.496) * (-753.552) (-750.761) [-751.724] (-751.920) -- 0:01:03
73000 -- [-757.499] (-751.817) (-751.575) (-757.324) * (-753.210) [-751.635] (-750.751) (-751.907) -- 0:01:03
73500 -- (-755.256) [-755.994] (-752.413) (-752.564) * [-755.931] (-751.382) (-751.962) (-753.209) -- 0:01:03
74000 -- [-751.720] (-753.491) (-752.239) (-754.124) * (-752.030) (-752.628) (-754.521) [-753.838] -- 0:01:02
74500 -- [-750.630] (-751.251) (-752.225) (-755.089) * (-752.145) (-752.042) (-753.745) [-754.400] -- 0:01:02
75000 -- (-751.246) (-751.702) (-752.884) [-752.667] * (-755.957) (-751.247) (-754.675) [-750.457] -- 0:01:01
Average standard deviation of split frequencies: 0.034278
75500 -- [-751.267] (-754.878) (-753.219) (-753.586) * (-751.144) [-752.367] (-751.522) (-751.292) -- 0:01:01
76000 -- [-753.582] (-756.515) (-753.288) (-753.174) * (-752.659) (-750.566) [-752.249] (-753.083) -- 0:01:00
76500 -- [-753.775] (-756.559) (-751.328) (-751.715) * (-751.024) (-750.822) (-756.304) [-756.652] -- 0:01:00
77000 -- (-751.869) [-754.157] (-750.567) (-752.137) * (-752.177) (-751.699) (-752.713) [-754.304] -- 0:00:59
77500 -- (-751.471) (-754.769) (-750.983) [-755.559] * (-753.902) [-752.558] (-752.959) (-752.217) -- 0:01:11
78000 -- (-754.318) (-756.520) [-752.670] (-755.901) * (-753.920) [-756.176] (-752.090) (-751.959) -- 0:01:10
78500 -- (-755.474) (-750.722) [-751.406] (-756.851) * (-755.555) [-750.540] (-752.798) (-752.442) -- 0:01:10
79000 -- [-755.834] (-757.232) (-752.449) (-755.038) * [-752.304] (-752.941) (-752.344) (-754.436) -- 0:01:09
79500 -- (-752.146) (-753.080) (-753.791) [-752.333] * [-750.862] (-756.511) (-752.418) (-757.461) -- 0:01:09
80000 -- (-751.426) [-751.321] (-754.864) (-752.347) * [-751.146] (-751.605) (-752.220) (-751.321) -- 0:01:09
Average standard deviation of split frequencies: 0.030757
80500 -- [-751.020] (-753.360) (-752.485) (-751.246) * (-753.426) [-752.484] (-751.754) (-751.148) -- 0:01:08
81000 -- (-751.503) (-755.486) [-754.923] (-753.704) * (-753.355) (-752.267) [-752.083] (-752.142) -- 0:01:08
81500 -- (-751.408) (-753.490) (-751.840) [-752.139] * (-752.999) (-753.881) (-752.512) [-751.026] -- 0:01:07
82000 -- (-752.014) (-757.709) (-757.141) [-755.967] * (-753.509) (-753.487) (-750.912) [-750.741] -- 0:01:07
82500 -- [-753.289] (-753.040) (-753.960) (-752.902) * (-755.326) (-751.461) (-751.727) [-755.147] -- 0:01:06
83000 -- [-754.384] (-752.789) (-756.142) (-752.894) * [-750.631] (-753.456) (-750.595) (-751.760) -- 0:01:06
83500 -- (-752.515) [-754.604] (-758.802) (-753.111) * (-753.018) (-752.289) (-754.758) [-752.595] -- 0:01:05
84000 -- [-752.366] (-752.595) (-750.443) (-752.791) * [-752.133] (-754.531) (-752.552) (-753.007) -- 0:01:05
84500 -- (-753.106) (-754.854) (-753.079) [-754.038] * (-751.369) (-750.807) (-752.010) [-752.919] -- 0:01:05
85000 -- (-750.397) [-752.556] (-750.709) (-751.439) * [-753.080] (-751.872) (-751.486) (-753.983) -- 0:01:04
Average standard deviation of split frequencies: 0.024916
85500 -- [-751.083] (-751.782) (-750.484) (-752.275) * [-756.585] (-751.503) (-753.666) (-752.163) -- 0:01:04
86000 -- (-753.633) (-751.943) [-755.027] (-753.038) * [-755.607] (-752.558) (-753.458) (-752.330) -- 0:01:03
86500 -- (-751.423) (-754.293) (-753.007) [-753.405] * (-756.090) (-750.835) (-755.559) [-757.932] -- 0:01:03
87000 -- (-755.530) [-755.604] (-755.755) (-752.128) * (-751.928) (-750.769) (-751.079) [-754.621] -- 0:01:02
87500 -- (-754.130) (-753.156) [-754.619] (-752.488) * (-751.217) [-751.425] (-756.969) (-755.355) -- 0:01:02
88000 -- (-751.777) (-752.619) (-751.941) [-751.268] * (-753.862) [-752.600] (-754.886) (-751.544) -- 0:01:02
88500 -- (-750.941) [-752.031] (-752.554) (-751.349) * [-752.275] (-750.891) (-755.940) (-752.034) -- 0:01:01
89000 -- (-753.550) (-752.299) [-751.853] (-755.382) * (-755.995) (-752.780) [-755.030] (-752.403) -- 0:01:01
89500 -- (-754.594) [-754.091] (-756.648) (-753.833) * [-751.290] (-750.668) (-754.232) (-752.132) -- 0:01:01
90000 -- (-753.574) (-750.872) (-753.243) [-754.184] * (-755.992) [-750.955] (-756.105) (-752.753) -- 0:01:00
Average standard deviation of split frequencies: 0.025288
90500 -- (-753.688) [-750.566] (-754.793) (-752.326) * (-751.661) [-751.584] (-752.645) (-750.249) -- 0:01:00
91000 -- [-753.586] (-753.136) (-755.241) (-755.624) * [-752.211] (-752.553) (-756.252) (-751.383) -- 0:00:59
91500 -- (-752.007) (-751.086) (-752.452) [-751.387] * (-753.541) (-753.134) [-750.659] (-752.622) -- 0:00:59
92000 -- (-750.758) (-754.037) (-755.186) [-752.985] * (-750.561) (-756.425) [-750.739] (-757.148) -- 0:00:59
92500 -- (-751.970) (-751.732) (-752.188) [-752.202] * (-755.370) (-750.703) (-750.499) [-754.505] -- 0:00:58
93000 -- (-752.301) [-753.055] (-751.364) (-751.852) * (-753.437) (-751.520) [-751.400] (-752.826) -- 0:00:58
93500 -- (-754.272) (-750.878) [-751.906] (-751.637) * (-753.072) (-750.415) [-751.924] (-753.771) -- 0:00:58
94000 -- (-753.216) (-753.448) [-750.999] (-752.234) * (-753.824) (-751.725) (-750.794) [-754.328] -- 0:00:57
94500 -- (-758.300) [-752.250] (-752.980) (-752.761) * (-753.791) (-750.397) [-750.606] (-752.355) -- 0:01:07
95000 -- (-758.611) (-754.297) (-752.827) [-751.788] * [-750.993] (-750.965) (-752.361) (-754.474) -- 0:01:06
Average standard deviation of split frequencies: 0.023213
95500 -- [-754.017] (-753.023) (-753.900) (-752.067) * (-756.039) (-752.215) (-753.231) [-751.001] -- 0:01:06
96000 -- (-751.314) [-754.437] (-754.282) (-751.897) * [-751.366] (-753.877) (-751.812) (-755.024) -- 0:01:05
96500 -- (-751.704) [-756.319] (-751.131) (-751.599) * (-752.123) (-755.443) [-753.263] (-751.677) -- 0:01:05
97000 -- (-751.448) [-753.109] (-751.775) (-754.404) * (-754.795) (-751.850) [-752.479] (-751.842) -- 0:01:05
97500 -- [-751.838] (-751.628) (-756.312) (-753.835) * (-751.358) [-753.044] (-753.117) (-753.633) -- 0:01:04
98000 -- (-752.117) (-753.484) (-753.392) [-754.983] * (-753.675) (-752.534) [-751.730] (-751.321) -- 0:01:04
98500 -- [-751.863] (-751.673) (-752.898) (-754.807) * (-756.187) (-751.694) [-752.653] (-753.752) -- 0:01:04
99000 -- (-753.484) (-756.347) (-752.068) [-753.531] * (-754.790) (-754.870) [-752.677] (-755.590) -- 0:01:03
99500 -- (-752.358) (-753.160) [-750.795] (-755.775) * (-752.587) (-754.815) [-751.307] (-756.143) -- 0:01:03
100000 -- (-751.814) (-752.520) [-752.488] (-753.463) * (-752.949) (-755.847) [-753.257] (-754.284) -- 0:01:02
Average standard deviation of split frequencies: 0.021498
100500 -- (-754.875) (-750.783) (-751.937) [-750.371] * (-751.791) [-752.355] (-757.626) (-752.023) -- 0:01:02
101000 -- (-758.162) [-755.590] (-752.396) (-751.061) * (-762.517) [-757.555] (-756.177) (-750.817) -- 0:01:02
101500 -- [-751.917] (-752.474) (-752.557) (-753.705) * [-750.722] (-757.929) (-756.605) (-750.544) -- 0:01:01
102000 -- (-758.523) (-753.581) (-751.628) [-751.718] * (-754.498) [-752.584] (-752.998) (-751.348) -- 0:01:01
102500 -- (-754.707) [-752.082] (-754.778) (-750.708) * (-758.524) [-751.506] (-752.718) (-751.236) -- 0:01:01
103000 -- (-752.360) (-753.622) [-752.722] (-751.632) * (-757.107) (-758.092) (-752.691) [-752.829] -- 0:01:00
103500 -- (-753.515) (-752.129) (-751.568) [-750.244] * (-754.281) [-752.327] (-753.755) (-752.442) -- 0:01:00
104000 -- (-750.898) [-753.215] (-754.384) (-751.044) * (-753.561) (-756.683) [-752.984] (-750.752) -- 0:01:00
104500 -- (-751.123) [-752.298] (-754.181) (-750.643) * (-752.698) [-752.777] (-752.171) (-750.924) -- 0:00:59
105000 -- (-750.677) (-752.945) [-752.772] (-750.323) * (-753.088) [-752.296] (-755.797) (-754.677) -- 0:00:59
Average standard deviation of split frequencies: 0.022236
105500 -- (-751.148) (-750.553) [-750.809] (-751.351) * (-752.823) [-754.663] (-752.620) (-758.113) -- 0:00:59
106000 -- (-751.357) (-756.571) [-751.449] (-752.411) * (-754.343) (-752.134) [-751.947] (-750.468) -- 0:00:59
106500 -- (-756.005) (-751.815) [-754.141] (-750.652) * [-754.047] (-752.116) (-751.076) (-751.841) -- 0:00:58
107000 -- (-754.321) (-757.397) (-753.026) [-752.147] * (-753.074) (-752.563) (-753.781) [-756.082] -- 0:00:58
107500 -- (-752.678) (-751.589) [-753.272] (-751.133) * (-754.248) (-756.685) (-752.303) [-754.555] -- 0:00:58
108000 -- (-750.939) (-750.427) [-754.077] (-753.609) * [-754.126] (-754.437) (-755.816) (-751.519) -- 0:00:57
108500 -- (-753.645) (-751.039) [-754.451] (-755.403) * (-752.750) [-753.195] (-751.656) (-750.948) -- 0:00:57
109000 -- (-750.326) [-750.940] (-753.292) (-754.949) * (-754.764) (-751.720) [-752.864] (-752.050) -- 0:00:57
109500 -- (-752.235) (-752.177) [-752.644] (-753.512) * (-752.726) [-751.444] (-752.211) (-753.390) -- 0:00:56
110000 -- (-752.423) (-752.338) (-753.890) [-753.393] * [-754.929] (-752.452) (-755.061) (-750.505) -- 0:00:56
Average standard deviation of split frequencies: 0.023327
110500 -- (-752.314) (-752.424) (-753.049) [-752.958] * (-752.372) (-750.968) (-752.870) [-751.890] -- 0:00:56
111000 -- (-751.967) (-750.769) (-755.985) [-752.146] * (-751.225) (-751.604) (-755.019) [-754.494] -- 0:01:04
111500 -- (-751.129) [-751.778] (-753.209) (-750.917) * [-751.161] (-752.018) (-753.829) (-751.663) -- 0:01:03
112000 -- [-751.494] (-752.105) (-753.730) (-751.381) * (-757.196) (-753.037) (-752.818) [-755.885] -- 0:01:03
112500 -- (-754.185) (-757.595) (-752.809) [-751.433] * (-752.322) (-751.350) [-753.967] (-752.146) -- 0:01:03
113000 -- (-756.130) [-751.305] (-750.600) (-752.586) * (-752.123) (-751.518) [-751.036] (-751.745) -- 0:01:02
113500 -- (-760.414) (-754.298) (-750.656) [-751.563] * [-752.168] (-752.630) (-751.948) (-751.250) -- 0:01:02
114000 -- (-755.373) (-752.813) (-750.635) [-752.328] * (-751.140) (-751.700) [-753.484] (-752.763) -- 0:01:02
114500 -- (-751.674) (-751.687) [-752.520] (-751.893) * (-752.887) [-752.490] (-752.818) (-752.642) -- 0:01:01
115000 -- [-750.493] (-754.282) (-754.743) (-753.202) * [-756.523] (-751.342) (-751.944) (-754.933) -- 0:01:01
Average standard deviation of split frequencies: 0.022886
115500 -- [-752.197] (-752.761) (-752.241) (-750.887) * (-755.080) (-750.401) [-752.396] (-756.346) -- 0:01:01
116000 -- (-750.653) [-755.162] (-752.832) (-750.381) * (-752.481) (-753.938) (-751.313) [-750.853] -- 0:01:00
116500 -- [-751.059] (-751.918) (-754.087) (-752.041) * (-755.096) (-753.644) (-752.244) [-750.590] -- 0:01:00
117000 -- (-750.982) [-750.474] (-753.429) (-751.600) * (-751.800) (-753.908) [-750.809] (-750.535) -- 0:01:00
117500 -- (-751.133) (-751.489) [-755.566] (-752.619) * (-755.251) (-752.346) (-751.214) [-751.121] -- 0:01:00
118000 -- (-752.950) [-752.584] (-750.939) (-754.390) * (-752.334) (-752.403) (-753.423) [-753.774] -- 0:00:59
118500 -- (-754.911) (-752.508) [-752.093] (-757.002) * (-754.078) [-752.589] (-752.695) (-754.947) -- 0:00:59
119000 -- (-751.678) [-750.803] (-752.693) (-759.252) * [-750.989] (-754.032) (-752.305) (-756.085) -- 0:00:59
119500 -- (-751.315) (-750.734) [-751.351] (-761.550) * (-752.402) (-754.094) [-753.620] (-753.012) -- 0:00:58
120000 -- (-753.398) (-750.380) (-752.116) [-751.821] * (-754.255) (-751.982) [-751.972] (-754.269) -- 0:00:58
Average standard deviation of split frequencies: 0.022618
120500 -- (-751.892) (-751.680) (-751.597) [-752.769] * (-751.555) (-751.270) (-753.685) [-754.170] -- 0:00:58
121000 -- (-751.451) [-752.865] (-753.405) (-753.408) * (-752.560) (-752.848) [-750.791] (-752.625) -- 0:00:58
121500 -- [-752.442] (-755.878) (-753.686) (-752.952) * [-752.475] (-750.895) (-752.128) (-752.175) -- 0:00:57
122000 -- (-751.439) [-754.578] (-754.558) (-752.177) * [-751.685] (-750.465) (-751.552) (-751.416) -- 0:00:57
122500 -- [-752.451] (-755.421) (-761.738) (-752.656) * (-753.231) (-751.975) [-751.703] (-750.983) -- 0:00:57
123000 -- [-753.957] (-756.296) (-750.868) (-753.779) * (-751.602) (-751.572) [-752.630] (-752.600) -- 0:00:57
123500 -- [-751.486] (-756.529) (-751.142) (-750.694) * (-753.154) [-755.400] (-753.517) (-754.183) -- 0:00:56
124000 -- [-752.122] (-751.794) (-751.332) (-750.716) * (-753.337) [-751.422] (-751.078) (-753.417) -- 0:00:56
124500 -- [-751.697] (-751.997) (-752.499) (-752.162) * (-753.806) (-751.400) [-751.180] (-754.986) -- 0:00:56
125000 -- [-753.602] (-752.372) (-752.032) (-750.744) * (-753.460) (-754.762) [-752.130] (-756.432) -- 0:00:56
Average standard deviation of split frequencies: 0.020203
125500 -- (-752.446) (-754.149) [-751.545] (-750.555) * (-755.288) [-754.219] (-751.882) (-757.731) -- 0:00:55
126000 -- (-752.759) (-754.570) [-751.307] (-750.495) * [-750.277] (-752.924) (-751.863) (-752.674) -- 0:00:55
126500 -- (-761.895) (-758.977) (-750.848) [-750.716] * (-751.813) (-751.950) [-754.702] (-751.739) -- 0:00:55
127000 -- (-755.908) (-753.862) (-751.234) [-754.056] * (-756.347) (-753.930) [-750.932] (-751.203) -- 0:00:54
127500 -- (-754.233) (-752.653) [-750.709] (-754.803) * (-754.220) [-752.153] (-759.147) (-752.338) -- 0:01:01
128000 -- (-755.423) [-752.234] (-750.081) (-751.676) * (-752.132) [-750.226] (-756.168) (-755.496) -- 0:01:01
128500 -- [-756.202] (-752.680) (-751.575) (-750.291) * (-751.280) [-751.960] (-752.980) (-754.721) -- 0:01:01
129000 -- (-756.299) (-752.715) (-752.300) [-751.990] * (-751.034) [-751.612] (-757.005) (-750.782) -- 0:01:00
129500 -- [-751.866] (-751.462) (-753.248) (-752.105) * (-753.206) [-752.203] (-751.840) (-751.269) -- 0:01:00
130000 -- [-756.052] (-754.047) (-750.153) (-752.891) * (-752.372) [-752.024] (-752.555) (-754.736) -- 0:01:00
Average standard deviation of split frequencies: 0.018219
130500 -- (-755.595) (-753.174) (-750.459) [-753.600] * (-752.297) [-752.871] (-752.100) (-759.173) -- 0:00:59
131000 -- (-753.512) (-753.764) [-752.677] (-754.905) * [-750.415] (-760.725) (-751.072) (-757.800) -- 0:00:59
131500 -- [-751.667] (-750.286) (-752.397) (-751.148) * (-750.116) (-750.140) (-752.270) [-752.441] -- 0:00:59
132000 -- (-754.421) (-753.972) [-750.798] (-750.732) * (-756.027) [-754.305] (-752.234) (-751.449) -- 0:00:59
132500 -- (-753.072) [-755.198] (-751.233) (-751.018) * (-753.735) (-751.438) (-750.812) [-751.312] -- 0:00:58
133000 -- [-753.078] (-755.304) (-751.043) (-752.955) * (-751.533) (-751.994) (-753.087) [-753.427] -- 0:00:58
133500 -- (-752.824) (-751.747) [-751.411] (-753.716) * (-751.885) [-752.288] (-755.728) (-750.291) -- 0:00:58
134000 -- (-750.290) (-754.636) (-752.832) [-751.344] * [-752.078] (-751.469) (-757.261) (-753.700) -- 0:00:58
134500 -- [-750.197] (-753.179) (-752.980) (-754.573) * (-753.950) (-752.314) (-754.074) [-753.514] -- 0:00:57
135000 -- (-751.147) (-753.315) (-756.653) [-751.086] * [-753.950] (-751.576) (-751.091) (-754.959) -- 0:00:57
Average standard deviation of split frequencies: 0.016984
135500 -- (-752.006) [-753.167] (-755.340) (-751.355) * (-758.145) (-753.518) (-753.479) [-752.391] -- 0:00:57
136000 -- [-753.140] (-755.714) (-751.806) (-751.357) * [-753.263] (-751.949) (-752.658) (-751.815) -- 0:00:57
136500 -- (-753.372) (-752.787) [-750.115] (-755.258) * [-752.923] (-752.086) (-751.335) (-752.396) -- 0:00:56
137000 -- (-753.867) (-750.671) (-750.685) [-753.419] * (-751.558) (-751.505) [-751.528] (-752.737) -- 0:00:56
137500 -- (-751.627) (-750.475) [-751.236] (-754.154) * [-753.968] (-754.446) (-752.193) (-751.603) -- 0:00:56
138000 -- [-756.137] (-752.154) (-751.395) (-754.172) * (-750.766) [-752.249] (-752.610) (-753.509) -- 0:00:56
138500 -- (-754.114) (-753.341) (-756.131) [-752.812] * (-750.621) (-750.477) (-751.620) [-750.969] -- 0:00:55
139000 -- (-755.329) [-753.644] (-754.034) (-753.041) * (-750.251) (-752.508) (-752.087) [-752.167] -- 0:00:55
139500 -- [-752.112] (-755.246) (-756.008) (-753.276) * (-751.551) (-752.042) [-752.573] (-755.935) -- 0:00:55
140000 -- (-750.391) (-752.128) (-755.598) [-752.744] * (-751.267) (-753.304) (-751.662) [-752.540] -- 0:00:55
Average standard deviation of split frequencies: 0.017091
140500 -- (-750.403) [-752.071] (-751.311) (-750.733) * (-750.749) (-752.828) (-752.143) [-754.810] -- 0:00:55
141000 -- (-750.782) (-750.864) [-751.274] (-752.573) * (-751.841) (-752.785) (-751.621) [-752.819] -- 0:00:54
141500 -- (-751.169) (-750.468) [-750.644] (-751.964) * (-754.147) (-753.394) [-751.302] (-752.779) -- 0:00:54
142000 -- (-750.394) (-750.873) [-751.748] (-752.211) * [-752.746] (-754.015) (-751.796) (-752.728) -- 0:00:54
142500 -- (-754.701) (-753.790) (-752.304) [-751.402] * (-750.582) [-751.908] (-754.393) (-751.641) -- 0:00:54
143000 -- [-754.614] (-755.887) (-751.165) (-751.465) * [-751.286] (-750.843) (-754.816) (-751.169) -- 0:00:53
143500 -- [-751.611] (-752.318) (-753.881) (-751.569) * [-751.614] (-752.886) (-750.874) (-752.219) -- 0:00:53
144000 -- (-750.835) (-752.953) (-753.346) [-755.605] * [-752.554] (-757.861) (-753.302) (-751.954) -- 0:00:59
144500 -- (-752.682) [-753.764] (-752.584) (-755.930) * (-755.336) [-751.350] (-751.865) (-755.799) -- 0:00:59
145000 -- [-751.728] (-752.019) (-751.729) (-753.740) * (-751.516) (-751.684) [-751.542] (-753.833) -- 0:00:58
Average standard deviation of split frequencies: 0.016628
145500 -- (-755.239) [-752.317] (-753.752) (-752.512) * (-751.530) [-751.474] (-751.222) (-754.435) -- 0:00:58
146000 -- (-760.748) (-751.740) [-753.429] (-752.638) * (-751.715) (-752.354) [-752.697] (-753.580) -- 0:00:58
146500 -- (-753.436) (-750.577) [-754.878] (-752.865) * (-756.566) (-757.576) (-755.479) [-752.784] -- 0:00:58
147000 -- [-754.369] (-750.527) (-756.113) (-754.163) * (-755.031) (-755.242) [-751.883] (-752.705) -- 0:00:58
147500 -- (-752.748) [-750.785] (-754.232) (-753.195) * (-755.114) (-752.895) [-751.050] (-751.675) -- 0:00:57
148000 -- (-757.253) (-750.668) (-752.298) [-752.097] * (-755.042) (-756.127) (-751.345) [-751.069] -- 0:00:57
148500 -- [-754.882] (-756.374) (-755.276) (-752.541) * (-751.637) (-754.167) [-751.616] (-751.809) -- 0:00:57
149000 -- (-752.958) [-756.511] (-756.492) (-751.595) * (-751.691) (-753.555) (-753.023) [-754.022] -- 0:00:57
149500 -- [-753.157] (-755.773) (-755.176) (-751.886) * (-752.862) [-751.207] (-752.982) (-752.239) -- 0:00:56
150000 -- (-751.297) (-752.053) (-755.342) [-753.583] * [-754.143] (-755.611) (-753.369) (-751.659) -- 0:00:56
Average standard deviation of split frequencies: 0.016583
150500 -- (-752.699) (-752.491) [-754.501] (-752.109) * [-752.933] (-753.335) (-753.207) (-750.298) -- 0:00:56
151000 -- (-753.397) (-751.999) (-752.610) [-751.401] * (-750.436) (-756.250) [-755.310] (-754.148) -- 0:00:56
151500 -- (-752.159) (-751.560) [-753.581] (-753.066) * [-751.853] (-755.809) (-752.144) (-750.748) -- 0:00:56
152000 -- (-752.473) (-753.013) [-754.321] (-751.096) * (-750.517) (-756.141) (-753.313) [-750.549] -- 0:00:55
152500 -- (-751.550) (-751.959) [-752.892] (-755.380) * (-752.780) [-752.830] (-753.888) (-754.957) -- 0:00:55
153000 -- (-753.671) (-752.419) [-754.610] (-754.672) * [-754.889] (-751.257) (-752.246) (-753.140) -- 0:00:55
153500 -- (-755.949) (-754.506) (-752.102) [-753.008] * [-752.012] (-751.422) (-752.496) (-752.841) -- 0:00:55
154000 -- (-752.247) [-752.948] (-751.785) (-752.349) * (-751.089) (-751.725) (-751.097) [-753.155] -- 0:00:54
154500 -- [-751.907] (-751.538) (-754.039) (-754.525) * [-750.311] (-751.040) (-752.651) (-752.676) -- 0:00:54
155000 -- (-755.220) (-755.058) [-751.729] (-752.965) * (-751.547) (-752.083) [-755.965] (-755.797) -- 0:00:54
Average standard deviation of split frequencies: 0.015865
155500 -- [-754.168] (-752.324) (-752.607) (-755.954) * [-752.740] (-751.906) (-754.539) (-754.483) -- 0:00:54
156000 -- (-752.699) [-751.508] (-752.022) (-751.368) * (-751.897) (-751.023) [-750.247] (-751.571) -- 0:00:54
156500 -- (-751.658) (-752.081) (-751.904) [-756.832] * (-752.555) [-753.739] (-756.929) (-754.981) -- 0:00:53
157000 -- [-752.423] (-750.983) (-751.501) (-751.670) * (-754.296) [-751.153] (-753.047) (-754.460) -- 0:00:53
157500 -- (-754.569) (-751.856) (-754.694) [-754.591] * (-750.374) [-750.650] (-755.365) (-755.408) -- 0:00:53
158000 -- (-755.166) (-755.529) [-755.258] (-751.898) * (-750.658) [-750.266] (-754.675) (-756.953) -- 0:00:53
158500 -- (-756.673) (-753.708) (-751.851) [-753.261] * [-752.753] (-752.428) (-755.910) (-751.279) -- 0:00:53
159000 -- (-752.290) (-754.437) [-751.488] (-750.741) * [-751.903] (-752.150) (-756.437) (-752.077) -- 0:00:52
159500 -- (-753.126) [-755.208] (-751.839) (-751.044) * (-751.236) (-752.021) (-754.003) [-753.560] -- 0:00:52
160000 -- (-751.501) (-759.513) (-754.815) [-753.829] * (-750.365) (-755.338) (-753.476) [-752.440] -- 0:00:57
Average standard deviation of split frequencies: 0.016724
160500 -- (-752.518) (-755.395) [-754.005] (-754.965) * [-751.219] (-753.816) (-758.133) (-750.898) -- 0:00:57
161000 -- (-753.465) [-754.716] (-756.239) (-754.771) * [-750.458] (-757.889) (-752.755) (-752.290) -- 0:00:57
161500 -- (-752.969) [-751.057] (-756.166) (-753.914) * (-752.086) (-753.396) [-754.241] (-751.228) -- 0:00:57
162000 -- (-754.154) (-753.380) (-751.155) [-754.617] * (-752.798) [-753.929] (-753.970) (-753.754) -- 0:00:56
162500 -- (-752.131) (-752.699) [-750.988] (-753.482) * (-752.468) (-752.896) (-758.871) [-753.313] -- 0:00:56
163000 -- [-754.931] (-752.695) (-751.290) (-753.011) * (-752.348) (-753.019) [-755.959] (-757.277) -- 0:00:56
163500 -- (-751.267) (-751.027) [-752.546] (-753.273) * [-753.436] (-754.746) (-754.742) (-754.656) -- 0:00:56
164000 -- (-753.468) [-753.475] (-751.548) (-754.040) * (-752.353) [-750.852] (-754.591) (-755.969) -- 0:00:56
164500 -- (-752.780) [-752.937] (-752.169) (-750.947) * (-752.426) (-751.117) (-751.724) [-753.568] -- 0:00:55
165000 -- [-752.982] (-753.326) (-752.914) (-751.770) * (-754.741) [-750.838] (-752.812) (-753.798) -- 0:00:55
Average standard deviation of split frequencies: 0.017749
165500 -- [-751.450] (-751.530) (-751.147) (-753.536) * (-752.837) (-751.525) (-758.591) [-752.623] -- 0:00:55
166000 -- (-753.525) (-750.447) (-753.294) [-751.719] * (-754.258) (-754.545) (-756.940) [-751.687] -- 0:00:55
166500 -- (-755.999) [-750.704] (-752.771) (-754.780) * (-751.394) (-753.305) (-753.248) [-750.532] -- 0:00:55
167000 -- (-753.958) (-751.358) [-752.481] (-752.244) * (-756.527) (-752.270) (-755.678) [-750.956] -- 0:00:54
167500 -- (-753.323) [-752.583] (-752.530) (-752.339) * (-752.116) (-751.417) [-751.347] (-752.449) -- 0:00:54
168000 -- (-752.625) (-752.469) [-753.190] (-751.190) * (-752.862) (-751.738) (-751.314) [-752.709] -- 0:00:54
168500 -- [-751.809] (-751.150) (-751.721) (-751.457) * [-753.105] (-754.405) (-750.533) (-750.881) -- 0:00:54
169000 -- (-753.930) (-752.357) [-752.078] (-752.693) * (-755.661) (-753.937) (-752.862) [-750.172] -- 0:00:54
169500 -- [-753.124] (-752.755) (-755.403) (-753.019) * (-750.569) (-754.981) [-752.345] (-751.754) -- 0:00:53
170000 -- [-751.251] (-752.099) (-750.659) (-751.187) * [-751.185] (-751.173) (-752.455) (-752.584) -- 0:00:53
Average standard deviation of split frequencies: 0.017540
170500 -- [-750.800] (-752.254) (-752.007) (-751.302) * [-753.467] (-752.467) (-752.047) (-750.930) -- 0:00:53
171000 -- (-751.361) (-750.895) (-754.199) [-750.200] * (-756.301) (-753.316) (-756.850) [-753.213] -- 0:00:53
171500 -- (-753.078) [-752.540] (-755.220) (-751.754) * (-754.405) (-750.936) [-751.330] (-753.682) -- 0:00:53
172000 -- (-750.498) (-753.699) (-753.279) [-752.880] * (-752.238) [-750.401] (-753.797) (-752.019) -- 0:00:52
172500 -- [-751.085] (-755.845) (-762.584) (-751.839) * [-753.184] (-753.630) (-753.242) (-752.393) -- 0:00:52
173000 -- (-751.403) (-753.175) (-755.701) [-752.713] * [-753.610] (-752.494) (-752.758) (-752.370) -- 0:00:52
173500 -- (-751.865) (-751.123) (-759.674) [-752.845] * (-753.219) (-752.675) [-751.407] (-753.631) -- 0:00:52
174000 -- [-752.296] (-751.203) (-754.577) (-754.692) * (-750.775) (-753.044) (-751.750) [-754.777] -- 0:00:52
174500 -- (-750.768) (-755.802) (-757.042) [-754.373] * (-754.248) (-754.763) (-755.875) [-751.442] -- 0:00:52
175000 -- [-753.290] (-752.011) (-756.284) (-752.863) * [-754.607] (-753.071) (-753.260) (-754.958) -- 0:00:51
Average standard deviation of split frequencies: 0.017142
175500 -- (-753.426) [-754.557] (-755.520) (-753.250) * (-751.561) (-752.646) (-753.165) [-751.277] -- 0:00:51
176000 -- (-750.773) (-750.814) [-751.833] (-751.206) * (-751.000) (-752.499) (-761.093) [-751.348] -- 0:00:56
176500 -- (-751.509) [-752.066] (-754.968) (-752.098) * (-756.626) (-751.177) (-752.224) [-750.666] -- 0:00:55
177000 -- [-752.868] (-751.844) (-754.217) (-750.691) * [-753.192] (-754.100) (-751.685) (-752.113) -- 0:00:55
177500 -- (-751.113) (-754.263) (-754.869) [-754.245] * (-754.367) (-752.871) [-751.557] (-754.267) -- 0:00:55
178000 -- (-751.311) [-754.575] (-755.685) (-754.792) * (-752.047) (-752.991) [-750.805] (-750.910) -- 0:00:55
178500 -- (-751.019) (-753.332) [-755.162] (-753.818) * (-752.285) (-753.003) (-752.423) [-751.149] -- 0:00:55
179000 -- [-753.131] (-750.384) (-752.617) (-752.833) * (-751.969) (-759.277) (-752.249) [-751.248] -- 0:00:55
179500 -- [-752.899] (-750.606) (-754.348) (-757.295) * [-753.034] (-755.497) (-750.962) (-751.081) -- 0:00:54
180000 -- (-751.606) [-755.409] (-755.938) (-754.560) * (-750.856) [-752.534] (-751.674) (-754.358) -- 0:00:54
Average standard deviation of split frequencies: 0.017029
180500 -- [-752.931] (-752.373) (-754.364) (-751.765) * (-752.428) [-751.792] (-751.200) (-753.617) -- 0:00:54
181000 -- (-752.997) [-752.488] (-753.074) (-752.511) * (-753.842) [-754.557] (-751.189) (-752.826) -- 0:00:54
181500 -- (-752.040) [-751.294] (-755.837) (-753.620) * (-753.274) [-750.520] (-751.906) (-752.983) -- 0:00:54
182000 -- (-752.125) [-752.742] (-759.454) (-752.387) * [-753.095] (-754.647) (-751.942) (-751.759) -- 0:00:53
182500 -- (-752.107) (-752.029) [-753.144] (-750.785) * (-751.296) [-750.119] (-754.050) (-753.323) -- 0:00:53
183000 -- (-755.141) (-755.369) [-752.989] (-751.449) * [-752.440] (-752.755) (-752.582) (-751.610) -- 0:00:53
183500 -- (-751.102) (-757.685) (-751.586) [-753.618] * (-751.959) (-755.699) [-751.280] (-753.329) -- 0:00:53
184000 -- [-751.291] (-750.624) (-751.432) (-755.019) * (-751.465) (-760.866) (-751.548) [-754.676] -- 0:00:53
184500 -- [-750.690] (-750.558) (-752.092) (-753.244) * (-752.678) [-752.609] (-752.962) (-756.094) -- 0:00:53
185000 -- (-752.072) (-751.476) (-752.572) [-753.884] * (-756.132) (-755.280) [-751.745] (-751.788) -- 0:00:52
Average standard deviation of split frequencies: 0.017474
185500 -- [-752.000] (-750.376) (-756.469) (-751.512) * (-753.127) [-755.842] (-753.450) (-752.683) -- 0:00:52
186000 -- [-752.675] (-751.763) (-753.186) (-754.170) * (-751.768) (-754.337) [-750.877] (-751.747) -- 0:00:52
186500 -- [-750.684] (-753.531) (-750.789) (-755.584) * [-750.817] (-751.225) (-752.324) (-752.589) -- 0:00:52
187000 -- (-753.754) (-753.552) [-752.728] (-752.026) * (-751.959) (-751.743) [-757.910] (-754.174) -- 0:00:52
187500 -- (-752.060) (-753.589) [-752.587] (-751.483) * [-750.931] (-753.719) (-750.616) (-751.861) -- 0:00:52
188000 -- (-752.027) [-751.531] (-751.136) (-752.551) * (-751.778) (-751.602) (-754.455) [-752.639] -- 0:00:51
188500 -- (-752.372) [-754.091] (-753.315) (-753.218) * (-750.161) [-752.639] (-758.538) (-752.094) -- 0:00:51
189000 -- (-756.658) [-753.037] (-752.145) (-750.940) * (-754.427) [-751.096] (-756.455) (-751.272) -- 0:00:51
189500 -- (-753.441) (-754.772) (-758.701) [-751.751] * (-753.750) (-757.107) (-752.663) [-751.442] -- 0:00:51
190000 -- [-753.326] (-753.602) (-750.591) (-751.217) * (-752.930) (-751.487) [-751.707] (-751.686) -- 0:00:51
Average standard deviation of split frequencies: 0.016757
190500 -- [-753.714] (-755.330) (-752.419) (-751.554) * (-754.898) [-751.732] (-754.437) (-754.128) -- 0:00:50
191000 -- (-752.363) [-752.679] (-753.671) (-755.622) * (-750.574) [-753.030] (-753.511) (-755.197) -- 0:00:50
191500 -- (-750.637) (-756.091) (-751.541) [-752.529] * (-750.878) (-751.183) (-753.007) [-757.720] -- 0:00:50
192000 -- [-750.307] (-754.562) (-750.690) (-758.330) * [-751.632] (-755.247) (-755.430) (-753.112) -- 0:00:50
192500 -- (-750.748) (-752.636) (-751.772) [-755.277] * (-753.592) [-751.376] (-753.875) (-751.865) -- 0:00:54
193000 -- (-753.128) (-753.995) [-751.542] (-753.596) * [-753.919] (-752.732) (-753.839) (-754.260) -- 0:00:54
193500 -- (-752.957) (-752.197) [-751.568] (-751.692) * (-751.780) (-753.493) [-750.926] (-756.139) -- 0:00:54
194000 -- (-753.621) (-753.967) (-752.921) [-753.308] * [-752.244] (-753.065) (-752.050) (-752.837) -- 0:00:54
194500 -- (-757.326) (-753.017) [-751.945] (-754.649) * (-750.978) (-757.260) (-754.722) [-754.162] -- 0:00:53
195000 -- (-752.589) (-750.643) (-752.730) [-755.042] * (-753.766) [-755.797] (-756.042) (-754.798) -- 0:00:53
Average standard deviation of split frequencies: 0.016168
195500 -- (-751.689) (-755.665) [-751.709] (-751.476) * (-751.856) [-751.476] (-751.670) (-751.749) -- 0:00:53
196000 -- (-751.613) (-753.627) [-751.269] (-757.950) * (-755.508) [-753.911] (-753.204) (-751.718) -- 0:00:53
196500 -- (-751.279) (-751.708) [-750.376] (-755.329) * (-752.461) [-751.087] (-750.625) (-752.840) -- 0:00:53
197000 -- (-751.236) (-752.872) [-752.483] (-754.189) * (-752.541) [-750.834] (-754.361) (-755.034) -- 0:00:52
197500 -- (-750.620) (-755.986) (-750.258) [-750.827] * (-756.430) (-752.170) (-751.617) [-753.167] -- 0:00:52
198000 -- (-750.498) (-753.254) (-757.524) [-750.822] * (-756.249) (-751.329) [-751.564] (-756.023) -- 0:00:52
198500 -- (-752.689) (-751.725) (-753.097) [-752.970] * [-751.459] (-750.561) (-750.927) (-753.297) -- 0:00:52
199000 -- [-750.963] (-750.375) (-754.409) (-754.368) * (-752.482) (-751.719) (-753.960) [-751.444] -- 0:00:52
199500 -- [-752.639] (-752.390) (-751.569) (-752.462) * (-752.015) (-752.947) (-754.467) [-753.197] -- 0:00:52
200000 -- (-754.120) (-750.907) (-753.441) [-754.356] * [-751.397] (-753.396) (-753.110) (-751.204) -- 0:00:51
Average standard deviation of split frequencies: 0.016705
200500 -- (-753.712) (-752.311) [-754.126] (-756.196) * (-752.981) (-752.657) (-752.830) [-751.512] -- 0:00:51
201000 -- [-753.082] (-752.850) (-752.653) (-751.693) * (-750.661) (-754.690) (-752.581) [-751.846] -- 0:00:51
201500 -- (-757.001) [-753.288] (-754.837) (-751.509) * [-755.438] (-753.323) (-753.096) (-753.213) -- 0:00:51
202000 -- [-750.510] (-750.798) (-759.821) (-754.279) * (-757.089) (-752.789) (-752.807) [-751.500] -- 0:00:51
202500 -- (-752.330) (-755.979) [-752.375] (-751.481) * (-757.117) [-750.981] (-752.448) (-751.448) -- 0:00:51
203000 -- [-752.897] (-750.677) (-752.329) (-751.647) * [-752.221] (-751.350) (-755.374) (-754.304) -- 0:00:51
203500 -- (-755.697) (-750.873) (-751.958) [-755.368] * (-752.178) (-752.091) (-753.739) [-752.944] -- 0:00:50
204000 -- [-754.351] (-753.061) (-750.759) (-752.827) * (-752.970) (-751.756) (-753.628) [-751.362] -- 0:00:50
204500 -- (-757.983) (-752.506) (-751.136) [-751.224] * (-753.041) (-753.469) (-750.943) [-751.274] -- 0:00:50
205000 -- (-752.407) [-754.557] (-754.462) (-753.776) * [-750.984] (-751.939) (-760.925) (-751.641) -- 0:00:50
Average standard deviation of split frequencies: 0.016527
205500 -- (-753.165) (-755.218) [-752.525] (-752.373) * [-751.287] (-752.320) (-755.898) (-752.416) -- 0:00:50
206000 -- (-750.237) (-756.624) (-750.222) [-754.018] * (-754.213) (-751.356) (-756.663) [-750.790] -- 0:00:50
206500 -- (-750.303) (-755.444) [-750.341] (-752.348) * (-754.304) (-753.852) [-753.122] (-754.765) -- 0:00:49
207000 -- (-751.812) [-752.205] (-751.124) (-752.577) * (-753.020) (-754.585) [-752.909] (-750.626) -- 0:00:49
207500 -- (-750.208) (-750.594) (-751.327) [-752.313] * (-750.337) (-753.996) (-754.827) [-750.465] -- 0:00:49
208000 -- (-752.223) [-751.098] (-751.867) (-752.098) * (-753.041) [-753.840] (-750.698) (-751.115) -- 0:00:49
208500 -- (-752.181) [-751.840] (-750.715) (-751.790) * (-752.829) (-751.634) (-751.198) [-751.212] -- 0:00:53
209000 -- (-751.562) [-750.726] (-753.230) (-751.711) * (-751.882) (-751.916) (-752.958) [-757.206] -- 0:00:52
209500 -- (-751.680) (-752.301) [-752.337] (-752.810) * (-752.074) (-750.570) (-753.179) [-753.115] -- 0:00:52
210000 -- (-754.710) [-752.358] (-752.767) (-752.005) * (-750.712) (-750.884) (-753.021) [-755.046] -- 0:00:52
Average standard deviation of split frequencies: 0.016534
210500 -- (-751.331) [-752.962] (-751.857) (-753.286) * (-753.172) (-750.100) (-752.525) [-754.471] -- 0:00:52
211000 -- (-754.126) (-756.487) (-753.987) [-753.395] * [-752.323] (-755.184) (-753.065) (-750.741) -- 0:00:52
211500 -- [-752.821] (-756.857) (-752.404) (-750.636) * [-752.032] (-751.872) (-755.732) (-752.570) -- 0:00:52
212000 -- [-754.354] (-756.269) (-751.703) (-751.097) * (-756.263) [-750.308] (-755.030) (-752.674) -- 0:00:52
212500 -- [-751.141] (-751.269) (-751.972) (-750.599) * (-752.090) (-752.042) (-751.232) [-754.846] -- 0:00:51
213000 -- (-751.628) (-753.791) [-751.344] (-753.984) * (-752.545) (-755.267) (-751.586) [-754.594] -- 0:00:51
213500 -- (-751.024) [-750.403] (-752.079) (-755.358) * (-752.917) (-754.031) [-753.221] (-755.268) -- 0:00:51
214000 -- (-751.249) (-751.701) [-752.721] (-752.135) * [-751.860] (-756.030) (-755.146) (-758.441) -- 0:00:51
214500 -- (-754.194) (-757.572) (-753.818) [-755.455] * (-750.968) (-755.506) [-755.475] (-750.639) -- 0:00:51
215000 -- (-753.163) (-755.397) [-754.553] (-752.248) * [-750.884] (-752.487) (-753.073) (-753.085) -- 0:00:51
Average standard deviation of split frequencies: 0.018187
215500 -- (-750.721) (-752.270) [-753.784] (-750.949) * [-755.033] (-751.060) (-755.981) (-751.761) -- 0:00:50
216000 -- (-751.804) (-754.573) [-751.436] (-751.960) * (-755.057) (-756.130) [-751.109] (-752.134) -- 0:00:50
216500 -- (-753.065) (-755.367) [-753.406] (-752.648) * [-750.772] (-751.498) (-752.908) (-750.872) -- 0:00:50
217000 -- (-754.300) (-753.416) (-754.095) [-752.888] * (-757.096) (-750.621) (-751.362) [-753.334] -- 0:00:50
217500 -- (-753.147) [-753.541] (-752.015) (-755.144) * [-754.247] (-751.213) (-752.141) (-753.571) -- 0:00:50
218000 -- (-752.404) (-751.691) [-750.578] (-755.247) * (-752.588) (-751.659) (-754.632) [-752.126] -- 0:00:50
218500 -- [-753.847] (-751.061) (-750.824) (-753.561) * (-752.778) [-752.512] (-752.716) (-752.589) -- 0:00:50
219000 -- (-752.586) (-750.267) (-753.209) [-753.292] * (-754.292) [-751.182] (-752.810) (-752.129) -- 0:00:49
219500 -- [-752.377] (-753.421) (-754.248) (-755.620) * (-758.546) [-751.660] (-752.213) (-751.486) -- 0:00:49
220000 -- (-751.023) [-753.328] (-754.944) (-753.939) * (-755.338) [-752.551] (-753.161) (-752.970) -- 0:00:49
Average standard deviation of split frequencies: 0.017090
220500 -- (-753.494) (-752.161) (-754.871) [-751.953] * (-754.817) [-755.313] (-751.029) (-759.300) -- 0:00:49
221000 -- (-753.966) (-752.161) [-753.817] (-752.420) * (-753.923) (-754.401) [-753.806] (-754.095) -- 0:00:49
221500 -- [-754.478] (-750.236) (-755.146) (-754.457) * (-754.844) [-753.595] (-754.407) (-754.339) -- 0:00:49
222000 -- [-752.484] (-753.189) (-755.399) (-750.921) * (-753.278) (-753.671) (-753.480) [-753.832] -- 0:00:49
222500 -- [-751.294] (-753.554) (-753.135) (-757.979) * (-753.093) [-752.040] (-754.722) (-752.957) -- 0:00:48
223000 -- (-753.241) [-754.484] (-751.416) (-756.587) * (-754.549) (-750.995) [-751.444] (-751.111) -- 0:00:48
223500 -- (-756.179) (-752.559) [-752.559] (-754.081) * (-756.484) [-750.873] (-754.336) (-751.078) -- 0:00:48
224000 -- (-755.371) [-751.419] (-754.609) (-751.590) * (-755.318) (-750.654) (-752.035) [-751.099] -- 0:00:48
224500 -- [-751.938] (-751.058) (-753.548) (-750.609) * (-750.721) (-752.347) (-750.286) [-751.269] -- 0:00:48
225000 -- (-752.051) (-751.158) (-755.105) [-751.297] * (-750.570) (-758.593) [-752.144] (-752.717) -- 0:00:51
Average standard deviation of split frequencies: 0.017846
225500 -- (-751.545) (-751.243) (-752.345) [-751.318] * (-753.140) (-758.610) [-752.701] (-751.383) -- 0:00:51
226000 -- (-752.010) [-751.038] (-752.617) (-756.472) * (-753.738) (-755.719) (-753.493) [-750.624] -- 0:00:51
226500 -- [-752.026] (-752.975) (-752.566) (-754.265) * (-751.966) [-753.688] (-753.398) (-753.627) -- 0:00:51
227000 -- (-752.592) (-754.528) [-751.433] (-754.819) * (-751.224) (-754.898) [-754.687] (-757.121) -- 0:00:51
227500 -- (-752.038) (-754.481) [-755.873] (-754.542) * [-750.500] (-751.885) (-751.538) (-751.060) -- 0:00:50
228000 -- (-750.788) [-754.187] (-753.371) (-754.306) * (-751.026) [-754.426] (-757.306) (-752.671) -- 0:00:50
228500 -- (-756.123) [-752.418] (-752.373) (-753.626) * (-750.508) (-754.916) [-752.414] (-752.421) -- 0:00:50
229000 -- (-753.215) (-753.809) [-750.722] (-756.305) * (-753.299) (-759.722) [-752.421] (-753.801) -- 0:00:50
229500 -- [-752.165] (-754.672) (-750.746) (-751.843) * (-751.204) [-753.742] (-756.202) (-757.486) -- 0:00:50
230000 -- (-757.051) (-755.120) [-752.362] (-752.282) * (-751.649) [-751.747] (-751.951) (-755.762) -- 0:00:50
Average standard deviation of split frequencies: 0.017031
230500 -- (-754.680) [-755.151] (-752.336) (-753.683) * [-752.720] (-754.090) (-751.037) (-751.329) -- 0:00:50
231000 -- [-757.487] (-753.708) (-759.729) (-753.752) * (-759.282) [-750.806] (-750.937) (-753.421) -- 0:00:49
231500 -- [-751.443] (-753.911) (-757.061) (-754.394) * (-754.694) [-750.885] (-752.308) (-754.776) -- 0:00:49
232000 -- [-752.443] (-751.501) (-751.016) (-755.964) * [-751.646] (-750.991) (-751.687) (-753.399) -- 0:00:49
232500 -- (-753.930) (-752.048) (-751.187) [-753.347] * [-754.105] (-753.917) (-751.783) (-750.894) -- 0:00:49
233000 -- (-757.724) (-750.409) (-751.004) [-750.116] * (-754.051) (-754.739) [-751.896] (-751.163) -- 0:00:49
233500 -- (-758.170) (-750.478) [-753.420] (-751.146) * (-750.377) [-752.166] (-754.470) (-752.838) -- 0:00:49
234000 -- (-752.838) [-750.915] (-753.817) (-755.023) * (-752.850) (-752.108) (-750.798) [-752.177] -- 0:00:49
234500 -- (-752.259) [-751.372] (-753.517) (-758.150) * (-754.068) [-752.532] (-751.514) (-756.985) -- 0:00:48
235000 -- (-753.215) (-753.549) (-750.797) [-755.083] * (-750.636) [-751.231] (-757.375) (-752.198) -- 0:00:48
Average standard deviation of split frequencies: 0.018188
235500 -- (-753.918) [-750.307] (-752.459) (-755.627) * [-754.838] (-751.443) (-754.856) (-751.440) -- 0:00:48
236000 -- (-755.273) (-751.903) (-752.035) [-752.740] * (-752.144) [-750.837] (-750.868) (-753.748) -- 0:00:48
236500 -- (-752.017) (-752.243) (-755.644) [-752.753] * (-751.652) [-751.102] (-753.430) (-751.107) -- 0:00:48
237000 -- (-753.600) (-755.813) (-754.234) [-751.288] * (-753.588) [-752.684] (-752.105) (-754.109) -- 0:00:48
237500 -- (-753.839) [-756.236] (-753.517) (-752.597) * (-752.867) (-754.445) [-750.718] (-753.220) -- 0:00:48
238000 -- (-756.002) (-755.712) (-753.611) [-754.618] * (-757.365) [-750.544] (-755.919) (-754.503) -- 0:00:48
238500 -- (-759.188) (-752.688) (-755.421) [-752.528] * [-752.326] (-752.074) (-753.882) (-757.773) -- 0:00:47
239000 -- [-751.358] (-753.207) (-753.395) (-754.179) * (-755.611) (-750.417) [-755.022] (-751.685) -- 0:00:47
239500 -- (-750.846) (-751.470) (-751.989) [-753.066] * (-752.832) [-750.417] (-752.573) (-751.768) -- 0:00:47
240000 -- (-751.559) (-751.403) (-755.041) [-751.956] * [-754.648] (-752.021) (-752.460) (-751.475) -- 0:00:47
Average standard deviation of split frequencies: 0.016592
240500 -- (-751.125) (-752.742) [-750.867] (-754.327) * (-753.732) [-752.255] (-755.151) (-751.632) -- 0:00:47
241000 -- (-753.432) (-752.370) (-757.969) [-754.734] * (-754.657) (-754.126) [-753.317] (-751.139) -- 0:00:47
241500 -- [-751.931] (-751.445) (-759.063) (-752.419) * [-752.875] (-751.461) (-754.516) (-752.263) -- 0:00:50
242000 -- [-752.581] (-754.476) (-755.989) (-750.576) * [-751.676] (-753.106) (-754.209) (-751.157) -- 0:00:50
242500 -- (-751.732) (-751.580) [-751.745] (-755.927) * [-754.173] (-752.650) (-750.733) (-752.425) -- 0:00:49
243000 -- (-753.500) (-751.387) [-752.597] (-751.862) * (-752.014) (-751.957) [-750.640] (-754.977) -- 0:00:49
243500 -- (-752.166) [-752.367] (-756.006) (-752.257) * [-751.667] (-753.554) (-752.601) (-753.308) -- 0:00:49
244000 -- [-752.746] (-753.883) (-750.989) (-752.400) * (-751.538) (-751.159) (-752.997) [-753.038] -- 0:00:49
244500 -- (-751.349) (-753.057) (-753.286) [-751.034] * (-752.808) [-751.711] (-753.201) (-752.891) -- 0:00:49
245000 -- [-752.084] (-757.723) (-750.740) (-754.684) * (-752.263) (-751.645) [-754.254] (-752.630) -- 0:00:49
Average standard deviation of split frequencies: 0.015894
245500 -- [-750.699] (-755.629) (-756.659) (-753.543) * (-753.122) [-753.045] (-753.783) (-752.731) -- 0:00:49
246000 -- [-753.389] (-752.616) (-754.591) (-752.845) * [-751.566] (-752.257) (-754.113) (-752.749) -- 0:00:49
246500 -- [-752.292] (-753.571) (-752.236) (-750.909) * (-752.846) (-753.658) [-752.943] (-752.659) -- 0:00:48
247000 -- (-751.160) [-751.938] (-750.679) (-752.234) * [-753.040] (-757.208) (-750.564) (-757.120) -- 0:00:48
247500 -- (-754.404) [-750.755] (-753.803) (-754.997) * (-757.513) [-753.887] (-750.777) (-756.007) -- 0:00:48
248000 -- (-751.519) (-752.321) (-751.092) [-751.233] * [-751.690] (-751.092) (-755.088) (-753.193) -- 0:00:48
248500 -- [-751.060] (-753.606) (-753.462) (-755.016) * (-750.814) (-753.476) (-753.613) [-754.785] -- 0:00:48
249000 -- (-755.805) [-752.649] (-752.825) (-751.242) * (-752.866) (-751.421) (-751.007) [-751.030] -- 0:00:48
249500 -- (-752.994) [-751.110] (-753.111) (-752.126) * (-753.560) [-751.291] (-751.167) (-755.832) -- 0:00:48
250000 -- [-752.651] (-758.342) (-759.216) (-750.305) * (-757.392) (-751.934) (-751.846) [-754.316] -- 0:00:48
Average standard deviation of split frequencies: 0.015358
250500 -- (-751.188) (-752.485) [-752.907] (-750.346) * (-752.475) [-751.601] (-751.291) (-755.303) -- 0:00:47
251000 -- (-754.655) (-755.530) (-751.234) [-750.854] * (-753.369) (-753.260) (-752.178) [-753.943] -- 0:00:47
251500 -- (-756.545) [-754.316] (-753.303) (-752.254) * [-752.900] (-753.410) (-751.220) (-752.511) -- 0:00:47
252000 -- (-754.121) (-753.391) (-752.735) [-752.130] * (-755.445) [-752.662] (-752.016) (-754.861) -- 0:00:47
252500 -- (-753.548) (-756.164) [-752.815] (-753.235) * [-753.422] (-751.279) (-751.067) (-752.974) -- 0:00:47
253000 -- [-751.997] (-755.210) (-751.504) (-751.835) * (-751.027) (-753.876) [-754.243] (-755.035) -- 0:00:47
253500 -- (-751.249) [-755.542] (-751.945) (-751.907) * (-753.600) (-753.820) (-752.781) [-751.804] -- 0:00:47
254000 -- (-753.513) (-751.388) [-752.568] (-752.745) * (-752.261) (-752.093) [-750.746] (-752.219) -- 0:00:46
254500 -- (-751.595) [-752.022] (-751.374) (-750.810) * (-754.645) [-751.600] (-751.242) (-750.726) -- 0:00:46
255000 -- (-753.233) (-757.486) (-752.711) [-754.163] * [-751.890] (-751.030) (-751.566) (-751.650) -- 0:00:46
Average standard deviation of split frequencies: 0.014731
255500 -- [-754.816] (-756.988) (-754.793) (-751.646) * (-752.592) (-750.398) (-756.046) [-752.151] -- 0:00:46
256000 -- [-752.917] (-753.434) (-752.557) (-752.131) * (-752.783) (-752.163) [-755.146] (-754.506) -- 0:00:46
256500 -- (-754.810) (-753.025) [-752.531] (-752.361) * [-752.479] (-752.624) (-758.458) (-753.845) -- 0:00:46
257000 -- (-753.845) (-751.758) [-755.978] (-751.298) * (-753.903) [-752.854] (-753.204) (-752.291) -- 0:00:46
257500 -- (-754.520) (-751.411) [-752.362] (-751.034) * (-753.433) [-752.134] (-753.327) (-753.438) -- 0:00:46
258000 -- [-752.087] (-751.991) (-752.247) (-753.782) * (-754.373) [-751.908] (-750.786) (-752.622) -- 0:00:46
258500 -- (-756.053) [-751.943] (-753.507) (-753.935) * [-752.365] (-756.258) (-750.622) (-752.871) -- 0:00:48
259000 -- [-755.736] (-752.217) (-750.535) (-752.565) * (-750.929) [-754.845] (-752.903) (-752.839) -- 0:00:48
259500 -- (-753.342) [-752.681] (-752.808) (-753.476) * [-750.637] (-755.662) (-751.391) (-755.018) -- 0:00:48
260000 -- (-753.456) [-752.543] (-754.116) (-752.118) * [-753.510] (-753.179) (-750.163) (-758.007) -- 0:00:48
Average standard deviation of split frequencies: 0.014255
260500 -- [-751.739] (-753.189) (-753.064) (-753.801) * (-752.093) (-751.487) [-750.132] (-754.006) -- 0:00:48
261000 -- (-754.402) (-757.585) (-752.500) [-750.257] * (-751.640) (-752.333) (-754.641) [-751.919] -- 0:00:48
261500 -- (-754.389) (-756.785) [-753.191] (-751.842) * [-753.921] (-752.921) (-751.054) (-751.911) -- 0:00:48
262000 -- (-758.846) (-751.973) (-754.244) [-753.068] * (-752.712) (-754.421) [-753.801] (-754.209) -- 0:00:47
262500 -- [-757.797] (-751.345) (-753.632) (-750.809) * (-753.389) (-755.149) [-751.270] (-755.685) -- 0:00:47
263000 -- (-752.411) (-752.984) [-750.886] (-756.453) * [-752.021] (-750.393) (-751.023) (-755.218) -- 0:00:47
263500 -- (-751.996) (-753.508) [-753.101] (-752.041) * (-752.858) [-752.126] (-750.606) (-756.591) -- 0:00:47
264000 -- (-752.770) (-751.779) (-753.845) [-752.490] * (-753.298) (-754.755) [-751.134] (-752.059) -- 0:00:47
264500 -- [-751.766] (-753.607) (-751.554) (-751.874) * (-754.647) [-755.768] (-750.856) (-752.126) -- 0:00:47
265000 -- (-755.726) (-754.212) [-750.864] (-751.819) * (-752.991) (-752.459) (-750.584) [-754.349] -- 0:00:47
Average standard deviation of split frequencies: 0.015162
265500 -- [-753.411] (-752.131) (-751.149) (-752.204) * [-753.805] (-754.410) (-751.464) (-755.263) -- 0:00:47
266000 -- [-756.724] (-757.848) (-753.125) (-751.319) * [-754.322] (-757.230) (-752.732) (-754.666) -- 0:00:46
266500 -- (-753.728) (-750.862) [-752.851] (-754.243) * (-753.297) (-754.979) [-753.545] (-752.763) -- 0:00:46
267000 -- (-756.598) (-756.625) (-750.351) [-753.086] * (-752.990) (-754.404) (-751.583) [-750.461] -- 0:00:46
267500 -- (-754.945) (-751.531) [-750.799] (-753.048) * (-752.290) [-752.738] (-751.175) (-752.620) -- 0:00:46
268000 -- [-755.035] (-751.125) (-750.746) (-753.227) * [-751.132] (-754.016) (-751.625) (-754.125) -- 0:00:46
268500 -- (-752.055) [-754.147] (-754.253) (-751.186) * (-756.733) (-750.987) [-750.300] (-754.376) -- 0:00:46
269000 -- (-756.457) [-752.085] (-754.319) (-751.900) * [-753.528] (-751.447) (-752.983) (-753.289) -- 0:00:46
269500 -- (-754.880) (-753.439) (-753.559) [-754.167] * (-750.943) (-752.270) (-753.960) [-752.485] -- 0:00:46
270000 -- [-754.505] (-750.380) (-755.485) (-752.194) * (-756.326) [-757.901] (-754.864) (-751.176) -- 0:00:45
Average standard deviation of split frequencies: 0.013933
270500 -- [-754.792] (-754.828) (-752.329) (-751.765) * (-750.977) (-757.015) (-754.970) [-755.550] -- 0:00:45
271000 -- (-750.781) (-752.698) [-751.580] (-752.106) * (-751.840) [-755.308] (-751.489) (-751.758) -- 0:00:45
271500 -- (-752.193) [-752.949] (-751.023) (-751.965) * (-751.968) (-752.777) (-752.140) [-752.023] -- 0:00:45
272000 -- (-750.959) (-752.070) [-751.494] (-750.317) * (-751.210) [-751.822] (-751.625) (-752.023) -- 0:00:45
272500 -- (-752.992) [-752.613] (-753.996) (-750.564) * (-752.553) (-753.140) [-751.915] (-751.509) -- 0:00:45
273000 -- (-753.113) [-751.738] (-752.611) (-752.402) * (-751.474) (-753.072) [-750.966] (-753.678) -- 0:00:45
273500 -- [-753.987] (-750.755) (-753.957) (-750.566) * [-750.964] (-751.749) (-752.745) (-753.477) -- 0:00:45
274000 -- [-751.615] (-751.669) (-752.143) (-755.553) * (-754.609) (-752.623) [-751.692] (-752.070) -- 0:00:45
274500 -- [-750.402] (-754.311) (-754.215) (-755.442) * (-751.863) (-750.317) [-751.739] (-753.328) -- 0:00:44
275000 -- (-750.089) (-751.056) [-751.520] (-754.661) * [-755.331] (-750.084) (-751.514) (-751.517) -- 0:00:47
Average standard deviation of split frequencies: 0.012056
275500 -- (-751.555) (-757.727) [-750.552] (-751.626) * (-753.600) [-750.638] (-756.973) (-751.536) -- 0:00:47
276000 -- (-752.493) (-757.973) [-751.136] (-751.184) * [-752.957] (-750.378) (-751.751) (-751.084) -- 0:00:47
276500 -- [-752.626] (-752.029) (-752.887) (-753.264) * (-754.033) (-752.842) (-754.382) [-756.393] -- 0:00:47
277000 -- (-755.818) (-751.948) [-757.901] (-755.556) * (-754.020) (-753.968) (-753.262) [-755.941] -- 0:00:46
277500 -- [-752.124] (-755.092) (-753.514) (-752.592) * (-752.412) (-754.018) [-750.429] (-754.603) -- 0:00:46
278000 -- [-754.531] (-753.828) (-753.251) (-751.989) * [-751.644] (-753.273) (-752.840) (-751.964) -- 0:00:46
278500 -- (-752.585) (-751.476) (-751.938) [-751.448] * (-755.430) (-752.918) (-752.866) [-751.306] -- 0:00:46
279000 -- (-759.477) (-752.927) [-756.349] (-753.590) * (-751.673) (-758.414) [-754.514] (-751.735) -- 0:00:46
279500 -- (-753.850) (-754.904) [-752.443] (-757.195) * (-751.759) [-752.858] (-752.593) (-750.353) -- 0:00:46
280000 -- (-752.450) (-752.218) (-750.912) [-754.632] * (-751.169) [-752.467] (-753.723) (-751.243) -- 0:00:46
Average standard deviation of split frequencies: 0.011362
280500 -- (-754.122) (-755.804) [-750.914] (-752.045) * (-759.595) [-752.828] (-754.482) (-753.027) -- 0:00:46
281000 -- (-751.952) [-752.282] (-751.243) (-756.392) * (-752.490) (-753.903) (-751.446) [-754.933] -- 0:00:46
281500 -- (-751.548) [-753.616] (-752.176) (-758.237) * (-754.982) [-750.966] (-751.539) (-756.897) -- 0:00:45
282000 -- [-751.069] (-753.594) (-751.095) (-756.429) * [-753.369] (-750.974) (-753.577) (-750.644) -- 0:00:45
282500 -- (-753.005) (-751.216) [-751.125] (-751.801) * (-751.906) (-752.571) [-753.266] (-751.684) -- 0:00:45
283000 -- (-754.614) (-754.664) (-752.326) [-753.080] * (-750.673) [-750.679] (-750.441) (-754.748) -- 0:00:45
283500 -- (-752.776) (-753.257) [-752.768] (-756.473) * [-750.578] (-751.562) (-752.162) (-752.564) -- 0:00:45
284000 -- (-753.488) (-752.117) [-754.571] (-754.982) * (-753.087) [-751.307] (-755.612) (-753.637) -- 0:00:45
284500 -- [-753.450] (-753.389) (-753.233) (-752.438) * [-752.282] (-750.892) (-755.087) (-754.156) -- 0:00:45
285000 -- (-752.561) (-755.396) (-751.170) [-752.190] * (-752.295) [-751.351] (-753.326) (-754.788) -- 0:00:45
Average standard deviation of split frequencies: 0.010956
285500 -- (-751.422) (-755.253) [-755.450] (-752.287) * [-753.036] (-751.768) (-755.626) (-752.758) -- 0:00:45
286000 -- [-751.055] (-758.349) (-752.399) (-750.505) * (-753.699) (-756.390) [-750.739] (-752.192) -- 0:00:44
286500 -- (-755.610) (-752.058) [-750.768] (-754.811) * [-753.121] (-754.002) (-751.809) (-751.391) -- 0:00:44
287000 -- (-751.231) [-751.696] (-752.837) (-750.701) * [-754.120] (-757.432) (-752.091) (-752.359) -- 0:00:44
287500 -- (-752.826) [-752.195] (-750.649) (-750.571) * [-755.033] (-756.935) (-753.226) (-752.556) -- 0:00:44
288000 -- (-757.990) [-752.489] (-750.081) (-750.324) * (-751.711) [-752.813] (-753.213) (-752.832) -- 0:00:44
288500 -- (-753.630) (-751.529) [-753.871] (-751.216) * (-753.318) [-752.407] (-752.015) (-758.510) -- 0:00:44
289000 -- [-752.603] (-758.258) (-751.664) (-750.697) * (-751.054) [-750.161] (-754.630) (-752.634) -- 0:00:44
289500 -- [-756.406] (-755.821) (-751.297) (-751.515) * (-756.038) (-750.491) [-754.225] (-751.684) -- 0:00:44
290000 -- (-753.633) [-757.298] (-756.134) (-751.306) * [-754.570] (-751.310) (-754.325) (-751.428) -- 0:00:44
Average standard deviation of split frequencies: 0.010589
290500 -- (-750.825) [-751.450] (-753.441) (-751.565) * (-753.181) (-751.985) [-751.631] (-752.579) -- 0:00:43
291000 -- (-750.678) (-751.487) [-752.530] (-752.701) * (-755.963) [-752.498] (-752.707) (-752.240) -- 0:00:43
291500 -- (-751.788) (-751.974) [-754.023] (-755.128) * (-750.981) [-753.101] (-752.855) (-752.169) -- 0:00:46
292000 -- (-755.511) (-751.487) (-753.984) [-751.566] * [-751.283] (-757.490) (-752.983) (-751.538) -- 0:00:46
292500 -- [-751.645] (-757.641) (-752.183) (-751.130) * (-750.284) (-753.213) (-751.914) [-751.046] -- 0:00:45
293000 -- (-751.890) [-750.921] (-753.212) (-753.353) * [-750.332] (-753.116) (-753.575) (-756.379) -- 0:00:45
293500 -- [-752.179] (-751.785) (-755.370) (-755.028) * (-754.946) (-752.887) (-751.258) [-752.599] -- 0:00:45
294000 -- (-753.690) [-751.986] (-754.179) (-757.769) * (-752.820) [-752.185] (-751.025) (-755.370) -- 0:00:45
294500 -- (-751.792) (-754.908) [-751.457] (-759.217) * (-755.786) (-752.515) [-751.223] (-753.814) -- 0:00:45
295000 -- (-750.770) [-754.978] (-750.994) (-759.620) * (-753.556) [-753.221] (-751.324) (-753.751) -- 0:00:45
Average standard deviation of split frequencies: 0.010492
295500 -- [-751.070] (-751.353) (-751.533) (-754.064) * (-753.983) [-751.384] (-750.662) (-753.357) -- 0:00:45
296000 -- [-753.045] (-753.283) (-751.730) (-750.786) * (-754.735) [-754.663] (-751.705) (-758.023) -- 0:00:45
296500 -- (-753.941) (-751.075) (-751.996) [-752.026] * (-753.166) [-751.934] (-753.391) (-750.848) -- 0:00:45
297000 -- (-751.115) (-751.536) [-751.651] (-754.294) * (-755.914) [-751.048] (-752.028) (-752.905) -- 0:00:44
297500 -- (-757.915) [-752.542] (-751.962) (-752.133) * [-751.637] (-752.369) (-750.232) (-750.695) -- 0:00:44
298000 -- [-752.755] (-752.844) (-752.283) (-751.639) * (-754.597) (-759.775) [-750.379] (-750.695) -- 0:00:44
298500 -- [-752.567] (-754.961) (-752.217) (-751.087) * (-754.714) (-757.141) (-754.400) [-753.835] -- 0:00:44
299000 -- (-752.309) (-750.623) (-754.992) [-750.925] * (-752.113) (-758.257) [-754.479] (-753.276) -- 0:00:44
299500 -- (-752.605) (-751.045) (-754.833) [-752.771] * (-752.247) (-753.584) [-751.844] (-752.920) -- 0:00:44
300000 -- [-751.639] (-752.346) (-752.408) (-756.398) * (-755.509) (-751.597) (-752.919) [-750.807] -- 0:00:44
Average standard deviation of split frequencies: 0.011528
300500 -- (-755.149) (-753.313) [-754.332] (-751.609) * [-750.630] (-751.785) (-753.266) (-752.023) -- 0:00:44
301000 -- (-752.869) [-754.242] (-754.281) (-750.808) * [-751.134] (-753.379) (-750.440) (-752.654) -- 0:00:44
301500 -- (-754.010) (-751.834) (-752.545) [-753.331] * [-752.314] (-758.925) (-751.865) (-751.669) -- 0:00:44
302000 -- (-752.180) [-751.160] (-754.841) (-752.233) * [-754.294] (-753.178) (-750.444) (-750.553) -- 0:00:43
302500 -- (-751.576) (-751.750) [-754.830] (-753.598) * (-752.257) [-750.462] (-755.030) (-750.195) -- 0:00:43
303000 -- (-751.797) (-753.063) (-751.480) [-755.949] * [-755.271] (-753.937) (-752.343) (-750.076) -- 0:00:43
303500 -- [-753.967] (-750.358) (-752.120) (-750.958) * (-751.708) (-756.410) [-752.669] (-752.775) -- 0:00:43
304000 -- [-753.859] (-750.353) (-750.931) (-752.089) * (-751.761) (-755.285) [-753.391] (-750.185) -- 0:00:43
304500 -- (-753.733) [-752.953] (-751.318) (-754.241) * (-752.371) (-755.609) [-750.770] (-753.690) -- 0:00:43
305000 -- (-753.747) (-754.398) [-751.880] (-758.407) * (-752.008) [-753.549] (-752.566) (-752.307) -- 0:00:43
Average standard deviation of split frequencies: 0.011041
305500 -- (-752.363) (-750.759) [-750.951] (-755.573) * (-755.539) (-751.874) [-753.315] (-751.368) -- 0:00:43
306000 -- (-750.780) (-756.215) (-753.071) [-752.915] * (-752.306) [-751.729] (-753.737) (-750.305) -- 0:00:43
306500 -- [-751.884] (-752.025) (-754.060) (-750.355) * (-752.878) (-753.013) [-754.616] (-750.838) -- 0:00:42
307000 -- (-752.957) (-755.617) (-754.467) [-750.630] * (-752.878) (-755.164) (-755.143) [-752.292] -- 0:00:42
307500 -- [-752.151] (-753.389) (-757.379) (-753.626) * (-756.041) [-753.620] (-750.457) (-753.938) -- 0:00:42
308000 -- (-752.723) [-752.027] (-755.485) (-754.015) * (-753.958) [-750.811] (-753.725) (-752.387) -- 0:00:44
308500 -- (-754.620) [-753.186] (-756.570) (-755.392) * (-752.475) [-753.394] (-754.006) (-751.115) -- 0:00:44
309000 -- (-753.406) (-753.428) (-753.598) [-751.782] * [-751.136] (-751.554) (-750.981) (-755.281) -- 0:00:44
309500 -- (-753.304) [-750.528] (-752.213) (-753.778) * (-752.430) (-751.584) (-754.953) [-751.482] -- 0:00:44
310000 -- (-751.744) (-751.486) (-751.976) [-752.797] * (-751.900) [-754.593] (-752.977) (-753.887) -- 0:00:44
Average standard deviation of split frequencies: 0.012139
310500 -- (-751.000) (-754.166) (-752.365) [-752.207] * (-754.506) [-751.991] (-750.782) (-752.207) -- 0:00:44
311000 -- [-754.383] (-752.834) (-753.126) (-751.125) * (-751.852) (-752.192) [-751.298] (-752.554) -- 0:00:44
311500 -- (-751.164) [-752.005] (-752.450) (-752.330) * (-752.351) [-752.060] (-750.684) (-751.476) -- 0:00:44
312000 -- [-753.680] (-752.572) (-751.546) (-754.272) * (-753.243) (-750.562) (-750.669) [-752.096] -- 0:00:44
312500 -- (-755.740) (-753.705) [-751.593] (-754.431) * (-751.718) [-751.933] (-750.840) (-754.231) -- 0:00:44
313000 -- (-751.863) (-757.498) (-753.045) [-752.718] * (-752.507) [-751.478] (-751.201) (-754.066) -- 0:00:43
313500 -- (-752.595) [-751.643] (-754.187) (-752.086) * [-751.934] (-754.010) (-752.772) (-751.290) -- 0:00:43
314000 -- (-754.478) (-753.743) (-751.003) [-752.903] * (-751.438) [-754.316] (-754.306) (-751.834) -- 0:00:43
314500 -- [-751.925] (-755.355) (-755.097) (-752.953) * (-750.713) (-753.921) (-752.620) [-751.297] -- 0:00:43
315000 -- [-751.586] (-752.455) (-752.543) (-751.668) * [-752.677] (-753.432) (-752.510) (-752.723) -- 0:00:43
Average standard deviation of split frequencies: 0.010794
315500 -- (-751.645) (-753.120) [-752.887] (-751.520) * [-753.131] (-752.905) (-758.015) (-753.590) -- 0:00:43
316000 -- (-752.867) (-750.925) [-756.789] (-754.958) * [-753.698] (-752.991) (-752.025) (-750.452) -- 0:00:43
316500 -- (-753.090) (-754.506) [-754.535] (-751.843) * [-752.343] (-753.123) (-753.023) (-752.117) -- 0:00:43
317000 -- (-751.287) (-755.471) (-750.615) [-752.682] * [-755.050] (-758.248) (-751.848) (-751.943) -- 0:00:43
317500 -- [-752.087] (-751.246) (-752.059) (-753.506) * (-752.568) [-750.311] (-753.736) (-755.573) -- 0:00:42
318000 -- (-752.890) (-753.220) (-751.206) [-754.188] * [-750.793] (-752.213) (-752.871) (-751.458) -- 0:00:42
318500 -- [-752.397] (-756.686) (-750.876) (-752.167) * (-752.331) (-751.838) (-752.787) [-754.978] -- 0:00:42
319000 -- (-754.454) (-753.003) (-751.677) [-754.452] * [-751.190] (-750.398) (-752.723) (-752.534) -- 0:00:42
319500 -- (-754.627) [-751.504] (-751.139) (-752.360) * (-755.046) (-750.475) (-752.167) [-751.329] -- 0:00:42
320000 -- (-753.839) (-750.654) [-754.759] (-752.623) * (-752.751) (-753.749) (-752.298) [-751.526] -- 0:00:42
Average standard deviation of split frequencies: 0.010118
320500 -- [-751.398] (-750.654) (-752.086) (-752.962) * (-753.624) (-753.320) (-754.190) [-750.769] -- 0:00:42
321000 -- (-751.630) (-751.248) (-751.673) [-752.565] * (-751.870) [-754.647] (-754.333) (-752.699) -- 0:00:42
321500 -- (-751.572) [-751.164] (-752.401) (-750.252) * (-751.609) (-751.795) [-750.968] (-751.474) -- 0:00:42
322000 -- (-752.115) (-751.229) [-750.886] (-750.038) * (-752.723) [-752.776] (-753.342) (-752.208) -- 0:00:42
322500 -- (-753.902) (-757.155) (-753.131) [-752.120] * (-750.577) (-754.747) (-752.773) [-751.375] -- 0:00:42
323000 -- (-751.457) (-756.491) [-753.119] (-755.168) * [-750.763] (-751.991) (-752.525) (-753.510) -- 0:00:41
323500 -- [-752.588] (-752.101) (-751.656) (-753.281) * (-750.937) [-751.827] (-751.969) (-752.915) -- 0:00:41
324000 -- (-750.195) (-753.241) (-752.590) [-754.500] * [-751.356] (-754.923) (-755.182) (-750.871) -- 0:00:41
324500 -- (-752.489) (-751.659) [-752.388] (-751.137) * (-751.949) (-752.733) (-754.454) [-751.522] -- 0:00:43
325000 -- (-753.686) (-756.417) [-751.500] (-753.966) * (-750.933) (-754.059) [-753.447] (-751.359) -- 0:00:43
Average standard deviation of split frequencies: 0.011006
325500 -- [-750.811] (-751.810) (-751.515) (-754.586) * [-752.953] (-752.008) (-753.964) (-750.112) -- 0:00:43
326000 -- [-754.148] (-752.026) (-750.974) (-751.373) * (-753.281) (-755.991) (-754.757) [-750.661] -- 0:00:43
326500 -- [-750.499] (-751.836) (-752.036) (-750.857) * (-751.518) [-752.030] (-750.601) (-750.813) -- 0:00:43
327000 -- (-750.540) [-751.974] (-752.207) (-755.121) * (-752.365) [-751.759] (-751.316) (-755.011) -- 0:00:43
327500 -- (-754.114) (-751.928) [-756.113] (-757.210) * (-753.933) (-755.063) (-751.397) [-750.776] -- 0:00:43
328000 -- [-752.555] (-751.583) (-753.456) (-751.404) * (-752.656) (-755.076) [-751.685] (-754.103) -- 0:00:43
328500 -- [-752.002] (-750.731) (-750.725) (-751.658) * (-757.047) [-753.290] (-750.512) (-753.244) -- 0:00:42
329000 -- [-752.827] (-753.708) (-751.040) (-751.548) * (-753.205) (-751.727) [-751.612] (-753.021) -- 0:00:42
329500 -- (-753.191) (-757.059) [-753.970] (-753.035) * (-752.592) [-755.977] (-754.148) (-753.500) -- 0:00:42
330000 -- (-751.626) [-753.720] (-750.970) (-751.382) * (-752.600) (-753.198) [-753.870] (-753.579) -- 0:00:42
Average standard deviation of split frequencies: 0.010930
330500 -- (-751.973) (-752.592) (-752.316) [-751.666] * (-753.553) (-751.419) (-751.358) [-752.425] -- 0:00:42
331000 -- (-752.946) [-751.231] (-750.634) (-750.279) * [-755.272] (-754.006) (-753.302) (-751.340) -- 0:00:42
331500 -- (-752.602) (-751.464) (-751.791) [-750.559] * (-751.688) (-751.791) [-751.491] (-751.012) -- 0:00:42
332000 -- (-752.040) (-751.815) [-753.758] (-759.226) * (-752.535) (-751.653) (-755.751) [-750.500] -- 0:00:42
332500 -- (-754.457) [-752.087] (-751.306) (-761.125) * (-752.437) [-750.487] (-752.614) (-750.651) -- 0:00:42
333000 -- [-753.186] (-757.489) (-752.021) (-753.711) * (-750.713) [-754.662] (-753.928) (-751.765) -- 0:00:42
333500 -- (-751.899) [-751.972] (-756.194) (-755.742) * [-753.710] (-755.757) (-752.368) (-751.249) -- 0:00:41
334000 -- (-752.246) (-751.510) [-754.258] (-752.276) * (-751.294) [-757.026] (-751.802) (-753.465) -- 0:00:41
334500 -- (-751.993) (-752.872) [-752.751] (-753.848) * [-751.477] (-753.397) (-750.785) (-751.701) -- 0:00:41
335000 -- (-753.183) (-753.780) [-750.930] (-752.266) * (-752.206) [-752.569] (-752.115) (-752.052) -- 0:00:41
Average standard deviation of split frequencies: 0.009986
335500 -- [-754.329] (-752.238) (-752.358) (-752.735) * (-753.261) [-752.035] (-752.997) (-756.726) -- 0:00:41
336000 -- (-753.314) [-750.976] (-753.574) (-752.685) * (-752.154) [-752.335] (-751.336) (-755.057) -- 0:00:41
336500 -- [-753.373] (-752.750) (-751.218) (-752.299) * (-752.338) (-752.528) [-751.006] (-751.034) -- 0:00:41
337000 -- (-752.472) (-760.651) [-750.404] (-751.940) * (-752.603) (-753.908) (-751.100) [-751.018] -- 0:00:41
337500 -- (-751.517) [-753.346] (-753.246) (-751.305) * (-754.087) (-754.570) (-751.270) [-753.532] -- 0:00:41
338000 -- [-752.318] (-751.666) (-753.031) (-755.865) * (-750.543) (-754.590) [-756.615] (-753.082) -- 0:00:41
338500 -- [-755.492] (-752.102) (-753.617) (-752.295) * (-751.388) (-754.588) [-751.352] (-758.287) -- 0:00:41
339000 -- (-750.832) (-752.576) (-753.204) [-752.689] * (-755.123) (-755.070) (-759.305) [-755.794] -- 0:00:40
339500 -- (-752.144) (-751.126) [-755.419] (-753.394) * (-750.695) (-756.153) [-751.731] (-752.111) -- 0:00:40
340000 -- [-752.479] (-752.253) (-754.589) (-750.739) * [-751.859] (-752.020) (-758.728) (-752.499) -- 0:00:40
Average standard deviation of split frequencies: 0.010256
340500 -- [-754.052] (-751.417) (-751.207) (-752.726) * (-750.460) [-750.816] (-754.123) (-751.124) -- 0:00:40
341000 -- (-751.842) [-750.789] (-752.715) (-750.650) * (-752.920) (-752.531) (-751.835) [-751.385] -- 0:00:42
341500 -- (-751.758) (-754.946) (-754.567) [-751.438] * (-752.189) [-751.799] (-758.099) (-751.105) -- 0:00:42
342000 -- (-750.924) [-759.731] (-751.437) (-752.103) * (-753.355) (-751.356) [-753.575] (-756.645) -- 0:00:42
342500 -- [-751.131] (-758.641) (-751.696) (-752.882) * (-751.942) (-751.141) (-750.372) [-752.987] -- 0:00:42
343000 -- (-752.440) [-753.922] (-752.726) (-753.142) * (-751.597) (-752.752) (-752.912) [-752.757] -- 0:00:42
343500 -- (-754.145) (-752.179) [-751.488] (-751.650) * (-752.626) [-754.424] (-751.437) (-754.563) -- 0:00:42
344000 -- (-751.639) (-750.891) [-750.415] (-753.649) * (-751.194) (-754.252) (-750.817) [-751.610] -- 0:00:41
344500 -- [-751.761] (-753.703) (-752.702) (-752.667) * (-752.987) (-751.883) [-750.709] (-751.695) -- 0:00:41
345000 -- (-752.732) (-751.979) (-751.401) [-754.618] * (-756.655) [-751.257] (-755.154) (-752.635) -- 0:00:41
Average standard deviation of split frequencies: 0.009840
345500 -- [-751.732] (-755.155) (-751.550) (-752.913) * (-751.088) (-750.289) [-751.884] (-754.330) -- 0:00:41
346000 -- [-752.186] (-757.136) (-752.075) (-750.216) * (-752.873) (-750.750) (-753.603) [-753.783] -- 0:00:41
346500 -- (-751.975) (-753.970) [-751.369] (-752.796) * [-751.634] (-751.050) (-753.744) (-755.014) -- 0:00:41
347000 -- (-753.324) (-751.612) [-751.837] (-756.020) * (-752.158) [-750.581] (-751.993) (-753.541) -- 0:00:41
347500 -- (-755.065) (-752.320) [-750.781] (-754.963) * (-756.294) (-750.488) [-752.847] (-750.926) -- 0:00:41
348000 -- [-750.114] (-756.281) (-753.689) (-753.920) * [-754.402] (-757.499) (-755.026) (-753.522) -- 0:00:41
348500 -- [-751.516] (-751.736) (-751.018) (-759.701) * (-755.699) [-754.194] (-752.466) (-754.856) -- 0:00:41
349000 -- (-750.911) [-753.816] (-751.938) (-756.962) * (-751.793) (-750.519) (-751.145) [-751.608] -- 0:00:41
349500 -- (-751.824) (-752.353) (-752.949) [-750.498] * (-750.990) (-751.141) (-752.883) [-751.756] -- 0:00:40
350000 -- [-753.344] (-752.602) (-752.132) (-750.408) * (-752.146) (-752.021) [-752.264] (-754.501) -- 0:00:40
Average standard deviation of split frequencies: 0.009261
350500 -- (-754.533) [-751.257] (-755.415) (-751.181) * (-752.544) (-752.097) (-751.152) [-751.474] -- 0:00:40
351000 -- (-751.779) (-752.785) [-751.375] (-751.723) * (-751.755) [-753.366] (-753.036) (-752.521) -- 0:00:40
351500 -- (-752.161) [-750.818] (-754.355) (-750.953) * (-752.609) (-753.536) (-762.595) [-753.369] -- 0:00:40
352000 -- [-750.619] (-756.220) (-751.498) (-752.076) * (-751.182) [-751.680] (-756.980) (-753.094) -- 0:00:40
352500 -- (-751.190) [-752.763] (-751.793) (-751.198) * (-751.282) (-751.999) [-754.766] (-751.204) -- 0:00:40
353000 -- (-751.977) [-750.899] (-751.451) (-751.664) * (-750.278) (-755.811) (-754.814) [-751.809] -- 0:00:40
353500 -- (-750.640) [-753.652] (-751.959) (-751.847) * [-751.692] (-756.318) (-757.178) (-750.939) -- 0:00:40
354000 -- [-753.050] (-753.851) (-753.881) (-753.539) * [-753.771] (-753.014) (-754.345) (-751.800) -- 0:00:40
354500 -- [-752.789] (-754.001) (-750.924) (-751.925) * [-752.879] (-752.064) (-752.386) (-753.750) -- 0:00:40
355000 -- [-753.418] (-751.578) (-756.878) (-752.569) * [-757.559] (-752.261) (-752.646) (-751.376) -- 0:00:39
Average standard deviation of split frequencies: 0.008958
355500 -- (-757.202) (-754.646) (-754.236) [-755.668] * (-753.761) [-754.596] (-752.562) (-751.002) -- 0:00:39
356000 -- (-753.844) [-754.170] (-750.669) (-753.686) * (-752.549) (-753.502) [-752.344] (-752.357) -- 0:00:39
356500 -- (-753.682) (-752.626) [-752.897] (-756.331) * [-751.557] (-751.844) (-753.329) (-751.891) -- 0:00:39
357000 -- (-754.633) (-751.545) [-750.763] (-761.347) * (-751.288) [-751.337] (-753.423) (-752.141) -- 0:00:39
357500 -- (-754.297) (-753.595) (-750.824) [-751.075] * (-753.350) [-752.495] (-757.308) (-756.634) -- 0:00:39
358000 -- (-754.050) [-751.398] (-752.569) (-751.629) * [-754.055] (-755.669) (-753.738) (-752.904) -- 0:00:41
358500 -- (-753.615) (-754.534) (-750.753) [-752.907] * (-758.560) (-754.060) [-754.226] (-752.961) -- 0:00:41
359000 -- (-754.162) (-758.544) [-754.013] (-754.639) * [-751.713] (-751.255) (-757.792) (-757.047) -- 0:00:41
359500 -- (-752.886) (-752.644) (-752.679) [-753.501] * (-751.362) (-753.952) (-754.168) [-754.155] -- 0:00:40
360000 -- (-754.152) (-751.438) (-754.018) [-753.342] * [-752.349] (-752.955) (-754.034) (-753.637) -- 0:00:40
Average standard deviation of split frequencies: 0.009658
360500 -- (-752.168) (-751.405) [-752.913] (-753.989) * (-753.190) [-752.866] (-755.349) (-754.051) -- 0:00:40
361000 -- (-756.065) [-751.511] (-750.549) (-755.587) * [-750.869] (-756.504) (-757.091) (-751.596) -- 0:00:40
361500 -- [-751.608] (-755.101) (-755.532) (-751.636) * (-752.116) (-751.720) [-752.758] (-752.704) -- 0:00:40
362000 -- (-757.912) (-750.594) [-754.334] (-752.627) * (-751.350) [-756.648] (-753.053) (-751.870) -- 0:00:40
362500 -- (-754.910) (-751.440) (-750.620) [-753.682] * [-755.246] (-751.877) (-751.917) (-751.287) -- 0:00:40
363000 -- [-754.096] (-754.273) (-752.842) (-750.473) * [-751.471] (-751.661) (-754.335) (-752.425) -- 0:00:40
363500 -- (-753.225) [-750.900] (-752.593) (-752.783) * (-751.575) [-755.328] (-752.413) (-751.830) -- 0:00:40
364000 -- (-752.839) (-755.370) [-751.130] (-752.000) * (-752.491) (-756.369) [-753.071] (-751.951) -- 0:00:40
364500 -- (-752.078) (-751.660) [-750.911] (-751.763) * (-753.366) (-756.364) (-754.643) [-752.696] -- 0:00:40
365000 -- (-751.849) [-755.219] (-750.986) (-754.473) * [-753.048] (-752.939) (-752.067) (-751.415) -- 0:00:40
Average standard deviation of split frequencies: 0.010089
365500 -- (-752.416) (-753.564) (-751.386) [-753.467] * (-754.585) (-752.378) [-751.007] (-755.076) -- 0:00:39
366000 -- (-754.284) (-756.709) [-751.334] (-755.795) * (-754.087) (-752.326) [-750.759] (-752.829) -- 0:00:39
366500 -- (-753.427) [-752.553] (-750.346) (-753.467) * (-753.754) [-753.187] (-752.959) (-751.850) -- 0:00:39
367000 -- (-753.626) (-756.763) [-751.138] (-752.193) * (-751.149) (-754.157) (-753.186) [-750.918] -- 0:00:39
367500 -- (-754.497) (-760.980) (-751.589) [-751.720] * [-752.282] (-750.953) (-751.933) (-751.141) -- 0:00:39
368000 -- (-753.486) (-752.593) [-752.936] (-753.401) * [-751.064] (-750.899) (-750.544) (-751.938) -- 0:00:39
368500 -- (-752.239) [-750.995] (-753.080) (-753.242) * (-752.052) [-750.502] (-750.755) (-753.115) -- 0:00:39
369000 -- (-752.273) (-752.084) (-752.974) [-752.009] * (-751.619) (-750.249) [-751.911] (-750.215) -- 0:00:39
369500 -- (-751.054) [-751.214] (-754.860) (-753.861) * (-752.062) (-750.688) [-752.333] (-751.128) -- 0:00:39
370000 -- (-752.182) (-751.850) (-757.259) [-755.220] * (-752.486) (-750.758) [-753.217] (-752.174) -- 0:00:39
Average standard deviation of split frequencies: 0.010025
370500 -- (-752.146) [-752.471] (-754.802) (-751.985) * (-751.663) (-751.257) (-751.304) [-752.718] -- 0:00:39
371000 -- (-751.054) (-755.261) (-754.012) [-752.084] * (-753.984) [-751.288] (-750.369) (-754.216) -- 0:00:38
371500 -- (-751.676) (-755.937) [-753.333] (-750.738) * [-750.960] (-751.450) (-752.419) (-754.223) -- 0:00:38
372000 -- (-751.087) (-752.787) [-755.235] (-754.229) * (-750.331) (-757.186) (-751.245) [-752.446] -- 0:00:38
372500 -- (-752.973) (-754.433) (-750.437) [-754.173] * (-753.486) (-753.508) [-752.620] (-754.493) -- 0:00:38
373000 -- [-751.833] (-751.661) (-751.853) (-751.110) * [-753.573] (-752.586) (-750.866) (-753.635) -- 0:00:38
373500 -- [-753.138] (-751.262) (-751.417) (-752.277) * [-751.447] (-752.284) (-751.708) (-751.785) -- 0:00:38
374000 -- (-751.218) (-751.350) (-750.387) [-750.120] * (-758.423) (-762.592) [-751.183] (-752.271) -- 0:00:38
374500 -- (-753.674) [-753.901] (-750.360) (-751.321) * (-754.041) [-752.993] (-752.958) (-752.224) -- 0:00:40
375000 -- (-754.670) (-751.342) (-751.378) [-756.047] * (-754.312) [-753.289] (-752.940) (-754.329) -- 0:00:40
Average standard deviation of split frequencies: 0.010915
375500 -- [-752.719] (-751.110) (-750.755) (-751.347) * (-751.594) (-751.151) (-751.529) [-752.752] -- 0:00:39
376000 -- (-751.972) (-751.247) [-754.848] (-751.796) * (-751.942) [-755.860] (-752.763) (-755.328) -- 0:00:39
376500 -- (-753.804) (-751.637) (-752.748) [-752.502] * (-754.950) (-754.683) [-751.296] (-753.000) -- 0:00:39
377000 -- (-753.120) (-755.278) [-751.001] (-752.020) * (-755.759) (-751.022) [-754.167] (-756.890) -- 0:00:39
377500 -- (-750.485) (-754.522) [-751.208] (-754.426) * (-751.682) [-750.686] (-752.209) (-754.359) -- 0:00:39
378000 -- (-752.950) (-751.069) (-751.184) [-754.437] * (-750.618) (-751.305) [-751.026] (-752.251) -- 0:00:39
378500 -- (-752.817) (-750.621) (-754.334) [-751.497] * (-753.831) (-751.322) (-752.058) [-751.571] -- 0:00:39
379000 -- (-754.227) (-753.637) [-754.732] (-752.820) * (-752.705) [-751.771] (-752.890) (-753.107) -- 0:00:39
379500 -- (-756.350) (-751.658) [-752.177] (-753.689) * [-752.041] (-754.520) (-753.521) (-752.641) -- 0:00:39
380000 -- (-752.814) (-751.165) [-751.993] (-755.246) * (-752.526) (-752.429) (-753.391) [-751.012] -- 0:00:39
Average standard deviation of split frequencies: 0.010708
380500 -- (-753.196) [-752.342] (-753.441) (-754.116) * (-752.392) (-753.914) [-752.425] (-755.298) -- 0:00:39
381000 -- [-751.052] (-750.992) (-752.172) (-752.568) * [-751.831] (-752.821) (-752.667) (-756.144) -- 0:00:38
381500 -- [-751.527] (-753.830) (-752.133) (-750.210) * (-752.525) (-753.912) [-750.403] (-751.127) -- 0:00:38
382000 -- (-752.258) (-752.137) [-751.138] (-751.896) * (-751.764) (-750.523) [-751.475] (-751.257) -- 0:00:38
382500 -- [-752.099] (-755.180) (-752.422) (-751.339) * (-750.821) (-751.524) (-753.532) [-751.082] -- 0:00:38
383000 -- (-754.511) (-753.052) [-753.308] (-751.539) * (-751.628) (-751.107) [-751.459] (-753.840) -- 0:00:38
383500 -- (-751.691) (-750.601) [-752.694] (-750.651) * (-751.572) (-756.597) (-756.269) [-753.106] -- 0:00:38
384000 -- (-751.294) (-753.280) [-752.669] (-751.026) * (-753.082) (-751.076) [-753.587] (-751.169) -- 0:00:38
384500 -- (-751.503) (-753.204) [-750.435] (-753.882) * [-752.498] (-752.540) (-752.381) (-752.542) -- 0:00:38
385000 -- [-753.086] (-752.870) (-750.875) (-752.075) * (-753.184) (-755.413) [-752.316] (-751.195) -- 0:00:38
Average standard deviation of split frequencies: 0.009986
385500 -- [-752.502] (-752.184) (-750.446) (-752.030) * (-751.979) (-751.460) (-754.909) [-751.594] -- 0:00:38
386000 -- (-751.683) (-752.730) [-750.420] (-752.068) * [-752.810] (-752.464) (-751.356) (-752.087) -- 0:00:38
386500 -- [-750.399] (-752.942) (-755.300) (-751.914) * (-754.232) (-752.226) (-751.411) [-754.418] -- 0:00:38
387000 -- (-759.371) [-751.627] (-751.697) (-751.602) * (-755.293) (-752.416) [-753.608] (-751.073) -- 0:00:38
387500 -- (-751.299) (-757.464) [-753.019] (-750.500) * (-754.077) (-752.579) [-752.758] (-750.880) -- 0:00:37
388000 -- (-754.470) (-754.805) (-753.027) [-750.710] * [-753.314] (-752.977) (-752.877) (-752.707) -- 0:00:37
388500 -- (-751.451) (-753.682) (-755.170) [-753.325] * (-752.336) (-753.070) (-754.946) [-751.823] -- 0:00:37
389000 -- (-752.181) (-751.896) [-752.938] (-759.681) * (-751.965) [-752.201] (-751.620) (-751.405) -- 0:00:37
389500 -- [-754.604] (-751.818) (-751.029) (-751.825) * (-753.389) (-750.828) (-756.683) [-750.037] -- 0:00:37
390000 -- (-755.055) (-754.249) (-750.838) [-752.202] * (-756.128) (-754.683) [-752.236] (-750.770) -- 0:00:37
Average standard deviation of split frequencies: 0.010221
390500 -- (-756.550) (-750.816) [-753.467] (-753.244) * [-756.675] (-751.163) (-751.836) (-752.733) -- 0:00:39
391000 -- (-753.894) [-750.361] (-755.374) (-750.356) * (-753.763) (-753.578) (-751.659) [-753.283] -- 0:00:38
391500 -- (-756.441) [-750.288] (-751.354) (-752.257) * (-753.732) (-754.411) (-751.904) [-751.582] -- 0:00:38
392000 -- (-751.627) (-750.826) [-753.977] (-752.294) * (-753.645) [-753.916] (-750.376) (-751.510) -- 0:00:38
392500 -- [-750.622] (-750.459) (-752.827) (-755.886) * (-751.655) (-752.686) (-754.294) [-752.057] -- 0:00:38
393000 -- (-752.045) (-759.482) [-752.075] (-753.094) * [-751.726] (-751.465) (-752.532) (-753.763) -- 0:00:38
393500 -- (-753.802) (-752.891) [-752.862] (-751.558) * (-752.014) (-753.011) (-751.701) [-754.469] -- 0:00:38
394000 -- (-753.811) [-752.095] (-752.829) (-750.449) * (-752.930) [-750.571] (-752.850) (-751.715) -- 0:00:38
394500 -- (-754.863) (-751.515) [-756.558] (-756.637) * [-750.206] (-752.615) (-752.248) (-753.935) -- 0:00:38
395000 -- (-751.822) (-752.310) [-751.203] (-751.693) * (-751.335) (-754.066) (-757.325) [-752.043] -- 0:00:38
Average standard deviation of split frequencies: 0.009873
395500 -- (-757.462) (-752.228) (-750.761) [-751.655] * [-751.898] (-752.480) (-750.906) (-752.140) -- 0:00:38
396000 -- (-751.810) (-758.952) (-751.180) [-751.477] * (-754.024) [-751.003] (-751.493) (-752.374) -- 0:00:38
396500 -- (-750.572) (-752.769) [-753.646] (-754.077) * (-752.896) (-751.926) (-753.776) [-751.313] -- 0:00:38
397000 -- (-750.459) (-753.354) (-751.404) [-750.287] * (-754.883) (-754.927) [-753.446] (-753.658) -- 0:00:37
397500 -- [-752.158] (-753.260) (-754.722) (-750.757) * (-753.912) (-751.331) [-750.659] (-752.408) -- 0:00:37
398000 -- [-751.310] (-757.011) (-752.908) (-753.058) * [-754.241] (-752.032) (-753.086) (-753.293) -- 0:00:37
398500 -- (-752.780) (-755.882) [-752.916] (-752.708) * (-754.190) [-751.907] (-753.029) (-751.462) -- 0:00:37
399000 -- (-750.983) (-756.840) (-751.906) [-752.681] * (-754.243) [-750.962] (-751.225) (-752.884) -- 0:00:37
399500 -- (-754.161) (-750.633) [-752.774] (-753.028) * [-754.422] (-751.951) (-752.982) (-751.273) -- 0:00:37
400000 -- [-750.830] (-751.074) (-752.369) (-755.162) * (-752.862) (-751.306) (-750.692) [-752.700] -- 0:00:37
Average standard deviation of split frequencies: 0.010866
400500 -- (-750.798) (-752.032) [-754.182] (-752.223) * (-757.587) [-751.896] (-752.277) (-752.287) -- 0:00:37
401000 -- (-750.530) (-755.120) (-753.724) [-752.078] * (-755.322) (-752.829) (-750.765) [-750.996] -- 0:00:37
401500 -- (-753.363) [-752.923] (-752.017) (-751.921) * (-751.322) [-752.015] (-750.437) (-752.150) -- 0:00:37
402000 -- (-751.723) (-755.145) (-751.751) [-751.205] * (-751.545) [-754.260] (-757.139) (-752.347) -- 0:00:37
402500 -- [-753.676] (-752.023) (-754.258) (-751.396) * (-751.875) (-752.120) [-753.844] (-754.319) -- 0:00:37
403000 -- (-750.884) [-752.136] (-752.683) (-751.124) * (-753.158) (-753.850) [-750.185] (-751.983) -- 0:00:37
403500 -- (-753.566) [-752.547] (-754.414) (-754.056) * (-753.996) (-754.059) [-750.716] (-750.166) -- 0:00:36
404000 -- (-752.604) (-751.262) (-753.251) [-751.267] * (-751.160) [-752.568] (-754.738) (-750.925) -- 0:00:36
404500 -- (-754.509) (-751.878) (-753.100) [-754.998] * (-752.250) [-758.311] (-756.417) (-752.897) -- 0:00:36
405000 -- [-754.935] (-752.176) (-753.412) (-756.968) * (-758.077) (-753.683) (-756.070) [-755.713] -- 0:00:36
Average standard deviation of split frequencies: 0.009699
405500 -- (-751.811) (-754.363) [-750.968] (-754.138) * (-751.953) (-753.786) [-750.485] (-750.381) -- 0:00:36
406000 -- (-752.255) (-750.696) [-751.025] (-754.096) * [-753.530] (-757.636) (-752.122) (-751.603) -- 0:00:36
406500 -- (-751.097) [-751.970] (-752.051) (-751.679) * (-753.788) (-752.257) [-750.601] (-751.473) -- 0:00:36
407000 -- (-750.796) (-755.335) [-752.491] (-752.173) * (-758.109) [-753.886] (-751.860) (-756.729) -- 0:00:37
407500 -- (-751.177) (-754.733) (-754.283) [-754.247] * (-752.019) (-751.111) (-754.331) [-752.614] -- 0:00:37
408000 -- (-752.056) (-752.608) [-753.580] (-753.910) * (-752.055) (-752.488) (-750.604) [-752.370] -- 0:00:37
408500 -- (-753.068) (-752.748) [-750.700] (-752.347) * (-753.181) [-750.105] (-751.894) (-752.028) -- 0:00:37
409000 -- [-752.839] (-752.761) (-762.521) (-755.507) * [-752.027] (-751.234) (-752.089) (-752.913) -- 0:00:37
409500 -- (-753.749) [-751.043] (-753.450) (-755.499) * (-753.355) [-752.925] (-750.796) (-753.779) -- 0:00:37
410000 -- (-752.329) [-750.710] (-754.603) (-755.914) * (-753.352) (-755.229) [-750.942] (-756.316) -- 0:00:37
Average standard deviation of split frequencies: 0.010196
410500 -- (-753.170) [-752.787] (-755.000) (-755.817) * [-752.593] (-755.724) (-751.982) (-751.793) -- 0:00:37
411000 -- (-753.148) [-751.647] (-751.174) (-751.512) * (-752.793) (-751.904) [-750.994] (-751.459) -- 0:00:37
411500 -- (-756.500) (-752.903) (-750.715) [-753.439] * [-752.280] (-753.773) (-752.959) (-754.593) -- 0:00:37
412000 -- (-758.297) (-752.361) (-753.248) [-754.767] * (-754.215) [-753.150] (-754.263) (-754.604) -- 0:00:37
412500 -- (-751.373) (-752.422) [-753.545] (-755.172) * (-753.952) (-753.698) [-752.713] (-752.924) -- 0:00:37
413000 -- (-754.668) (-750.861) [-750.629] (-752.539) * (-753.809) (-754.728) (-754.023) [-755.023] -- 0:00:36
413500 -- (-753.066) (-754.865) (-754.190) [-751.851] * (-752.253) (-750.859) (-750.939) [-752.213] -- 0:00:36
414000 -- [-754.218] (-751.195) (-752.985) (-751.210) * (-751.180) [-752.682] (-753.425) (-753.450) -- 0:00:36
414500 -- [-753.615] (-754.432) (-751.398) (-751.829) * (-755.422) [-757.633] (-752.734) (-751.603) -- 0:00:36
415000 -- (-755.473) (-752.091) [-754.233] (-750.429) * (-753.446) [-751.886] (-756.070) (-756.019) -- 0:00:36
Average standard deviation of split frequencies: 0.010128
415500 -- (-758.788) (-751.382) [-753.285] (-753.343) * [-753.753] (-754.825) (-755.055) (-751.833) -- 0:00:36
416000 -- [-751.464] (-753.824) (-751.866) (-752.748) * (-753.853) (-756.193) (-752.362) [-750.542] -- 0:00:36
416500 -- [-751.733] (-751.297) (-750.852) (-751.477) * (-755.522) (-756.905) (-750.992) [-752.795] -- 0:00:36
417000 -- (-752.369) (-755.801) [-751.513] (-753.239) * (-755.223) (-753.915) [-751.751] (-751.230) -- 0:00:36
417500 -- [-754.516] (-754.205) (-751.639) (-756.838) * (-753.582) (-751.937) [-751.854] (-752.058) -- 0:00:36
418000 -- (-755.969) [-751.531] (-751.937) (-755.440) * (-751.111) (-751.304) [-752.793] (-753.806) -- 0:00:36
418500 -- (-752.948) (-752.845) [-752.711] (-750.812) * (-755.131) [-752.548] (-752.563) (-753.577) -- 0:00:36
419000 -- [-751.767] (-754.474) (-753.267) (-758.936) * [-755.374] (-752.874) (-752.695) (-751.123) -- 0:00:36
419500 -- [-755.493] (-754.764) (-753.099) (-752.562) * (-752.565) [-755.302] (-753.626) (-751.561) -- 0:00:35
420000 -- (-752.507) (-757.866) (-754.933) [-750.896] * (-750.963) (-755.282) (-756.808) [-751.338] -- 0:00:35
Average standard deviation of split frequencies: 0.009315
420500 -- (-751.516) (-752.308) (-753.299) [-751.905] * (-750.751) [-751.781] (-754.914) (-752.409) -- 0:00:35
421000 -- (-752.106) (-752.889) [-756.588] (-751.505) * [-750.969] (-752.119) (-754.269) (-754.970) -- 0:00:35
421500 -- [-750.795] (-752.945) (-752.275) (-754.474) * (-754.130) (-752.974) (-751.019) [-750.223] -- 0:00:35
422000 -- (-753.736) (-752.041) [-750.880] (-754.041) * [-755.223] (-753.100) (-750.958) (-751.601) -- 0:00:35
422500 -- (-753.621) (-754.422) [-750.905] (-751.793) * (-752.960) (-752.114) [-750.799] (-751.801) -- 0:00:35
423000 -- (-753.555) [-759.582] (-754.109) (-753.889) * (-751.549) (-752.217) [-752.050] (-752.432) -- 0:00:35
423500 -- (-751.607) (-759.074) (-750.390) [-750.607] * [-755.677] (-752.283) (-750.941) (-751.813) -- 0:00:35
424000 -- (-753.541) (-752.555) [-754.029] (-751.024) * (-753.114) (-753.888) (-753.990) [-755.569] -- 0:00:36
424500 -- [-754.690] (-751.760) (-752.956) (-752.963) * (-750.831) (-754.589) [-755.758] (-752.981) -- 0:00:36
425000 -- (-752.571) (-750.731) (-751.960) [-751.146] * (-751.770) (-753.396) (-758.571) [-751.007] -- 0:00:36
Average standard deviation of split frequencies: 0.008507
425500 -- (-753.275) (-751.986) [-751.057] (-752.430) * (-750.772) (-752.304) [-750.825] (-755.745) -- 0:00:36
426000 -- (-753.770) [-751.295] (-752.081) (-752.387) * [-752.695] (-751.103) (-751.917) (-753.852) -- 0:00:36
426500 -- (-751.220) (-753.663) (-751.130) [-751.018] * (-751.322) (-751.019) [-750.813] (-753.078) -- 0:00:36
427000 -- (-750.104) (-752.074) (-751.562) [-750.665] * (-754.480) [-752.535] (-756.234) (-751.076) -- 0:00:36
427500 -- (-752.802) [-753.077] (-751.126) (-753.368) * (-754.930) [-752.296] (-754.867) (-752.106) -- 0:00:36
428000 -- [-752.079] (-753.232) (-754.500) (-750.864) * (-752.218) (-750.549) [-751.081] (-751.301) -- 0:00:36
428500 -- [-751.438] (-751.709) (-752.336) (-753.423) * (-753.813) (-751.812) (-751.412) [-750.415] -- 0:00:36
429000 -- [-751.729] (-751.627) (-753.064) (-752.015) * (-750.355) (-763.793) (-754.438) [-750.378] -- 0:00:35
429500 -- [-751.031] (-753.315) (-759.281) (-750.537) * [-752.545] (-754.707) (-752.306) (-752.714) -- 0:00:35
430000 -- (-751.402) (-755.122) (-752.379) [-750.765] * [-752.855] (-750.320) (-754.633) (-753.164) -- 0:00:35
Average standard deviation of split frequencies: 0.008209
430500 -- (-754.927) [-753.238] (-751.293) (-751.392) * (-751.624) (-751.704) (-752.141) [-750.836] -- 0:00:35
431000 -- (-751.779) (-754.226) [-752.847] (-751.600) * (-751.162) (-751.551) (-752.064) [-750.355] -- 0:00:35
431500 -- [-751.903] (-751.978) (-753.154) (-754.593) * (-751.446) [-753.409] (-752.464) (-752.579) -- 0:00:35
432000 -- (-753.589) [-753.036] (-752.820) (-751.179) * [-750.926] (-751.247) (-751.660) (-751.306) -- 0:00:35
432500 -- (-752.972) (-753.001) [-752.192] (-760.311) * (-754.499) (-750.690) (-752.457) [-755.222] -- 0:00:35
433000 -- (-752.033) [-750.986] (-756.298) (-752.859) * [-751.649] (-755.406) (-750.751) (-752.623) -- 0:00:35
433500 -- (-752.576) (-752.265) [-752.168] (-753.403) * (-754.295) (-754.239) [-751.561] (-750.675) -- 0:00:35
434000 -- [-750.913] (-752.939) (-751.492) (-753.403) * (-752.139) [-752.503] (-753.403) (-751.855) -- 0:00:35
434500 -- [-754.020] (-755.539) (-752.412) (-755.143) * [-751.751] (-753.444) (-752.469) (-751.445) -- 0:00:35
435000 -- [-753.860] (-752.390) (-751.368) (-758.848) * (-752.161) [-751.548] (-755.277) (-752.361) -- 0:00:35
Average standard deviation of split frequencies: 0.008244
435500 -- [-752.060] (-752.738) (-752.092) (-756.444) * (-750.679) (-752.610) (-751.938) [-751.219] -- 0:00:34
436000 -- (-753.874) (-751.399) [-753.529] (-752.931) * [-754.146] (-751.356) (-752.532) (-751.540) -- 0:00:34
436500 -- (-751.610) [-753.940] (-751.722) (-757.785) * (-753.448) (-753.803) (-753.944) [-753.315] -- 0:00:34
437000 -- (-752.626) (-751.523) [-753.369] (-751.648) * [-750.723] (-760.153) (-752.420) (-753.554) -- 0:00:34
437500 -- (-752.699) (-752.189) (-750.615) [-752.507] * [-753.315] (-752.328) (-751.100) (-751.365) -- 0:00:34
438000 -- (-754.018) (-750.641) (-750.654) [-751.251] * (-753.901) [-750.978] (-753.716) (-752.688) -- 0:00:34
438500 -- (-753.886) (-750.916) [-755.093] (-752.800) * [-754.488] (-753.251) (-753.566) (-753.717) -- 0:00:34
439000 -- (-752.456) [-751.876] (-751.918) (-752.775) * (-755.429) (-755.338) (-751.582) [-753.824] -- 0:00:34
439500 -- (-754.474) [-751.778] (-752.907) (-752.870) * (-753.319) [-754.114] (-750.729) (-754.056) -- 0:00:34
440000 -- (-753.467) (-752.893) (-754.983) [-752.065] * [-751.647] (-756.528) (-753.419) (-752.081) -- 0:00:34
Average standard deviation of split frequencies: 0.008090
440500 -- (-751.723) (-753.960) (-752.010) [-751.130] * (-750.513) [-752.140] (-751.509) (-753.483) -- 0:00:35
441000 -- [-752.363] (-752.934) (-750.414) (-751.224) * (-751.353) (-752.070) [-752.613] (-750.515) -- 0:00:35
441500 -- (-752.426) (-751.595) [-754.208] (-752.036) * (-750.495) (-752.193) (-752.081) [-751.744] -- 0:00:35
442000 -- (-753.158) [-754.216] (-753.020) (-752.309) * (-751.209) (-754.293) (-754.420) [-752.490] -- 0:00:35
442500 -- (-755.459) (-752.707) [-752.463] (-753.199) * [-751.095] (-752.743) (-757.421) (-755.512) -- 0:00:35
443000 -- (-753.972) [-753.410] (-752.721) (-752.008) * (-757.870) (-752.462) (-750.971) [-751.035] -- 0:00:35
443500 -- [-750.809] (-751.707) (-753.304) (-753.456) * [-751.640] (-753.611) (-756.892) (-752.939) -- 0:00:35
444000 -- (-753.885) (-753.521) (-752.985) [-753.646] * (-750.811) (-750.726) [-752.058] (-753.923) -- 0:00:35
444500 -- (-751.684) (-755.203) [-751.306] (-754.102) * (-751.770) [-751.699] (-751.401) (-752.688) -- 0:00:34
445000 -- (-756.661) (-752.397) [-750.508] (-752.597) * (-753.035) (-752.739) (-751.774) [-750.233] -- 0:00:34
Average standard deviation of split frequencies: 0.008390
445500 -- [-751.217] (-750.286) (-751.034) (-751.793) * (-752.487) (-755.598) (-753.763) [-751.855] -- 0:00:34
446000 -- (-751.698) [-750.643] (-752.361) (-750.497) * (-757.699) (-755.081) (-761.690) [-750.876] -- 0:00:34
446500 -- [-751.534] (-752.558) (-750.462) (-751.173) * [-755.012] (-753.025) (-752.653) (-750.277) -- 0:00:34
447000 -- (-751.118) (-756.256) [-750.830] (-751.096) * (-751.950) [-751.559] (-752.852) (-750.755) -- 0:00:34
447500 -- (-752.005) (-751.761) (-751.101) [-752.766] * (-755.320) (-753.369) (-751.169) [-750.988] -- 0:00:34
448000 -- (-752.446) (-750.595) [-750.705] (-753.934) * (-753.024) (-752.298) (-752.646) [-753.247] -- 0:00:34
448500 -- (-751.500) [-753.532] (-750.050) (-752.663) * (-753.381) (-752.748) (-754.480) [-756.307] -- 0:00:34
449000 -- [-751.534] (-750.742) (-750.886) (-752.135) * [-750.440] (-754.384) (-753.016) (-754.007) -- 0:00:34
449500 -- (-752.714) (-752.640) [-752.251] (-751.029) * (-755.899) [-754.405] (-750.735) (-754.427) -- 0:00:34
450000 -- (-752.206) [-752.489] (-752.840) (-751.121) * [-750.536] (-751.210) (-750.535) (-754.778) -- 0:00:34
Average standard deviation of split frequencies: 0.008957
450500 -- (-753.081) (-760.345) [-753.773] (-752.166) * (-751.400) (-753.234) [-750.621] (-751.121) -- 0:00:34
451000 -- (-750.520) [-754.845] (-755.672) (-751.489) * (-752.478) (-751.855) [-750.593] (-751.035) -- 0:00:34
451500 -- (-750.494) (-752.078) [-754.911] (-752.256) * [-752.854] (-758.257) (-751.848) (-751.936) -- 0:00:34
452000 -- (-751.205) (-752.963) [-753.292] (-753.906) * (-753.976) [-752.106] (-751.770) (-752.468) -- 0:00:33
452500 -- (-754.025) [-751.087] (-752.903) (-753.111) * (-753.779) [-751.644] (-751.715) (-752.279) -- 0:00:33
453000 -- (-753.678) (-754.538) (-752.741) [-752.386] * [-752.117] (-752.781) (-751.251) (-751.132) -- 0:00:33
453500 -- (-751.916) (-756.637) [-752.242] (-752.241) * (-759.126) (-751.522) (-752.475) [-754.071] -- 0:00:33
454000 -- (-753.157) [-752.158] (-750.648) (-750.991) * (-752.407) [-751.932] (-752.539) (-754.872) -- 0:00:33
454500 -- (-752.497) (-754.945) (-752.362) [-755.112] * (-753.280) (-751.777) [-751.777] (-754.943) -- 0:00:33
455000 -- (-751.944) (-753.477) (-753.485) [-754.049] * [-751.082] (-751.669) (-753.249) (-758.187) -- 0:00:33
Average standard deviation of split frequencies: 0.008399
455500 -- (-752.986) [-751.285] (-754.458) (-753.356) * (-750.366) [-751.450] (-752.535) (-751.337) -- 0:00:33
456000 -- (-752.776) [-751.162] (-753.428) (-752.698) * [-750.989] (-752.245) (-760.242) (-752.779) -- 0:00:33
456500 -- [-752.810] (-752.488) (-750.928) (-751.809) * [-750.114] (-752.386) (-751.066) (-752.092) -- 0:00:33
457000 -- (-751.278) [-751.320] (-753.583) (-754.289) * (-751.835) [-752.787] (-753.262) (-753.462) -- 0:00:34
457500 -- (-760.097) [-751.982] (-755.597) (-755.188) * (-751.013) [-750.984] (-750.732) (-752.766) -- 0:00:34
458000 -- (-755.763) (-755.360) (-751.195) [-753.924] * (-753.606) (-753.038) (-750.787) [-753.838] -- 0:00:34
458500 -- (-751.931) [-755.435] (-752.045) (-752.094) * (-750.791) [-753.044] (-751.106) (-754.381) -- 0:00:34
459000 -- [-754.046] (-753.118) (-754.830) (-751.051) * (-750.768) [-753.612] (-757.911) (-753.393) -- 0:00:34
459500 -- (-752.348) (-752.368) (-755.870) [-752.154] * (-754.649) (-753.370) (-752.241) [-752.803] -- 0:00:34
460000 -- (-752.304) (-753.885) [-751.358] (-751.271) * (-751.741) (-750.734) [-750.380] (-753.297) -- 0:00:34
Average standard deviation of split frequencies: 0.007803
460500 -- (-752.440) (-752.512) [-751.223] (-753.074) * (-751.159) (-752.955) [-751.543] (-752.713) -- 0:00:33
461000 -- (-752.665) [-753.186] (-751.766) (-753.230) * (-752.837) (-753.685) [-752.363] (-755.449) -- 0:00:33
461500 -- (-750.604) [-756.415] (-756.091) (-756.076) * [-754.669] (-756.222) (-752.662) (-757.048) -- 0:00:33
462000 -- (-753.961) (-751.911) [-750.338] (-754.889) * [-751.611] (-752.650) (-752.265) (-751.918) -- 0:00:33
462500 -- [-751.154] (-753.588) (-750.337) (-753.193) * [-750.825] (-754.028) (-753.023) (-754.287) -- 0:00:33
463000 -- [-751.246] (-753.452) (-751.983) (-757.085) * [-750.839] (-752.069) (-754.146) (-752.465) -- 0:00:33
463500 -- (-752.761) (-755.047) [-751.855] (-752.977) * (-752.366) [-752.111] (-751.404) (-755.901) -- 0:00:33
464000 -- (-753.443) (-753.284) (-753.127) [-752.751] * (-753.509) [-753.915] (-751.569) (-751.449) -- 0:00:33
464500 -- [-751.915] (-751.376) (-755.043) (-752.441) * (-754.335) (-757.314) [-758.825] (-753.626) -- 0:00:33
465000 -- (-752.108) [-750.776] (-752.581) (-750.935) * (-752.189) (-753.146) [-752.775] (-752.994) -- 0:00:33
Average standard deviation of split frequencies: 0.008282
465500 -- (-753.275) [-752.508] (-751.408) (-750.861) * (-751.570) (-751.754) [-751.442] (-753.717) -- 0:00:33
466000 -- (-753.035) [-751.227] (-754.034) (-751.967) * (-751.480) (-751.732) (-753.800) [-752.782] -- 0:00:33
466500 -- (-753.199) [-751.275] (-759.447) (-752.535) * [-754.895] (-751.378) (-752.036) (-752.241) -- 0:00:33
467000 -- (-754.208) [-751.759] (-753.991) (-753.787) * (-755.000) [-755.540] (-752.018) (-753.960) -- 0:00:33
467500 -- [-751.637] (-752.848) (-754.352) (-752.966) * [-752.218] (-754.629) (-752.481) (-759.732) -- 0:00:33
468000 -- (-754.624) (-751.952) (-752.967) [-752.480] * (-752.299) (-751.011) [-751.927] (-753.360) -- 0:00:32
468500 -- (-755.940) [-752.608] (-751.807) (-752.737) * (-752.440) (-750.688) (-755.361) [-753.906] -- 0:00:32
469000 -- (-753.497) [-752.872] (-751.566) (-752.841) * (-751.316) (-752.661) [-754.594] (-751.048) -- 0:00:32
469500 -- [-755.534] (-752.509) (-752.306) (-752.561) * [-750.848] (-751.869) (-751.279) (-750.719) -- 0:00:32
470000 -- (-751.270) (-752.961) (-752.397) [-753.830] * (-754.630) (-753.901) (-751.736) [-754.244] -- 0:00:32
Average standard deviation of split frequencies: 0.008576
470500 -- [-754.838] (-751.367) (-751.971) (-751.875) * (-755.618) [-752.493] (-752.562) (-754.991) -- 0:00:32
471000 -- [-751.236] (-751.165) (-752.772) (-752.840) * [-752.542] (-753.687) (-754.570) (-752.274) -- 0:00:32
471500 -- (-752.205) (-754.616) (-752.854) [-751.919] * (-753.890) [-753.405] (-751.392) (-752.732) -- 0:00:32
472000 -- (-752.887) (-752.388) (-752.227) [-752.893] * (-754.980) (-752.244) [-750.785] (-751.921) -- 0:00:32
472500 -- (-756.284) [-750.404] (-755.364) (-755.695) * (-753.244) (-753.944) [-750.911] (-752.637) -- 0:00:32
473000 -- (-751.993) (-751.230) (-754.660) [-753.103] * (-752.777) [-750.966] (-750.434) (-756.350) -- 0:00:32
473500 -- (-751.969) (-755.032) (-751.879) [-751.964] * (-751.145) [-751.063] (-751.552) (-752.073) -- 0:00:32
474000 -- [-751.465] (-754.837) (-751.967) (-752.040) * (-751.743) (-752.683) (-762.300) [-752.476] -- 0:00:33
474500 -- (-753.212) (-753.857) (-753.035) [-752.267] * [-755.229] (-753.018) (-758.785) (-755.947) -- 0:00:33
475000 -- (-756.052) (-752.453) [-752.523] (-752.730) * (-753.060) (-753.070) (-752.396) [-753.216] -- 0:00:33
Average standard deviation of split frequencies: 0.009161
475500 -- (-751.305) [-751.459] (-750.778) (-751.867) * [-751.267] (-752.549) (-752.671) (-751.182) -- 0:00:33
476000 -- (-751.170) [-753.966] (-750.327) (-753.021) * (-753.578) (-752.823) (-754.113) [-756.161] -- 0:00:33
476500 -- (-752.118) (-751.796) [-750.592] (-754.162) * (-753.587) (-751.576) (-754.792) [-750.663] -- 0:00:32
477000 -- (-752.378) (-754.412) (-753.630) [-755.126] * (-756.092) (-753.996) (-752.270) [-750.707] -- 0:00:32
477500 -- [-751.740] (-753.846) (-751.631) (-755.187) * [-751.088] (-755.545) (-754.429) (-751.916) -- 0:00:32
478000 -- [-751.614] (-752.276) (-751.085) (-750.805) * [-753.801] (-757.866) (-750.745) (-752.870) -- 0:00:32
478500 -- (-753.209) [-752.660] (-757.883) (-750.777) * (-752.245) (-757.554) (-750.568) [-751.176] -- 0:00:32
479000 -- (-752.433) (-752.735) [-754.513] (-751.632) * (-754.809) (-751.512) (-751.049) [-750.943] -- 0:00:32
479500 -- (-753.234) [-754.098] (-754.757) (-752.091) * (-750.978) (-754.280) (-753.854) [-752.339] -- 0:00:32
480000 -- (-754.500) [-754.460] (-754.617) (-756.020) * [-752.561] (-754.636) (-752.624) (-751.581) -- 0:00:32
Average standard deviation of split frequencies: 0.009685
480500 -- (-757.258) [-750.570] (-752.631) (-757.722) * [-750.959] (-753.809) (-752.242) (-752.821) -- 0:00:32
481000 -- (-751.808) [-750.574] (-757.115) (-752.699) * [-753.037] (-753.173) (-752.201) (-754.470) -- 0:00:32
481500 -- (-750.785) (-751.963) [-752.446] (-752.032) * (-758.820) (-751.364) [-750.778] (-756.907) -- 0:00:32
482000 -- (-751.461) [-755.224] (-751.880) (-752.938) * (-752.437) (-751.753) [-751.440] (-756.555) -- 0:00:32
482500 -- [-753.276] (-752.083) (-750.914) (-755.762) * (-757.206) (-753.675) (-757.606) [-753.753] -- 0:00:32
483000 -- (-752.242) (-751.778) (-750.312) [-752.675] * [-755.715] (-751.294) (-754.924) (-755.253) -- 0:00:32
483500 -- [-750.583] (-751.674) (-753.094) (-753.478) * (-752.984) (-752.154) (-754.919) [-750.781] -- 0:00:32
484000 -- (-757.239) (-750.760) [-751.383] (-754.557) * (-754.250) [-751.661] (-752.154) (-752.049) -- 0:00:31
484500 -- (-751.042) [-752.707] (-755.822) (-756.467) * (-752.823) (-753.197) [-752.136] (-753.593) -- 0:00:31
485000 -- (-750.317) (-752.135) (-751.989) [-750.941] * (-751.188) [-750.587] (-756.476) (-752.848) -- 0:00:31
Average standard deviation of split frequencies: 0.010003
485500 -- [-754.543] (-750.342) (-756.962) (-752.523) * (-752.992) (-752.906) [-755.046] (-754.352) -- 0:00:31
486000 -- (-754.953) (-754.701) [-751.817] (-752.811) * (-752.863) [-754.805] (-753.628) (-754.784) -- 0:00:31
486500 -- (-752.422) (-751.732) [-750.640] (-753.880) * [-754.126] (-752.195) (-752.515) (-755.103) -- 0:00:31
487000 -- (-754.384) (-754.940) (-752.402) [-753.707] * [-755.800] (-754.446) (-750.959) (-755.877) -- 0:00:31
487500 -- [-751.658] (-751.456) (-753.737) (-751.286) * [-754.765] (-755.441) (-756.943) (-751.215) -- 0:00:31
488000 -- (-751.405) (-751.597) (-755.192) [-751.148] * (-752.763) (-752.150) [-752.349] (-751.236) -- 0:00:31
488500 -- (-754.055) (-751.122) [-753.836] (-750.367) * [-752.403] (-750.758) (-755.607) (-751.736) -- 0:00:31
489000 -- (-752.423) [-751.326] (-752.098) (-753.553) * (-752.261) (-752.055) [-752.374] (-751.661) -- 0:00:31
489500 -- [-753.654] (-753.297) (-753.460) (-751.302) * (-752.345) (-754.306) [-750.991] (-750.788) -- 0:00:31
490000 -- [-752.411] (-753.085) (-753.085) (-751.378) * (-751.696) (-753.981) [-751.175] (-751.020) -- 0:00:31
Average standard deviation of split frequencies: 0.009667
490500 -- (-752.811) [-753.019] (-752.715) (-753.554) * (-752.034) [-753.433] (-754.261) (-751.092) -- 0:00:32
491000 -- (-752.049) (-756.998) (-753.586) [-751.669] * (-755.299) (-750.416) [-751.927] (-752.090) -- 0:00:32
491500 -- (-752.289) (-754.665) (-759.273) [-753.806] * (-753.092) (-750.301) (-756.205) [-750.811] -- 0:00:32
492000 -- (-753.256) (-753.879) [-754.896] (-753.591) * [-751.205] (-750.832) (-750.542) (-754.288) -- 0:00:32
492500 -- [-759.345] (-757.335) (-757.883) (-758.362) * (-752.147) [-750.464] (-752.889) (-754.558) -- 0:00:31
493000 -- (-752.581) (-755.969) (-752.152) [-754.017] * (-752.018) [-753.079] (-751.237) (-752.503) -- 0:00:31
493500 -- [-750.937] (-756.341) (-753.538) (-752.206) * (-750.263) (-751.144) [-751.405] (-754.862) -- 0:00:31
494000 -- (-750.948) [-755.862] (-752.791) (-751.287) * (-753.403) (-755.897) (-751.767) [-752.743] -- 0:00:31
494500 -- (-752.724) (-754.594) [-750.467] (-753.193) * (-751.534) [-750.554] (-752.489) (-754.276) -- 0:00:31
495000 -- (-753.420) [-751.736] (-753.015) (-754.048) * [-755.076] (-752.340) (-755.059) (-754.024) -- 0:00:31
Average standard deviation of split frequencies: 0.009742
495500 -- [-753.873] (-751.181) (-752.723) (-751.948) * (-752.504) [-755.940] (-752.901) (-751.123) -- 0:00:31
496000 -- (-752.301) [-752.005] (-752.541) (-752.462) * (-750.927) (-754.212) (-753.215) [-752.012] -- 0:00:31
496500 -- (-754.292) (-754.265) [-752.542] (-751.045) * (-752.187) (-755.413) (-751.087) [-754.556] -- 0:00:31
497000 -- (-755.703) (-754.469) (-752.704) [-751.528] * (-752.494) (-750.709) (-755.765) [-753.422] -- 0:00:31
497500 -- (-754.211) (-753.938) [-752.464] (-751.386) * [-752.557] (-750.756) (-753.487) (-751.453) -- 0:00:31
498000 -- (-757.460) [-753.497] (-752.109) (-751.788) * [-754.438] (-755.384) (-752.223) (-750.912) -- 0:00:31
498500 -- [-752.161] (-754.135) (-752.921) (-752.758) * [-752.844] (-751.340) (-754.710) (-750.946) -- 0:00:31
499000 -- (-752.048) [-752.813] (-753.486) (-753.653) * [-753.479] (-751.703) (-752.133) (-750.800) -- 0:00:31
499500 -- (-753.124) [-751.686] (-755.539) (-752.673) * (-752.675) [-751.120] (-752.206) (-756.250) -- 0:00:31
500000 -- (-753.351) (-751.547) (-756.561) [-752.951] * [-753.878] (-754.880) (-752.808) (-755.820) -- 0:00:31
Average standard deviation of split frequencies: 0.009886
500500 -- (-750.511) (-751.586) (-752.704) [-752.609] * (-753.067) [-751.687] (-751.927) (-752.484) -- 0:00:30
501000 -- [-751.380] (-753.518) (-750.587) (-752.919) * (-753.223) (-750.854) (-751.751) [-751.457] -- 0:00:30
501500 -- (-751.978) (-753.297) [-756.123] (-752.406) * (-751.094) (-753.520) (-753.259) [-751.667] -- 0:00:30
502000 -- (-752.946) [-752.419] (-754.285) (-752.790) * (-753.031) (-753.625) [-750.741] (-751.556) -- 0:00:30
502500 -- (-754.635) (-751.910) (-752.508) [-759.642] * (-750.550) (-758.304) (-751.158) [-752.648] -- 0:00:30
503000 -- [-753.509] (-752.271) (-753.329) (-756.766) * (-752.998) (-751.123) (-755.920) [-752.973] -- 0:00:30
503500 -- (-754.256) (-752.256) (-758.686) [-752.250] * (-751.620) [-751.820] (-752.544) (-753.059) -- 0:00:30
504000 -- (-754.728) [-750.873] (-755.222) (-751.158) * (-750.734) (-754.047) (-752.944) [-751.251] -- 0:00:30
504500 -- (-752.521) (-751.768) [-754.081] (-754.282) * [-752.790] (-752.948) (-753.025) (-753.212) -- 0:00:30
505000 -- (-752.692) (-751.235) [-751.959] (-751.611) * (-751.557) (-752.087) (-751.865) [-751.860] -- 0:00:30
Average standard deviation of split frequencies: 0.010539
505500 -- [-758.249] (-754.284) (-750.655) (-750.678) * (-757.029) [-753.114] (-758.916) (-752.722) -- 0:00:30
506000 -- (-754.100) (-756.537) (-751.650) [-750.436] * (-751.664) (-753.095) (-753.495) [-751.605] -- 0:00:30
506500 -- [-751.388] (-753.175) (-754.361) (-755.437) * (-754.441) [-751.309] (-751.816) (-753.621) -- 0:00:30
507000 -- (-753.465) [-750.761] (-752.551) (-752.877) * [-753.868] (-751.222) (-752.722) (-751.923) -- 0:00:31
507500 -- (-752.810) [-752.612] (-751.423) (-753.590) * (-754.970) (-753.173) (-751.956) [-750.798] -- 0:00:31
508000 -- [-753.018] (-754.455) (-750.832) (-752.895) * (-752.269) (-752.404) (-755.901) [-752.144] -- 0:00:30
508500 -- (-752.160) [-752.959] (-753.964) (-753.299) * [-754.193] (-751.277) (-751.722) (-754.869) -- 0:00:30
509000 -- [-751.172] (-752.401) (-752.038) (-752.581) * (-752.023) [-752.237] (-753.442) (-752.946) -- 0:00:30
509500 -- (-751.623) (-751.942) (-753.055) [-758.321] * (-754.447) (-752.647) [-754.685] (-755.115) -- 0:00:30
510000 -- (-752.659) (-751.354) [-752.195] (-753.525) * (-757.018) [-750.579] (-754.445) (-752.823) -- 0:00:30
Average standard deviation of split frequencies: 0.010558
510500 -- (-752.958) (-753.404) [-751.652] (-755.273) * (-756.984) (-752.968) [-754.204] (-752.351) -- 0:00:30
511000 -- [-751.168] (-752.574) (-751.433) (-750.840) * (-753.844) (-751.694) (-753.301) [-751.437] -- 0:00:30
511500 -- (-752.381) (-753.933) [-751.700] (-752.585) * (-751.088) (-752.911) [-755.679] (-756.239) -- 0:00:30
512000 -- (-752.257) [-751.523] (-755.659) (-752.443) * [-751.643] (-754.671) (-750.569) (-753.768) -- 0:00:30
512500 -- (-752.802) (-752.117) [-752.535] (-751.757) * (-756.010) (-757.533) (-754.403) [-752.615] -- 0:00:30
513000 -- (-751.387) (-751.963) (-752.649) [-751.944] * (-758.219) (-754.805) (-754.727) [-751.475] -- 0:00:30
513500 -- (-755.806) (-751.953) [-752.646] (-756.315) * (-754.220) [-750.598] (-754.704) (-753.200) -- 0:00:30
514000 -- (-751.351) (-752.646) (-754.126) [-754.703] * (-751.040) (-752.666) (-753.971) [-751.498] -- 0:00:30
514500 -- (-753.558) [-753.223] (-752.432) (-753.273) * (-752.295) (-751.375) [-751.717] (-752.228) -- 0:00:30
515000 -- (-762.475) (-751.269) (-752.850) [-752.283] * (-752.614) (-751.858) (-752.563) [-754.923] -- 0:00:30
Average standard deviation of split frequencies: 0.010849
515500 -- (-752.856) (-752.000) [-751.380] (-755.663) * (-752.475) (-750.763) [-751.398] (-756.440) -- 0:00:30
516000 -- (-752.966) [-753.448] (-750.411) (-757.437) * [-753.543] (-752.347) (-751.603) (-754.173) -- 0:00:30
516500 -- (-752.178) (-752.366) [-753.021] (-755.763) * [-758.274] (-751.177) (-750.597) (-753.473) -- 0:00:29
517000 -- [-751.793] (-752.116) (-751.829) (-751.473) * (-754.991) [-750.582] (-751.822) (-752.208) -- 0:00:29
517500 -- (-752.113) [-751.542] (-750.691) (-751.011) * (-754.339) (-753.091) [-751.813] (-754.235) -- 0:00:29
518000 -- [-754.334] (-754.387) (-752.625) (-756.543) * (-751.031) (-753.048) [-754.338] (-754.508) -- 0:00:29
518500 -- (-756.408) [-753.591] (-753.773) (-752.364) * (-751.039) (-751.193) [-751.746] (-751.122) -- 0:00:29
519000 -- [-752.289] (-754.055) (-753.586) (-753.118) * [-750.824] (-750.954) (-753.718) (-752.034) -- 0:00:29
519500 -- (-753.547) [-754.350] (-753.625) (-754.118) * (-755.090) (-751.046) (-752.679) [-755.667] -- 0:00:29
520000 -- (-754.041) [-753.156] (-756.105) (-756.230) * [-753.716] (-753.654) (-753.533) (-753.831) -- 0:00:29
Average standard deviation of split frequencies: 0.010186
520500 -- (-752.411) (-752.303) (-752.592) [-750.991] * (-750.157) [-750.230] (-753.386) (-751.041) -- 0:00:29
521000 -- (-757.207) [-752.434] (-753.365) (-752.229) * (-751.516) (-751.658) [-750.809] (-750.450) -- 0:00:29
521500 -- (-754.275) [-753.277] (-752.287) (-751.681) * [-751.379] (-752.151) (-752.213) (-751.825) -- 0:00:29
522000 -- (-754.852) (-758.272) [-755.486] (-757.399) * (-751.741) [-753.185] (-754.413) (-751.484) -- 0:00:29
522500 -- (-754.904) (-756.392) (-751.546) [-750.897] * [-750.614] (-752.789) (-752.213) (-751.744) -- 0:00:29
523000 -- (-752.977) (-751.466) (-751.566) [-751.645] * (-753.016) (-751.266) [-755.590] (-752.671) -- 0:00:29
523500 -- [-755.822] (-754.998) (-752.697) (-752.175) * (-752.247) [-752.179] (-754.745) (-754.619) -- 0:00:30
524000 -- (-755.986) (-750.637) (-752.445) [-751.447] * [-754.037] (-752.228) (-751.956) (-750.986) -- 0:00:29
524500 -- (-752.785) [-750.510] (-755.910) (-751.617) * (-750.751) (-751.423) (-751.148) [-752.189] -- 0:00:29
525000 -- (-751.619) [-750.832] (-760.203) (-754.402) * (-750.899) (-751.205) [-751.965] (-751.719) -- 0:00:29
Average standard deviation of split frequencies: 0.010250
525500 -- (-752.452) (-751.143) [-753.125] (-751.562) * (-751.520) (-751.048) (-752.164) [-750.985] -- 0:00:29
526000 -- (-753.971) [-752.157] (-754.368) (-750.460) * [-751.186] (-751.271) (-751.009) (-751.163) -- 0:00:29
526500 -- (-754.626) [-752.302] (-751.170) (-750.296) * (-751.179) (-751.374) [-751.019] (-752.550) -- 0:00:29
527000 -- (-750.786) (-752.124) [-751.454] (-752.699) * (-750.429) [-752.404] (-751.331) (-752.587) -- 0:00:29
527500 -- (-753.464) (-755.517) (-751.871) [-750.593] * [-750.628] (-751.009) (-752.257) (-751.884) -- 0:00:29
528000 -- [-750.786] (-754.654) (-752.026) (-755.605) * (-750.632) [-751.813] (-752.266) (-755.215) -- 0:00:29
528500 -- (-751.511) (-756.620) [-751.787] (-754.797) * (-753.404) (-752.815) (-750.733) [-752.105] -- 0:00:29
529000 -- (-750.607) (-753.308) (-753.087) [-752.877] * [-752.283] (-754.181) (-752.966) (-752.693) -- 0:00:29
529500 -- [-753.068] (-753.491) (-753.973) (-753.759) * (-755.488) (-754.130) (-753.299) [-752.590] -- 0:00:29
530000 -- (-757.500) (-753.645) (-757.754) [-750.647] * (-758.097) (-754.179) (-754.469) [-753.481] -- 0:00:29
Average standard deviation of split frequencies: 0.009050
530500 -- (-756.658) [-753.414] (-751.715) (-754.445) * [-753.828] (-752.384) (-751.959) (-752.148) -- 0:00:29
531000 -- (-751.845) (-751.120) [-751.085] (-752.625) * (-752.533) (-754.300) (-750.763) [-753.390] -- 0:00:29
531500 -- (-752.428) (-752.837) (-750.265) [-753.239] * (-751.757) (-759.145) [-755.149] (-751.324) -- 0:00:29
532000 -- [-753.746] (-751.649) (-750.369) (-752.549) * [-750.889] (-750.957) (-753.308) (-753.558) -- 0:00:29
532500 -- (-751.586) (-751.514) [-750.368] (-755.427) * (-757.082) (-750.784) [-752.546] (-752.747) -- 0:00:28
533000 -- [-753.581] (-751.403) (-751.261) (-753.730) * (-756.134) (-754.836) (-754.916) [-751.179] -- 0:00:28
533500 -- (-755.584) [-753.119] (-751.429) (-751.945) * [-753.960] (-756.682) (-754.964) (-753.428) -- 0:00:28
534000 -- [-752.542] (-753.215) (-751.788) (-753.177) * (-751.682) [-759.956] (-752.163) (-755.022) -- 0:00:28
534500 -- (-752.232) [-752.390] (-752.005) (-752.160) * [-750.962] (-751.666) (-750.230) (-751.923) -- 0:00:28
535000 -- (-753.275) (-755.604) (-751.537) [-751.849] * (-751.845) (-753.797) (-752.296) [-751.155] -- 0:00:28
Average standard deviation of split frequencies: 0.009400
535500 -- (-752.459) [-757.596] (-751.023) (-751.918) * [-752.046] (-753.072) (-752.405) (-753.134) -- 0:00:28
536000 -- (-753.193) (-754.458) (-751.589) [-750.344] * (-752.801) (-755.652) (-752.097) [-752.622] -- 0:00:28
536500 -- [-752.972] (-754.138) (-753.945) (-751.269) * [-751.443] (-751.415) (-754.591) (-752.230) -- 0:00:28
537000 -- (-754.046) (-755.667) (-754.427) [-750.972] * (-751.025) (-754.069) (-753.527) [-752.210] -- 0:00:28
537500 -- (-752.899) [-752.873] (-751.825) (-750.847) * (-750.898) [-753.977] (-752.353) (-752.512) -- 0:00:28
538000 -- [-754.976] (-752.382) (-751.565) (-751.409) * [-751.480] (-752.054) (-752.917) (-756.388) -- 0:00:28
538500 -- (-757.740) (-750.569) (-751.563) [-752.486] * (-752.730) [-751.223] (-754.332) (-751.844) -- 0:00:28
539000 -- [-751.367] (-754.450) (-754.583) (-756.045) * (-753.164) (-751.224) (-751.110) [-750.921] -- 0:00:28
539500 -- [-752.833] (-752.072) (-759.478) (-754.349) * (-752.112) (-753.748) (-750.769) [-754.154] -- 0:00:28
540000 -- (-754.369) [-754.056] (-753.838) (-756.238) * (-751.321) (-754.131) (-753.540) [-754.766] -- 0:00:28
Average standard deviation of split frequencies: 0.009155
540500 -- [-752.681] (-753.413) (-751.929) (-754.759) * (-752.580) [-755.877] (-754.085) (-755.455) -- 0:00:28
541000 -- [-751.454] (-753.772) (-753.143) (-755.023) * [-752.601] (-758.187) (-751.601) (-754.762) -- 0:00:28
541500 -- (-752.817) [-752.976] (-751.169) (-751.607) * [-752.209] (-757.679) (-752.011) (-751.889) -- 0:00:28
542000 -- (-751.807) [-752.706] (-752.166) (-750.498) * (-752.539) [-751.646] (-752.792) (-753.456) -- 0:00:28
542500 -- (-751.531) [-751.649] (-751.012) (-755.592) * (-756.716) (-752.591) (-750.948) [-754.148] -- 0:00:28
543000 -- (-751.697) (-751.579) [-751.062] (-752.509) * (-754.966) (-752.404) [-751.432] (-751.182) -- 0:00:28
543500 -- (-754.115) (-751.672) [-756.303] (-750.285) * (-752.730) (-752.618) (-750.556) [-750.542] -- 0:00:28
544000 -- (-752.472) (-755.693) [-756.005] (-750.905) * [-752.153] (-755.662) (-752.450) (-751.610) -- 0:00:28
544500 -- [-753.808] (-751.150) (-754.764) (-751.537) * (-751.669) (-752.076) (-751.595) [-750.950] -- 0:00:28
545000 -- (-751.371) (-753.330) [-756.745] (-752.812) * (-754.152) (-751.890) (-756.058) [-751.446] -- 0:00:28
Average standard deviation of split frequencies: 0.009659
545500 -- (-753.627) (-752.552) (-753.710) [-751.691] * [-752.214] (-753.897) (-753.250) (-750.735) -- 0:00:28
546000 -- (-753.915) (-754.286) [-754.620] (-753.337) * (-753.483) (-755.195) [-750.771] (-752.631) -- 0:00:28
546500 -- (-751.212) [-751.076] (-751.368) (-751.013) * [-752.520] (-753.547) (-752.049) (-751.987) -- 0:00:28
547000 -- [-752.709] (-755.117) (-751.387) (-752.409) * (-752.294) [-754.601] (-752.664) (-752.722) -- 0:00:28
547500 -- (-754.214) (-752.888) [-750.814] (-753.600) * (-755.435) (-753.155) (-754.284) [-753.526] -- 0:00:28
548000 -- (-756.682) [-753.045] (-750.410) (-751.713) * (-751.283) [-754.985] (-751.831) (-755.213) -- 0:00:28
548500 -- (-756.454) [-751.821] (-756.202) (-751.861) * (-753.166) [-751.383] (-751.451) (-752.697) -- 0:00:27
549000 -- (-754.756) [-751.825] (-750.886) (-750.626) * (-756.383) (-751.950) [-751.724] (-752.463) -- 0:00:27
549500 -- [-751.497] (-750.530) (-752.608) (-752.149) * (-752.937) (-752.859) [-753.876] (-754.856) -- 0:00:27
550000 -- (-753.804) [-750.763] (-755.799) (-753.103) * [-751.481] (-751.788) (-752.082) (-753.765) -- 0:00:27
Average standard deviation of split frequencies: 0.010433
550500 -- (-751.860) [-750.598] (-751.817) (-751.384) * (-753.050) (-750.580) [-757.244] (-756.839) -- 0:00:27
551000 -- [-751.011] (-753.976) (-752.217) (-752.242) * (-753.250) [-751.326] (-751.179) (-751.452) -- 0:00:27
551500 -- [-752.523] (-754.686) (-758.841) (-750.900) * (-754.211) (-751.946) (-751.596) [-752.825] -- 0:00:27
552000 -- [-751.531] (-752.494) (-754.372) (-754.235) * (-756.964) (-751.210) [-751.402] (-751.376) -- 0:00:27
552500 -- (-751.573) (-751.448) (-752.204) [-751.416] * (-752.375) [-750.629] (-752.648) (-752.995) -- 0:00:27
553000 -- (-752.011) (-753.373) [-751.595] (-755.511) * (-756.650) (-751.688) [-752.817] (-754.678) -- 0:00:27
553500 -- [-751.159] (-751.888) (-755.398) (-753.351) * (-753.035) (-755.196) [-751.890] (-755.274) -- 0:00:27
554000 -- (-755.091) (-752.382) (-753.303) [-753.649] * (-754.569) (-753.451) (-750.696) [-755.297] -- 0:00:27
554500 -- (-758.363) [-756.846] (-759.470) (-753.456) * (-755.802) (-761.616) [-751.247] (-752.039) -- 0:00:27
555000 -- (-751.251) (-754.630) (-754.286) [-753.206] * [-753.212] (-753.609) (-752.286) (-757.846) -- 0:00:28
Average standard deviation of split frequencies: 0.010280
555500 -- (-751.317) [-753.718] (-752.010) (-752.908) * (-752.593) [-752.039] (-751.203) (-757.324) -- 0:00:28
556000 -- (-751.565) (-754.212) [-752.431] (-752.641) * (-753.240) (-752.742) [-750.737] (-753.982) -- 0:00:27
556500 -- (-751.570) [-751.342] (-753.653) (-758.310) * (-751.508) [-752.086] (-751.041) (-753.283) -- 0:00:27
557000 -- [-753.700] (-757.076) (-754.751) (-752.633) * (-751.621) (-751.558) (-752.446) [-751.205] -- 0:00:27
557500 -- (-754.508) (-753.630) (-752.175) [-751.300] * (-752.832) (-750.876) (-751.674) [-752.086] -- 0:00:27
558000 -- [-753.830] (-752.374) (-752.293) (-752.791) * (-753.381) [-751.253] (-751.706) (-752.932) -- 0:00:27
558500 -- (-753.433) (-750.917) (-754.237) [-752.752] * (-759.412) (-751.112) [-750.445] (-759.699) -- 0:00:27
559000 -- (-757.405) [-751.198] (-751.878) (-754.053) * (-758.759) [-751.519] (-750.633) (-754.160) -- 0:00:27
559500 -- (-752.389) (-752.202) [-751.379] (-753.514) * (-751.395) (-755.839) [-751.116] (-754.421) -- 0:00:27
560000 -- (-750.597) [-752.992] (-753.190) (-752.529) * (-751.896) [-751.607] (-751.603) (-751.159) -- 0:00:27
Average standard deviation of split frequencies: 0.011193
560500 -- (-752.049) (-750.949) [-751.798] (-751.600) * (-751.957) (-750.541) (-753.326) [-753.908] -- 0:00:27
561000 -- (-752.038) (-750.650) (-751.781) [-752.419] * (-752.989) (-750.696) (-754.649) [-754.066] -- 0:00:27
561500 -- (-753.179) (-750.935) (-750.679) [-752.106] * (-753.526) (-751.231) (-754.098) [-752.450] -- 0:00:27
562000 -- [-752.262] (-751.364) (-754.590) (-751.423) * (-753.334) (-751.122) (-753.889) [-754.001] -- 0:00:27
562500 -- (-753.086) [-752.198] (-756.805) (-754.590) * (-752.521) (-752.104) [-752.174] (-751.708) -- 0:00:27
563000 -- [-750.869] (-754.257) (-753.147) (-752.921) * [-753.810] (-753.119) (-754.524) (-752.411) -- 0:00:27
563500 -- (-752.609) (-756.753) [-754.251] (-752.228) * [-751.713] (-751.865) (-753.295) (-751.242) -- 0:00:27
564000 -- (-755.985) (-752.289) [-755.692] (-750.469) * (-752.442) (-751.302) [-750.643] (-751.294) -- 0:00:27
564500 -- (-757.301) (-752.313) (-753.553) [-754.430] * [-751.014] (-752.240) (-752.493) (-753.246) -- 0:00:27
565000 -- (-755.901) (-750.996) (-752.829) [-753.904] * [-750.505] (-752.151) (-751.202) (-754.115) -- 0:00:26
Average standard deviation of split frequencies: 0.010827
565500 -- (-752.699) (-756.402) (-750.858) [-753.435] * [-752.960] (-753.293) (-757.073) (-753.887) -- 0:00:26
566000 -- [-751.882] (-753.639) (-752.823) (-754.745) * (-755.507) (-754.015) (-752.611) [-753.977] -- 0:00:26
566500 -- (-755.071) [-753.361] (-757.252) (-752.961) * (-753.975) (-752.729) [-751.729] (-752.263) -- 0:00:26
567000 -- (-753.925) (-753.173) (-751.260) [-751.219] * [-754.586] (-751.288) (-750.773) (-751.921) -- 0:00:26
567500 -- [-753.598] (-751.726) (-751.937) (-753.577) * (-756.310) (-751.162) (-754.291) [-760.057] -- 0:00:26
568000 -- (-754.672) (-753.293) [-751.088] (-750.524) * (-756.118) (-753.160) [-752.180] (-751.660) -- 0:00:26
568500 -- (-752.593) (-752.302) (-753.342) [-753.009] * (-752.439) (-751.246) (-750.381) [-752.119] -- 0:00:26
569000 -- (-751.177) (-752.278) [-752.394] (-752.211) * [-754.165] (-751.306) (-751.114) (-751.656) -- 0:00:26
569500 -- (-755.759) (-750.891) (-754.420) [-750.964] * (-753.905) [-752.395] (-752.453) (-751.604) -- 0:00:26
570000 -- (-752.550) (-754.597) [-754.400] (-752.519) * (-755.007) (-753.020) [-762.778] (-752.884) -- 0:00:27
Average standard deviation of split frequencies: 0.011152
570500 -- (-753.431) (-751.753) (-751.324) [-751.128] * (-753.678) (-750.681) (-753.719) [-752.506] -- 0:00:27
571000 -- (-758.387) [-750.931] (-753.751) (-751.740) * [-751.510] (-750.862) (-754.776) (-752.167) -- 0:00:27
571500 -- (-753.257) (-750.672) (-751.763) [-752.018] * (-751.090) [-752.400] (-754.648) (-752.860) -- 0:00:26
572000 -- (-751.749) (-751.642) (-752.369) [-757.346] * (-751.669) (-752.489) (-755.076) [-750.493] -- 0:00:26
572500 -- (-752.493) (-752.225) (-751.289) [-750.708] * (-751.678) (-753.339) (-752.819) [-754.869] -- 0:00:26
573000 -- (-753.536) (-753.342) (-751.229) [-753.433] * (-751.705) (-754.278) [-751.958] (-752.554) -- 0:00:26
573500 -- (-751.517) [-752.883] (-753.723) (-753.585) * (-756.000) (-752.139) [-751.648] (-751.891) -- 0:00:26
574000 -- (-753.539) (-752.087) (-750.822) [-755.534] * [-755.401] (-753.046) (-753.783) (-754.723) -- 0:00:26
574500 -- (-750.460) (-750.592) [-755.383] (-758.300) * (-754.388) (-751.456) (-752.472) [-752.863] -- 0:00:26
575000 -- (-751.909) [-751.826] (-752.560) (-755.753) * (-755.056) (-750.715) [-754.944] (-752.102) -- 0:00:26
Average standard deviation of split frequencies: 0.010639
575500 -- [-753.249] (-752.425) (-751.235) (-754.774) * (-750.583) [-750.450] (-755.406) (-751.947) -- 0:00:26
576000 -- [-755.007] (-752.431) (-751.493) (-753.192) * (-750.894) (-751.568) [-751.143] (-751.274) -- 0:00:26
576500 -- (-752.189) (-753.217) [-751.179] (-754.955) * [-754.359] (-750.540) (-751.196) (-753.485) -- 0:00:26
577000 -- (-757.424) (-753.752) [-750.613] (-752.630) * (-756.656) [-752.445] (-751.972) (-754.619) -- 0:00:26
577500 -- [-750.873] (-756.353) (-750.634) (-753.248) * [-751.241] (-754.677) (-751.254) (-751.233) -- 0:00:26
578000 -- [-751.421] (-752.701) (-750.955) (-752.708) * (-751.827) (-753.438) [-753.593] (-751.865) -- 0:00:26
578500 -- (-750.051) (-755.535) [-750.428] (-751.871) * (-752.781) [-752.053] (-750.464) (-751.761) -- 0:00:26
579000 -- (-751.080) (-752.022) [-752.244] (-752.923) * (-751.442) (-752.296) [-750.589] (-752.055) -- 0:00:26
579500 -- (-751.301) (-750.442) (-754.800) [-753.434] * [-752.489] (-753.242) (-751.627) (-753.067) -- 0:00:26
580000 -- (-753.381) [-751.511] (-752.479) (-751.342) * [-754.334] (-753.583) (-751.971) (-753.705) -- 0:00:26
Average standard deviation of split frequencies: 0.010808
580500 -- [-752.558] (-751.501) (-752.061) (-759.789) * [-750.908] (-751.507) (-750.979) (-751.473) -- 0:00:26
581000 -- [-751.679] (-753.172) (-752.951) (-759.433) * (-753.325) (-751.233) (-752.169) [-752.520] -- 0:00:25
581500 -- (-751.191) (-755.083) (-753.366) [-753.546] * (-753.126) (-751.430) [-751.898] (-755.738) -- 0:00:25
582000 -- [-752.713] (-753.775) (-752.003) (-752.746) * (-751.548) (-753.174) (-752.638) [-754.814] -- 0:00:25
582500 -- (-755.314) (-754.197) [-752.531] (-752.156) * [-751.472] (-752.061) (-752.914) (-753.884) -- 0:00:25
583000 -- [-752.858] (-752.797) (-753.000) (-755.841) * (-756.618) [-753.479] (-753.572) (-756.089) -- 0:00:25
583500 -- (-752.043) [-756.178] (-751.606) (-754.658) * (-753.632) (-753.968) [-754.540] (-752.658) -- 0:00:25
584000 -- [-751.701] (-750.402) (-750.930) (-754.971) * (-750.378) (-751.804) (-751.895) [-752.344] -- 0:00:25
584500 -- (-751.491) (-752.451) [-751.456] (-754.467) * (-753.224) (-750.988) (-752.635) [-755.528] -- 0:00:25
585000 -- (-750.539) [-751.043] (-751.203) (-751.389) * (-751.509) [-756.791] (-752.443) (-751.999) -- 0:00:26
Average standard deviation of split frequencies: 0.010810
585500 -- [-753.960] (-752.122) (-751.577) (-755.312) * (-752.167) (-753.987) (-750.805) [-753.623] -- 0:00:26
586000 -- [-751.796] (-752.650) (-755.181) (-754.945) * (-751.261) [-751.230] (-755.349) (-752.637) -- 0:00:26
586500 -- (-750.501) (-753.901) (-753.350) [-754.214] * (-754.837) (-753.379) [-752.259] (-754.501) -- 0:00:26
587000 -- [-751.084] (-754.631) (-754.415) (-755.442) * (-750.344) (-752.800) (-752.285) [-751.259] -- 0:00:26
587500 -- (-751.190) (-753.446) (-751.252) [-754.043] * (-751.566) (-752.153) [-756.041] (-751.006) -- 0:00:25
588000 -- (-752.530) (-752.655) [-754.863] (-753.433) * (-750.656) (-757.208) (-750.504) [-751.696] -- 0:00:25
588500 -- (-753.584) (-752.484) (-751.200) [-752.222] * (-752.151) (-753.996) [-751.070] (-751.402) -- 0:00:25
589000 -- [-750.754] (-751.505) (-752.865) (-754.139) * (-751.589) (-752.923) (-753.052) [-752.197] -- 0:00:25
589500 -- [-750.939] (-753.766) (-751.702) (-753.032) * [-753.086] (-750.977) (-751.506) (-753.823) -- 0:00:25
590000 -- (-751.369) [-753.860] (-756.246) (-751.907) * (-751.600) [-750.372] (-752.914) (-752.109) -- 0:00:25
Average standard deviation of split frequencies: 0.010275
590500 -- (-751.593) [-751.935] (-755.336) (-753.433) * (-751.337) [-750.672] (-754.011) (-751.328) -- 0:00:25
591000 -- [-753.005] (-755.406) (-755.898) (-756.090) * (-751.573) (-752.549) [-751.477] (-752.977) -- 0:00:25
591500 -- (-751.149) (-753.009) (-753.877) [-755.503] * (-754.393) (-752.811) [-753.359] (-753.774) -- 0:00:25
592000 -- (-752.818) (-753.736) [-751.993] (-758.171) * [-753.871] (-753.430) (-751.745) (-753.825) -- 0:00:25
592500 -- (-754.918) (-755.156) [-752.667] (-751.058) * (-757.110) (-754.923) [-750.268] (-755.973) -- 0:00:25
593000 -- (-753.400) (-751.789) [-752.843] (-752.889) * (-757.956) [-755.897] (-751.456) (-754.767) -- 0:00:25
593500 -- (-751.423) (-751.567) (-751.828) [-751.379] * (-751.692) (-755.285) (-753.015) [-753.938] -- 0:00:25
594000 -- [-755.691] (-751.177) (-752.798) (-753.148) * (-752.432) [-755.806] (-754.168) (-751.836) -- 0:00:25
594500 -- (-753.192) [-752.232] (-750.670) (-756.013) * [-750.650] (-752.775) (-756.456) (-751.094) -- 0:00:25
595000 -- [-752.483] (-754.884) (-751.286) (-755.698) * (-754.395) (-754.256) (-752.062) [-753.626] -- 0:00:25
Average standard deviation of split frequencies: 0.010085
595500 -- (-753.955) (-755.912) [-751.571] (-750.755) * (-753.354) (-750.967) [-752.613] (-751.946) -- 0:00:25
596000 -- (-755.987) [-750.705] (-761.936) (-752.708) * [-753.111] (-755.536) (-753.638) (-752.386) -- 0:00:25
596500 -- [-753.079] (-754.309) (-754.581) (-754.032) * (-751.883) (-751.154) [-750.774] (-751.366) -- 0:00:25
597000 -- (-758.462) [-754.064] (-751.301) (-754.718) * (-752.458) [-751.725] (-752.620) (-751.066) -- 0:00:24
597500 -- (-752.858) [-752.033] (-756.657) (-752.053) * [-753.007] (-750.508) (-751.492) (-751.405) -- 0:00:24
598000 -- (-760.257) (-753.300) (-752.436) [-750.904] * (-755.086) (-755.588) (-751.707) [-753.622] -- 0:00:24
598500 -- [-751.289] (-751.475) (-754.831) (-755.355) * (-757.972) [-751.397] (-754.632) (-755.285) -- 0:00:24
599000 -- (-750.960) [-755.196] (-751.623) (-757.221) * (-752.329) (-751.235) [-757.736] (-754.972) -- 0:00:24
599500 -- (-754.214) [-751.442] (-751.891) (-753.641) * (-754.286) [-751.262] (-754.264) (-754.392) -- 0:00:24
600000 -- [-750.296] (-755.868) (-752.245) (-752.424) * (-751.237) (-751.247) (-752.342) [-751.579] -- 0:00:25
Average standard deviation of split frequencies: 0.009810
600500 -- (-751.407) [-752.093] (-752.284) (-751.450) * (-752.617) (-754.287) [-752.015] (-752.036) -- 0:00:25
601000 -- [-751.407] (-753.075) (-752.077) (-752.679) * (-751.517) (-753.884) (-755.115) [-751.083] -- 0:00:25
601500 -- (-750.457) [-752.632] (-752.627) (-751.488) * (-754.354) (-754.183) [-752.648] (-751.183) -- 0:00:25
602000 -- (-750.292) (-753.209) [-751.750] (-757.823) * (-750.890) (-752.608) (-755.531) [-753.698] -- 0:00:25
602500 -- (-750.521) (-751.665) [-750.676] (-751.536) * (-753.074) [-753.047] (-752.294) (-755.387) -- 0:00:25
603000 -- [-751.125] (-752.381) (-751.893) (-752.659) * [-754.820] (-752.397) (-750.663) (-753.027) -- 0:00:25
603500 -- [-752.950] (-753.329) (-752.179) (-754.613) * (-753.603) (-750.982) [-750.684] (-753.822) -- 0:00:24
604000 -- (-756.211) (-751.352) [-753.188] (-753.206) * [-751.189] (-750.859) (-754.706) (-755.758) -- 0:00:24
604500 -- [-753.884] (-752.308) (-753.813) (-758.620) * (-758.979) [-757.393] (-752.955) (-753.481) -- 0:00:24
605000 -- [-751.527] (-752.704) (-753.983) (-759.020) * (-754.774) (-756.910) (-757.820) [-757.895] -- 0:00:24
Average standard deviation of split frequencies: 0.009432
605500 -- [-750.759] (-758.302) (-757.496) (-753.019) * [-751.906] (-752.114) (-751.269) (-756.996) -- 0:00:24
606000 -- (-750.524) (-756.716) [-751.548] (-751.449) * [-754.100] (-753.694) (-752.762) (-751.744) -- 0:00:24
606500 -- (-754.511) (-753.966) (-752.436) [-751.927] * [-753.533] (-756.216) (-751.427) (-753.300) -- 0:00:24
607000 -- (-752.126) (-752.007) (-752.476) [-751.633] * (-753.221) [-756.424] (-752.170) (-752.587) -- 0:00:24
607500 -- (-753.365) (-751.417) (-752.281) [-752.424] * (-750.585) (-755.444) [-755.810] (-753.015) -- 0:00:24
608000 -- [-752.742] (-751.812) (-751.727) (-754.309) * (-751.136) (-753.745) [-754.162] (-752.502) -- 0:00:24
608500 -- (-753.282) [-752.663] (-754.061) (-753.313) * (-755.139) (-751.338) (-753.046) [-752.847] -- 0:00:24
609000 -- [-751.801] (-752.078) (-752.150) (-751.756) * (-753.123) [-754.210] (-754.963) (-750.816) -- 0:00:24
609500 -- (-752.120) (-752.615) [-753.887] (-751.079) * [-750.410] (-759.568) (-751.885) (-751.993) -- 0:00:24
610000 -- (-751.126) (-752.091) (-751.956) [-751.998] * (-755.439) [-754.539] (-750.412) (-751.106) -- 0:00:24
Average standard deviation of split frequencies: 0.008974
610500 -- (-754.961) [-751.334] (-752.493) (-754.978) * (-751.096) [-752.030] (-750.727) (-750.521) -- 0:00:24
611000 -- (-755.132) (-752.717) [-755.201] (-751.367) * (-755.108) [-752.049] (-751.349) (-751.690) -- 0:00:24
611500 -- (-754.194) (-752.487) (-754.944) [-751.036] * [-754.074] (-751.774) (-752.146) (-750.697) -- 0:00:24
612000 -- [-755.255] (-751.894) (-753.482) (-750.704) * (-755.301) (-753.568) [-751.151] (-754.334) -- 0:00:24
612500 -- (-752.995) [-751.655] (-754.071) (-753.591) * (-753.989) (-753.297) [-755.525] (-751.661) -- 0:00:24
613000 -- (-753.425) (-751.815) (-753.444) [-750.896] * (-752.810) (-753.152) (-760.343) [-751.909] -- 0:00:23
613500 -- (-759.614) [-753.407] (-752.500) (-752.561) * (-753.538) (-754.831) [-751.409] (-750.378) -- 0:00:24
614000 -- [-751.661] (-753.090) (-752.774) (-751.427) * [-751.340] (-752.899) (-751.278) (-752.166) -- 0:00:24
614500 -- (-751.375) (-752.177) (-751.170) [-752.206] * (-757.342) (-752.118) (-752.957) [-752.677] -- 0:00:24
615000 -- (-750.940) (-750.919) (-752.657) [-752.222] * (-751.030) [-752.588] (-753.550) (-753.313) -- 0:00:24
Average standard deviation of split frequencies: 0.009279
615500 -- (-751.216) (-752.713) (-752.363) [-754.342] * (-750.868) (-755.546) (-751.729) [-751.786] -- 0:00:24
616000 -- [-753.959] (-752.675) (-750.721) (-751.929) * [-751.476] (-752.178) (-753.971) (-754.910) -- 0:00:24
616500 -- (-754.062) [-752.939] (-751.497) (-754.292) * [-751.608] (-751.387) (-753.540) (-750.451) -- 0:00:24
617000 -- (-753.425) (-751.943) [-753.119] (-751.512) * (-753.261) [-755.916] (-750.757) (-750.714) -- 0:00:24
617500 -- (-754.182) (-752.415) (-752.089) [-751.385] * (-754.366) [-752.251] (-751.473) (-754.385) -- 0:00:24
618000 -- [-751.497] (-752.330) (-752.973) (-754.107) * (-753.732) [-750.506] (-752.928) (-752.931) -- 0:00:24
618500 -- [-751.679] (-752.258) (-753.130) (-753.492) * (-753.874) (-751.747) (-753.119) [-750.666] -- 0:00:24
619000 -- [-752.865] (-751.832) (-755.064) (-751.507) * (-752.440) [-752.304] (-753.983) (-750.731) -- 0:00:24
619500 -- [-752.690] (-750.572) (-752.607) (-750.825) * (-750.980) [-751.049] (-750.436) (-751.121) -- 0:00:23
620000 -- (-753.358) (-752.533) (-750.782) [-751.302] * (-752.587) (-754.003) (-751.327) [-752.260] -- 0:00:23
Average standard deviation of split frequencies: 0.009162
620500 -- (-752.260) (-753.648) (-756.975) [-751.052] * (-752.930) [-753.297] (-751.320) (-750.955) -- 0:00:23
621000 -- (-751.469) (-751.348) [-752.220] (-751.919) * (-751.561) [-752.719] (-754.174) (-751.456) -- 0:00:23
621500 -- [-751.044] (-751.647) (-751.397) (-751.822) * (-753.006) (-753.105) (-752.871) [-753.760] -- 0:00:23
622000 -- (-751.004) (-751.461) (-753.970) [-751.513] * [-752.494] (-755.241) (-753.566) (-754.116) -- 0:00:23
622500 -- (-754.536) [-751.111] (-752.084) (-754.948) * [-751.492] (-751.784) (-751.948) (-752.056) -- 0:00:23
623000 -- (-750.951) (-754.164) (-752.771) [-751.748] * (-752.317) (-754.134) [-750.946] (-751.091) -- 0:00:23
623500 -- [-751.998] (-752.670) (-752.557) (-756.009) * [-752.425] (-756.806) (-754.555) (-751.984) -- 0:00:23
624000 -- (-751.391) (-755.778) [-752.972] (-753.708) * (-755.470) [-755.376] (-752.359) (-754.429) -- 0:00:23
624500 -- [-753.671] (-761.670) (-752.021) (-752.739) * (-751.729) [-751.986] (-751.584) (-754.085) -- 0:00:23
625000 -- (-750.973) (-762.293) [-750.657] (-753.297) * [-754.186] (-752.164) (-751.397) (-751.474) -- 0:00:23
Average standard deviation of split frequencies: 0.008989
625500 -- (-751.132) [-753.060] (-752.826) (-753.484) * (-750.334) [-753.095] (-756.066) (-753.708) -- 0:00:23
626000 -- (-751.221) (-753.418) (-751.924) [-752.017] * (-751.526) [-751.684] (-754.844) (-755.995) -- 0:00:23
626500 -- (-752.966) [-750.889] (-752.702) (-751.881) * (-750.685) [-751.826] (-754.418) (-754.664) -- 0:00:23
627000 -- (-757.160) [-750.790] (-756.773) (-753.830) * [-750.689] (-754.598) (-750.750) (-755.135) -- 0:00:23
627500 -- (-751.953) (-751.059) (-753.807) [-753.621] * [-750.282] (-752.506) (-751.687) (-757.242) -- 0:00:23
628000 -- [-754.161] (-755.595) (-753.624) (-753.577) * (-750.708) [-752.354] (-756.315) (-757.318) -- 0:00:23
628500 -- (-751.306) (-752.649) (-751.754) [-751.084] * (-752.758) [-752.098] (-756.577) (-756.321) -- 0:00:23
629000 -- [-750.815] (-750.543) (-751.837) (-750.781) * (-753.983) (-755.004) [-751.678] (-750.809) -- 0:00:23
629500 -- (-750.889) [-751.476] (-752.084) (-750.876) * (-751.683) (-754.486) [-756.308] (-750.738) -- 0:00:23
630000 -- (-750.888) (-754.131) (-751.690) [-751.485] * (-751.074) (-754.699) [-751.448] (-754.007) -- 0:00:23
Average standard deviation of split frequencies: 0.008409
630500 -- (-751.135) (-761.821) (-751.742) [-752.070] * [-750.784] (-750.914) (-756.228) (-752.205) -- 0:00:23
631000 -- [-751.001] (-752.885) (-753.349) (-756.851) * (-750.885) (-756.667) (-754.973) [-752.583] -- 0:00:23
631500 -- (-751.409) (-753.505) (-758.662) [-754.581] * (-753.608) [-751.079] (-754.629) (-753.538) -- 0:00:23
632000 -- (-754.726) [-752.572] (-753.404) (-750.818) * (-751.193) [-752.082] (-752.927) (-754.322) -- 0:00:23
632500 -- (-753.273) (-752.387) [-752.558] (-757.150) * [-751.369] (-756.657) (-752.961) (-753.654) -- 0:00:23
633000 -- (-754.527) (-755.300) (-754.273) [-754.035] * (-751.978) [-753.536] (-754.467) (-755.537) -- 0:00:23
633500 -- (-751.668) [-753.283] (-753.533) (-754.357) * [-752.291] (-752.522) (-757.383) (-752.702) -- 0:00:23
634000 -- [-751.162] (-754.687) (-751.988) (-751.812) * (-751.594) [-750.978] (-755.951) (-752.584) -- 0:00:23
634500 -- (-750.739) (-757.700) [-752.460] (-752.097) * (-750.908) [-751.530] (-751.646) (-755.578) -- 0:00:23
635000 -- (-754.845) [-758.241] (-752.298) (-751.953) * (-754.147) (-755.505) (-753.354) [-753.514] -- 0:00:22
Average standard deviation of split frequencies: 0.009033
635500 -- (-752.228) [-752.816] (-752.254) (-759.157) * [-752.424] (-752.086) (-753.694) (-752.093) -- 0:00:22
636000 -- [-751.734] (-753.027) (-751.308) (-750.875) * (-750.682) (-752.309) [-752.780] (-753.113) -- 0:00:22
636500 -- (-752.776) [-752.406] (-755.101) (-752.853) * (-759.078) (-752.745) (-754.358) [-751.844] -- 0:00:22
637000 -- (-751.814) (-754.602) [-751.065] (-751.647) * (-751.619) (-753.987) (-752.413) [-751.571] -- 0:00:22
637500 -- (-751.486) (-753.238) [-750.480] (-755.705) * (-756.731) (-751.176) [-752.951] (-752.669) -- 0:00:22
638000 -- (-753.048) (-753.596) [-753.375] (-751.193) * [-753.242] (-752.596) (-753.015) (-754.158) -- 0:00:22
638500 -- (-756.043) [-751.756] (-752.203) (-750.779) * (-752.089) (-752.739) [-751.163] (-752.836) -- 0:00:22
639000 -- (-755.628) (-752.881) [-751.911] (-752.972) * (-750.444) (-752.784) (-750.830) [-751.006] -- 0:00:22
639500 -- (-756.863) [-752.336] (-751.350) (-753.637) * (-750.418) (-752.180) (-751.397) [-754.088] -- 0:00:22
640000 -- (-752.778) (-753.244) (-754.829) [-755.967] * (-751.964) [-752.090] (-753.441) (-754.399) -- 0:00:22
Average standard deviation of split frequencies: 0.008462
640500 -- (-752.759) (-752.820) [-753.201] (-751.126) * (-751.916) (-753.153) [-752.112] (-751.702) -- 0:00:22
641000 -- [-753.962] (-755.271) (-756.825) (-751.543) * (-754.083) (-753.567) [-751.727] (-751.399) -- 0:00:22
641500 -- (-752.339) [-753.414] (-752.021) (-752.161) * (-752.072) (-754.242) [-751.112] (-752.814) -- 0:00:22
642000 -- (-755.771) [-752.446] (-753.049) (-750.577) * (-754.538) (-750.648) (-754.769) [-752.646] -- 0:00:22
642500 -- (-751.528) (-759.557) [-750.397] (-755.621) * (-751.147) [-750.657] (-750.734) (-752.103) -- 0:00:22
643000 -- (-753.435) (-752.414) [-751.482] (-751.318) * (-753.796) [-755.185] (-751.055) (-750.250) -- 0:00:22
643500 -- (-753.439) [-752.338] (-753.373) (-752.332) * (-753.544) [-752.122] (-753.020) (-753.675) -- 0:00:22
644000 -- (-754.114) (-751.345) (-754.801) [-752.258] * (-756.756) (-753.934) [-755.379] (-750.931) -- 0:00:22
644500 -- [-751.216] (-753.545) (-755.519) (-751.630) * (-753.130) (-753.709) (-754.646) [-755.305] -- 0:00:22
645000 -- [-751.523] (-754.036) (-753.469) (-752.965) * [-752.874] (-753.120) (-751.356) (-751.730) -- 0:00:22
Average standard deviation of split frequencies: 0.008209
645500 -- (-755.169) (-751.953) [-751.619] (-750.556) * (-759.105) (-752.953) (-752.407) [-750.643] -- 0:00:22
646000 -- (-753.845) (-751.133) (-750.122) [-751.606] * (-755.165) [-752.986] (-753.753) (-754.478) -- 0:00:22
646500 -- (-751.691) (-752.544) (-752.284) [-752.091] * [-752.004] (-751.931) (-751.681) (-755.068) -- 0:00:22
647000 -- (-756.581) (-752.504) (-753.101) [-751.826] * (-751.935) (-751.203) (-755.813) [-752.111] -- 0:00:22
647500 -- (-750.289) (-752.066) (-752.270) [-755.769] * (-753.665) (-751.369) (-760.406) [-751.317] -- 0:00:22
648000 -- [-752.095] (-752.199) (-753.332) (-753.861) * (-753.217) (-755.509) (-751.355) [-751.317] -- 0:00:22
648500 -- [-752.459] (-752.738) (-754.608) (-755.726) * [-755.992] (-751.262) (-752.565) (-754.594) -- 0:00:22
649000 -- (-751.157) (-755.540) (-750.899) [-756.457] * (-760.450) (-753.292) (-752.441) [-754.822] -- 0:00:22
649500 -- (-752.414) (-753.485) [-754.676] (-752.413) * (-755.928) (-753.027) (-751.525) [-751.047] -- 0:00:22
650000 -- [-751.953] (-752.731) (-751.270) (-756.447) * [-752.110] (-751.866) (-752.915) (-751.047) -- 0:00:22
Average standard deviation of split frequencies: 0.008830
650500 -- (-758.247) (-752.601) [-752.521] (-752.317) * (-750.929) [-752.979] (-753.364) (-752.195) -- 0:00:22
651000 -- (-752.514) [-753.118] (-753.158) (-751.488) * (-750.791) (-753.504) [-753.871] (-752.569) -- 0:00:21
651500 -- [-755.387] (-751.859) (-754.981) (-752.730) * (-751.884) [-752.161] (-750.545) (-751.832) -- 0:00:21
652000 -- [-757.411] (-753.936) (-754.880) (-754.268) * (-754.539) [-750.367] (-750.803) (-751.990) -- 0:00:21
652500 -- (-752.064) [-753.015] (-754.063) (-750.568) * (-751.515) (-752.015) (-751.883) [-753.133] -- 0:00:21
653000 -- (-752.795) (-754.236) (-752.827) [-752.429] * (-750.366) (-751.113) (-752.029) [-750.205] -- 0:00:21
653500 -- (-754.490) (-755.908) [-751.008] (-752.676) * [-751.183] (-750.805) (-754.888) (-754.036) -- 0:00:21
654000 -- (-751.310) (-754.509) (-752.883) [-753.902] * (-751.765) (-754.958) [-755.105] (-751.690) -- 0:00:21
654500 -- (-751.212) (-752.150) [-751.150] (-752.364) * (-751.290) [-753.609] (-753.569) (-756.567) -- 0:00:21
655000 -- (-754.971) (-753.597) [-751.385] (-756.364) * (-755.655) (-754.159) [-753.780] (-755.137) -- 0:00:21
Average standard deviation of split frequencies: 0.008803
655500 -- (-753.149) (-751.357) [-751.879] (-752.622) * (-750.669) (-752.395) [-754.332] (-753.271) -- 0:00:21
656000 -- [-753.655] (-753.388) (-753.309) (-751.824) * (-750.722) (-751.185) [-755.855] (-752.423) -- 0:00:21
656500 -- (-754.482) (-751.556) [-756.132] (-752.538) * [-750.273] (-750.935) (-752.861) (-754.642) -- 0:00:21
657000 -- [-753.166] (-753.228) (-752.775) (-751.598) * (-750.255) [-750.907] (-753.045) (-753.879) -- 0:00:21
657500 -- (-752.738) (-754.413) [-752.794] (-750.603) * (-750.191) (-750.725) [-753.702] (-750.301) -- 0:00:21
658000 -- (-752.619) (-755.094) [-753.828] (-750.796) * [-750.160] (-750.693) (-752.755) (-751.176) -- 0:00:21
658500 -- [-752.276] (-751.562) (-750.637) (-751.576) * (-752.760) [-753.081] (-754.552) (-751.404) -- 0:00:21
659000 -- (-753.220) (-755.263) (-751.353) [-755.199] * (-752.561) (-754.109) [-751.770] (-756.607) -- 0:00:21
659500 -- (-753.057) (-754.134) [-752.475] (-758.849) * [-753.029] (-750.917) (-750.901) (-755.975) -- 0:00:21
660000 -- (-752.344) [-753.250] (-753.733) (-754.418) * [-754.357] (-750.780) (-752.353) (-752.843) -- 0:00:21
Average standard deviation of split frequencies: 0.008919
660500 -- (-752.999) (-751.787) (-755.324) [-751.484] * (-753.482) (-752.040) (-751.379) [-750.898] -- 0:00:21
661000 -- (-754.324) [-750.851] (-756.871) (-752.123) * [-753.911] (-752.938) (-751.720) (-752.446) -- 0:00:21
661500 -- (-752.641) (-751.322) (-750.885) [-750.905] * (-757.214) (-751.835) (-755.245) [-754.888] -- 0:00:21
662000 -- (-752.637) (-750.606) (-751.873) [-752.220] * [-751.701] (-752.132) (-752.676) (-753.875) -- 0:00:21
662500 -- (-753.275) (-751.995) [-752.561] (-754.843) * (-752.246) (-750.596) [-750.712] (-751.866) -- 0:00:21
663000 -- (-751.603) (-751.971) (-751.882) [-751.698] * (-752.110) [-753.272] (-750.809) (-751.435) -- 0:00:21
663500 -- (-753.717) (-751.535) [-751.431] (-751.573) * (-752.331) [-753.985] (-751.886) (-753.040) -- 0:00:21
664000 -- (-752.324) (-752.296) (-752.647) [-753.059] * (-750.797) (-753.514) (-752.502) [-754.540] -- 0:00:21
664500 -- [-752.635] (-752.322) (-751.070) (-752.958) * (-753.379) (-751.196) [-752.217] (-752.402) -- 0:00:21
665000 -- [-753.795] (-753.391) (-751.181) (-750.251) * [-750.905] (-751.438) (-751.681) (-752.029) -- 0:00:21
Average standard deviation of split frequencies: 0.008892
665500 -- (-756.936) (-756.227) [-752.663] (-752.666) * (-751.320) (-761.960) [-751.177] (-751.788) -- 0:00:21
666000 -- (-752.915) [-752.226] (-752.936) (-752.915) * [-750.738] (-754.262) (-751.411) (-752.904) -- 0:00:21
666500 -- (-753.167) [-752.391] (-751.972) (-752.557) * (-752.838) [-751.732] (-757.561) (-752.461) -- 0:00:21
667000 -- (-753.221) (-753.309) (-753.766) [-758.288] * [-753.685] (-751.139) (-752.942) (-753.208) -- 0:00:20
667500 -- (-756.678) [-752.048] (-752.133) (-752.475) * (-753.024) [-750.307] (-751.933) (-753.273) -- 0:00:20
668000 -- (-752.362) (-751.043) [-750.623] (-756.845) * (-753.634) [-753.183] (-751.869) (-752.267) -- 0:00:20
668500 -- (-752.247) (-751.563) [-752.741] (-752.514) * (-753.461) [-754.963] (-751.531) (-752.276) -- 0:00:20
669000 -- (-752.162) (-755.813) (-752.759) [-752.358] * (-754.588) (-755.938) (-751.394) [-750.845] -- 0:00:20
669500 -- (-751.268) (-753.207) (-753.911) [-751.861] * (-755.164) (-757.676) [-754.899] (-753.458) -- 0:00:20
670000 -- [-751.025] (-754.429) (-752.938) (-751.946) * (-755.889) [-752.594] (-756.656) (-752.188) -- 0:00:20
Average standard deviation of split frequencies: 0.008830
670500 -- (-752.921) [-751.880] (-752.250) (-752.153) * (-751.478) (-752.177) (-752.109) [-752.693] -- 0:00:20
671000 -- (-752.143) (-750.799) [-751.749] (-752.194) * [-751.452] (-757.427) (-752.872) (-751.587) -- 0:00:20
671500 -- (-750.939) (-752.293) (-751.210) [-751.874] * (-757.535) (-753.922) (-752.520) [-750.722] -- 0:00:20
672000 -- [-751.317] (-752.750) (-750.857) (-751.843) * (-757.845) [-752.221] (-751.683) (-753.028) -- 0:00:20
672500 -- (-750.899) [-752.360] (-751.374) (-750.930) * [-751.881] (-750.627) (-751.929) (-755.459) -- 0:00:20
673000 -- (-751.007) (-751.374) [-751.396] (-752.096) * [-750.907] (-751.140) (-752.543) (-751.635) -- 0:00:20
673500 -- (-750.981) (-751.571) (-750.854) [-753.091] * (-751.338) (-750.736) (-753.911) [-751.741] -- 0:00:20
674000 -- (-750.722) (-751.461) [-751.698] (-751.595) * [-752.950] (-750.404) (-750.990) (-753.257) -- 0:00:20
674500 -- (-752.625) [-753.332] (-751.196) (-753.164) * (-752.005) [-753.054] (-750.665) (-756.195) -- 0:00:20
675000 -- (-753.853) [-752.461] (-751.891) (-752.182) * [-753.582] (-752.451) (-751.632) (-756.025) -- 0:00:20
Average standard deviation of split frequencies: 0.008848
675500 -- (-753.522) (-752.750) (-750.814) [-752.221] * [-753.269] (-753.908) (-751.889) (-752.077) -- 0:00:20
676000 -- (-754.150) (-751.235) (-752.310) [-753.223] * (-751.310) (-752.925) (-752.137) [-751.894] -- 0:00:20
676500 -- (-753.218) (-753.077) (-752.191) [-751.954] * [-752.373] (-752.504) (-750.847) (-750.785) -- 0:00:20
677000 -- (-754.240) (-751.278) (-754.004) [-752.038] * (-750.582) (-752.490) (-754.118) [-750.247] -- 0:00:20
677500 -- [-751.742] (-751.877) (-750.657) (-752.032) * (-759.935) [-753.974] (-753.848) (-753.398) -- 0:00:20
678000 -- (-750.757) (-750.754) [-752.206] (-757.381) * [-753.040] (-757.023) (-757.453) (-752.692) -- 0:00:20
678500 -- [-752.755] (-750.562) (-757.413) (-756.325) * (-751.811) [-753.231] (-753.178) (-750.407) -- 0:00:20
679000 -- (-754.434) (-752.559) (-756.157) [-753.917] * (-751.641) (-752.297) (-751.793) [-752.072] -- 0:00:20
679500 -- [-755.476] (-753.014) (-753.726) (-755.903) * (-750.756) (-752.345) [-752.156] (-752.014) -- 0:00:20
680000 -- (-754.674) (-755.784) (-752.070) [-752.519] * (-751.541) (-750.548) [-751.390] (-752.015) -- 0:00:20
Average standard deviation of split frequencies: 0.008960
680500 -- (-757.385) (-760.020) [-750.708] (-752.587) * (-752.561) (-752.063) (-753.047) [-750.988] -- 0:00:20
681000 -- (-754.301) [-750.255] (-752.288) (-753.295) * (-753.175) [-750.836] (-754.671) (-752.731) -- 0:00:20
681500 -- (-750.776) (-753.431) (-752.517) [-754.195] * [-753.486] (-752.592) (-752.289) (-752.190) -- 0:00:20
682000 -- (-752.442) [-752.862] (-754.507) (-754.181) * (-752.389) (-752.240) (-750.376) [-754.635] -- 0:00:20
682500 -- (-751.201) [-751.033] (-754.616) (-753.521) * (-751.807) (-752.311) [-751.165] (-752.573) -- 0:00:20
683000 -- (-758.544) (-753.232) (-751.146) [-753.023] * (-753.592) [-750.152] (-751.124) (-753.153) -- 0:00:19
683500 -- [-752.243] (-755.355) (-752.981) (-750.988) * (-753.382) (-757.006) (-751.611) [-752.136] -- 0:00:19
684000 -- [-751.049] (-755.496) (-752.698) (-752.351) * (-752.120) [-751.434] (-752.578) (-753.086) -- 0:00:19
684500 -- (-751.866) [-752.895] (-751.367) (-756.186) * [-751.182] (-750.969) (-750.921) (-753.576) -- 0:00:19
685000 -- (-751.016) (-752.040) [-754.466] (-755.399) * (-751.244) (-750.270) [-750.889] (-753.804) -- 0:00:19
Average standard deviation of split frequencies: 0.009234
685500 -- (-753.683) [-755.850] (-751.913) (-750.734) * (-751.071) (-753.128) (-753.029) [-752.090] -- 0:00:19
686000 -- (-751.290) [-751.557] (-758.393) (-750.977) * (-750.912) (-750.386) (-753.171) [-751.349] -- 0:00:19
686500 -- (-753.958) (-755.145) [-756.660] (-753.904) * [-751.744] (-752.422) (-753.911) (-752.472) -- 0:00:19
687000 -- (-753.338) [-752.706] (-751.352) (-754.261) * (-752.376) (-753.405) (-751.274) [-751.975] -- 0:00:19
687500 -- (-753.847) (-754.805) [-753.643] (-755.168) * (-753.036) [-751.761] (-753.012) (-751.541) -- 0:00:19
688000 -- (-751.377) (-752.916) (-751.336) [-752.182] * [-753.120] (-751.890) (-753.092) (-753.098) -- 0:00:19
688500 -- (-752.450) [-752.280] (-751.592) (-751.691) * [-752.765] (-753.332) (-750.602) (-750.541) -- 0:00:19
689000 -- (-754.099) (-753.321) (-752.437) [-755.647] * (-751.088) (-754.576) [-750.686] (-751.425) -- 0:00:19
689500 -- (-754.553) [-751.824] (-753.344) (-750.769) * (-750.246) (-753.897) [-751.345] (-751.201) -- 0:00:19
690000 -- (-755.146) (-756.732) (-755.471) [-751.670] * [-750.239] (-755.974) (-753.629) (-751.759) -- 0:00:19
Average standard deviation of split frequencies: 0.009683
690500 -- [-753.022] (-753.337) (-756.511) (-754.543) * [-750.321] (-754.031) (-754.332) (-752.076) -- 0:00:19
691000 -- (-752.149) (-754.599) (-753.521) [-753.602] * (-751.759) (-756.102) (-751.342) [-754.020] -- 0:00:19
691500 -- (-755.012) [-752.049] (-754.488) (-751.593) * (-753.281) (-754.461) [-751.938] (-751.512) -- 0:00:19
692000 -- (-752.098) [-753.968] (-754.465) (-753.049) * (-751.173) (-755.230) (-750.533) [-750.842] -- 0:00:19
692500 -- (-754.586) (-756.492) (-750.774) [-751.975] * (-751.196) [-753.203] (-751.253) (-751.329) -- 0:00:19
693000 -- (-752.496) (-751.044) [-750.285] (-750.855) * (-755.053) [-751.707] (-751.458) (-752.040) -- 0:00:19
693500 -- (-753.609) (-751.303) [-755.842] (-751.697) * (-755.079) [-751.765] (-755.241) (-751.398) -- 0:00:19
694000 -- [-751.573] (-753.783) (-750.437) (-752.086) * (-752.785) (-751.472) [-752.384] (-751.894) -- 0:00:19
694500 -- (-751.970) (-755.406) [-753.036] (-758.111) * (-751.681) (-754.136) [-752.573] (-756.915) -- 0:00:19
695000 -- (-752.151) (-752.202) [-754.868] (-759.679) * (-751.891) (-750.706) (-751.711) [-754.920] -- 0:00:19
Average standard deviation of split frequencies: 0.009779
695500 -- (-754.222) [-751.253] (-752.831) (-755.748) * (-751.766) [-752.148] (-751.589) (-757.461) -- 0:00:19
696000 -- (-754.990) (-757.839) [-755.668] (-751.957) * [-751.300] (-752.789) (-750.764) (-750.351) -- 0:00:19
696500 -- [-754.828] (-752.975) (-753.149) (-754.165) * [-754.119] (-752.053) (-752.080) (-751.022) -- 0:00:19
697000 -- (-752.790) [-756.159] (-752.365) (-754.590) * (-751.927) (-754.912) [-751.865] (-752.419) -- 0:00:19
697500 -- (-750.198) [-750.969] (-753.614) (-751.469) * (-750.899) (-753.870) [-750.955] (-750.889) -- 0:00:19
698000 -- (-751.790) [-750.304] (-753.748) (-752.482) * (-752.845) [-753.633] (-752.800) (-751.724) -- 0:00:19
698500 -- (-751.274) (-750.724) (-751.918) [-751.622] * (-751.353) (-754.418) [-751.548] (-752.668) -- 0:00:18
699000 -- (-755.981) (-755.450) (-751.922) [-751.566] * (-753.475) (-750.959) (-753.659) [-754.784] -- 0:00:18
699500 -- [-752.383] (-752.946) (-751.347) (-752.944) * (-757.944) [-750.114] (-756.682) (-752.117) -- 0:00:18
700000 -- (-750.356) (-753.010) (-753.591) [-752.048] * (-752.036) [-750.359] (-758.121) (-754.381) -- 0:00:18
Average standard deviation of split frequencies: 0.009419
700500 -- (-752.630) (-751.803) [-750.352] (-755.322) * [-751.405] (-750.369) (-752.641) (-755.686) -- 0:00:18
701000 -- (-751.937) (-750.199) (-750.695) [-751.806] * (-751.774) (-755.500) (-755.955) [-754.016] -- 0:00:18
701500 -- [-752.344] (-760.352) (-754.742) (-750.393) * (-750.859) (-752.309) (-754.474) [-754.983] -- 0:00:18
702000 -- (-757.150) (-757.347) (-752.239) [-752.225] * [-753.601] (-751.559) (-751.404) (-754.595) -- 0:00:18
702500 -- (-753.514) (-758.310) (-758.056) [-750.963] * (-751.236) [-750.730] (-752.476) (-750.735) -- 0:00:18
703000 -- (-755.718) [-754.531] (-756.730) (-751.675) * (-753.406) [-752.733] (-756.176) (-754.911) -- 0:00:18
703500 -- (-750.743) [-752.123] (-752.424) (-751.328) * (-752.994) [-750.880] (-757.473) (-753.146) -- 0:00:18
704000 -- (-750.757) (-751.892) (-753.984) [-756.456] * [-753.931] (-750.827) (-751.225) (-750.603) -- 0:00:18
704500 -- (-754.808) (-751.449) [-754.016] (-759.111) * (-753.683) [-750.666] (-751.116) (-752.323) -- 0:00:18
705000 -- (-751.152) [-751.287] (-754.822) (-752.548) * (-753.668) (-751.811) [-752.297] (-752.358) -- 0:00:18
Average standard deviation of split frequencies: 0.009390
705500 -- [-751.475] (-751.743) (-752.980) (-753.210) * (-755.435) (-754.801) (-755.865) [-758.289] -- 0:00:18
706000 -- [-751.846] (-754.930) (-754.052) (-750.921) * [-752.440] (-753.235) (-755.547) (-753.112) -- 0:00:18
706500 -- (-751.241) (-754.200) (-755.695) [-751.329] * (-755.360) (-755.069) (-754.066) [-752.108] -- 0:00:18
707000 -- [-751.972] (-755.291) (-754.460) (-758.303) * (-752.055) (-752.279) (-753.384) [-753.984] -- 0:00:18
707500 -- [-750.651] (-752.541) (-751.888) (-762.655) * (-756.585) (-753.239) [-751.239] (-753.048) -- 0:00:18
708000 -- (-752.351) (-752.768) (-752.029) [-753.494] * [-753.691] (-752.561) (-754.151) (-751.350) -- 0:00:18
708500 -- (-751.264) [-751.238] (-751.269) (-753.343) * (-755.776) (-754.527) (-755.297) [-750.621] -- 0:00:18
709000 -- (-750.905) [-751.825] (-753.951) (-753.351) * (-755.005) (-756.666) (-753.050) [-750.497] -- 0:00:18
709500 -- [-752.134] (-752.799) (-750.347) (-752.553) * (-754.609) (-751.057) (-751.653) [-751.226] -- 0:00:18
710000 -- (-753.689) [-751.038] (-752.986) (-751.415) * (-752.091) (-753.109) [-752.137] (-751.716) -- 0:00:18
Average standard deviation of split frequencies: 0.008996
710500 -- (-751.783) (-752.758) (-753.312) [-752.907] * (-753.674) (-752.615) (-750.845) [-751.223] -- 0:00:18
711000 -- (-751.737) [-753.371] (-751.827) (-752.773) * [-750.740] (-751.641) (-751.653) (-753.311) -- 0:00:18
711500 -- (-751.057) (-755.071) [-750.834] (-751.317) * (-753.981) (-751.704) [-750.914] (-751.000) -- 0:00:18
712000 -- (-750.411) (-756.292) (-753.209) [-752.455] * (-752.172) [-751.884] (-753.876) (-751.028) -- 0:00:18
712500 -- (-750.818) (-752.464) [-752.009] (-754.384) * (-753.352) (-753.726) [-752.047] (-753.429) -- 0:00:18
713000 -- (-751.821) (-754.548) [-750.565] (-752.906) * (-753.694) [-751.440] (-754.859) (-752.877) -- 0:00:18
713500 -- [-753.090] (-751.800) (-751.108) (-753.265) * (-750.648) (-752.634) (-751.327) [-751.374] -- 0:00:18
714000 -- (-753.102) (-754.813) [-751.402] (-754.421) * (-754.752) [-751.544] (-755.135) (-753.645) -- 0:00:18
714500 -- (-755.185) [-752.717] (-753.096) (-752.780) * (-752.017) (-751.563) (-760.061) [-752.313] -- 0:00:17
715000 -- (-752.672) (-751.837) (-756.658) [-751.140] * (-752.359) [-750.705] (-751.405) (-750.495) -- 0:00:17
Average standard deviation of split frequencies: 0.008971
715500 -- (-751.804) (-751.072) [-761.469] (-752.899) * [-753.144] (-752.423) (-754.297) (-750.763) -- 0:00:17
716000 -- [-752.532] (-753.204) (-755.839) (-751.897) * [-753.364] (-751.953) (-752.067) (-756.967) -- 0:00:17
716500 -- [-751.745] (-752.331) (-760.254) (-753.893) * (-751.685) [-750.555] (-754.128) (-754.853) -- 0:00:17
717000 -- (-751.745) (-754.185) (-754.760) [-751.580] * [-752.559] (-753.292) (-753.342) (-753.801) -- 0:00:17
717500 -- (-753.050) [-752.056] (-754.148) (-751.542) * [-750.730] (-753.864) (-754.500) (-750.666) -- 0:00:17
718000 -- [-751.848] (-752.186) (-751.117) (-753.615) * (-750.538) (-753.865) [-753.071] (-750.467) -- 0:00:17
718500 -- (-751.363) (-752.810) (-751.194) [-750.335] * [-752.384] (-751.378) (-751.243) (-754.698) -- 0:00:17
719000 -- (-751.667) (-752.918) [-751.237] (-751.700) * [-751.377] (-755.749) (-751.710) (-751.650) -- 0:00:17
719500 -- (-753.490) (-752.047) [-759.205] (-752.658) * (-752.742) (-761.245) (-751.499) [-752.855] -- 0:00:17
720000 -- (-753.502) [-752.723] (-756.959) (-752.947) * (-751.325) [-754.571] (-752.744) (-754.906) -- 0:00:17
Average standard deviation of split frequencies: 0.008912
720500 -- [-750.188] (-755.357) (-752.865) (-752.575) * (-750.895) (-754.550) (-758.642) [-751.481] -- 0:00:17
721000 -- (-751.918) (-751.679) (-751.535) [-753.370] * [-751.328] (-757.000) (-754.533) (-751.244) -- 0:00:17
721500 -- (-751.668) (-753.568) (-753.537) [-752.546] * (-752.044) [-753.898] (-752.547) (-751.959) -- 0:00:17
722000 -- (-751.471) (-753.815) [-751.734] (-751.814) * [-753.315] (-752.336) (-754.625) (-752.562) -- 0:00:17
722500 -- (-751.006) [-754.329] (-751.022) (-751.651) * (-752.198) (-752.787) [-751.491] (-753.256) -- 0:00:17
723000 -- (-754.154) (-750.766) [-754.217] (-755.544) * (-750.733) (-755.044) [-751.659] (-755.733) -- 0:00:17
723500 -- (-753.237) (-754.984) (-751.483) [-751.829] * [-755.093] (-752.746) (-752.991) (-755.900) -- 0:00:17
724000 -- (-751.748) (-753.455) (-752.631) [-751.668] * (-753.982) (-751.830) [-756.661] (-751.991) -- 0:00:17
724500 -- (-753.810) (-756.424) (-753.000) [-750.332] * (-755.526) (-753.259) (-762.404) [-752.921] -- 0:00:17
725000 -- (-753.541) [-751.444] (-752.125) (-752.046) * (-755.730) [-752.210] (-751.450) (-754.431) -- 0:00:17
Average standard deviation of split frequencies: 0.008847
725500 -- (-752.427) (-757.538) [-752.470] (-757.731) * [-751.509] (-750.986) (-753.094) (-757.216) -- 0:00:17
726000 -- (-756.641) [-752.500] (-751.286) (-754.145) * [-752.563] (-751.669) (-751.693) (-752.095) -- 0:00:17
726500 -- [-751.656] (-753.859) (-751.913) (-754.575) * (-752.396) [-751.295] (-753.991) (-753.579) -- 0:00:17
727000 -- [-751.939] (-750.925) (-751.281) (-753.968) * (-754.324) [-751.582] (-751.322) (-753.604) -- 0:00:17
727500 -- (-756.547) [-750.943] (-755.033) (-755.487) * (-750.864) [-753.876] (-753.890) (-754.264) -- 0:00:17
728000 -- (-753.650) [-752.280] (-755.182) (-753.512) * [-753.575] (-753.026) (-751.645) (-752.931) -- 0:00:17
728500 -- [-752.992] (-756.940) (-754.492) (-751.745) * [-752.514] (-753.412) (-751.199) (-753.162) -- 0:00:17
729000 -- (-752.552) (-756.664) [-751.672] (-756.048) * (-754.570) (-753.473) (-753.495) [-752.677] -- 0:00:17
729500 -- (-754.336) (-752.095) [-750.671] (-754.465) * [-752.631] (-752.971) (-753.266) (-750.675) -- 0:00:17
730000 -- (-753.420) [-751.452] (-753.732) (-751.869) * (-752.221) (-752.634) (-754.899) [-752.687] -- 0:00:17
Average standard deviation of split frequencies: 0.008549
730500 -- (-751.738) [-752.417] (-752.072) (-755.157) * [-753.767] (-750.912) (-751.520) (-752.671) -- 0:00:16
731000 -- (-754.918) (-758.423) (-752.181) [-751.941] * [-753.265] (-755.312) (-755.092) (-754.765) -- 0:00:16
731500 -- (-754.024) (-759.728) (-753.472) [-751.169] * (-752.937) [-755.326] (-752.179) (-753.341) -- 0:00:16
732000 -- [-751.324] (-753.941) (-751.150) (-752.925) * (-750.773) [-754.292] (-753.626) (-754.498) -- 0:00:16
732500 -- (-751.326) (-750.647) [-752.346] (-752.395) * (-753.305) (-755.902) (-752.690) [-754.550] -- 0:00:16
733000 -- (-759.944) (-751.827) [-752.969] (-752.997) * (-751.232) (-756.540) (-754.822) [-753.028] -- 0:00:16
733500 -- (-758.844) [-752.437] (-753.072) (-752.134) * (-755.822) (-751.239) (-751.384) [-754.149] -- 0:00:17
734000 -- [-752.893] (-753.655) (-751.835) (-750.784) * (-756.590) (-752.299) [-753.182] (-753.035) -- 0:00:17
734500 -- (-753.186) (-752.328) (-750.992) [-752.069] * (-751.272) (-753.086) (-753.563) [-752.026] -- 0:00:16
735000 -- (-754.495) (-751.821) [-751.837] (-753.973) * [-752.749] (-754.941) (-753.221) (-755.112) -- 0:00:16
Average standard deviation of split frequencies: 0.008687
735500 -- [-751.026] (-752.945) (-751.154) (-753.597) * (-751.018) (-754.635) (-752.202) [-751.060] -- 0:00:16
736000 -- (-751.281) (-752.828) [-750.807] (-753.849) * [-751.066] (-750.703) (-750.463) (-754.780) -- 0:00:16
736500 -- [-751.083] (-753.530) (-752.495) (-752.694) * (-754.698) [-752.799] (-752.083) (-753.440) -- 0:00:16
737000 -- (-754.245) (-753.928) [-752.046] (-752.328) * [-755.134] (-756.754) (-751.291) (-753.146) -- 0:00:16
737500 -- [-755.814] (-751.948) (-750.986) (-754.833) * [-751.318] (-753.237) (-751.918) (-756.228) -- 0:00:16
738000 -- (-754.361) [-751.428] (-753.895) (-754.112) * [-753.989] (-751.694) (-751.928) (-755.316) -- 0:00:16
738500 -- [-751.468] (-756.468) (-750.479) (-756.047) * [-752.652] (-751.411) (-751.958) (-757.032) -- 0:00:16
739000 -- (-751.845) [-750.785] (-752.228) (-752.417) * (-751.866) [-751.996] (-751.670) (-752.381) -- 0:00:16
739500 -- (-754.321) (-753.430) [-752.432] (-752.993) * (-752.882) (-753.538) (-754.809) [-754.428] -- 0:00:16
740000 -- (-758.723) (-753.538) (-753.741) [-752.641] * [-751.420] (-756.130) (-752.577) (-751.102) -- 0:00:16
Average standard deviation of split frequencies: 0.009149
740500 -- (-753.340) (-751.044) [-751.603] (-755.833) * (-751.296) (-754.747) [-751.948] (-754.038) -- 0:00:16
741000 -- [-752.639] (-751.312) (-754.487) (-750.251) * (-754.144) (-752.921) (-752.810) [-752.210] -- 0:00:16
741500 -- (-751.147) [-751.225] (-753.563) (-751.150) * (-754.456) (-752.212) [-754.319] (-756.101) -- 0:00:16
742000 -- (-751.339) (-752.894) (-754.446) [-752.504] * (-751.705) (-751.793) [-752.943] (-755.358) -- 0:00:16
742500 -- [-752.956] (-753.294) (-752.080) (-751.852) * [-753.561] (-753.215) (-751.466) (-752.395) -- 0:00:16
743000 -- [-752.595] (-753.382) (-751.849) (-753.154) * [-751.218] (-757.555) (-753.167) (-756.119) -- 0:00:16
743500 -- [-750.401] (-750.725) (-751.126) (-752.926) * [-750.881] (-752.820) (-751.537) (-753.821) -- 0:00:16
744000 -- (-752.489) (-754.143) [-752.226] (-754.528) * (-750.894) [-757.167] (-759.016) (-755.927) -- 0:00:16
744500 -- [-752.928] (-751.351) (-750.757) (-751.045) * [-750.970] (-755.790) (-752.583) (-753.095) -- 0:00:16
745000 -- (-751.760) (-750.035) [-753.734] (-752.042) * (-756.505) [-752.956] (-753.043) (-752.371) -- 0:00:16
Average standard deviation of split frequencies: 0.008807
745500 -- [-751.353] (-751.093) (-752.439) (-750.865) * [-753.865] (-751.079) (-753.096) (-751.152) -- 0:00:16
746000 -- (-750.511) (-753.075) (-754.528) [-751.149] * [-753.420] (-751.970) (-753.120) (-754.598) -- 0:00:16
746500 -- (-753.285) [-753.072] (-752.321) (-752.834) * (-753.707) [-752.995] (-754.073) (-752.587) -- 0:00:15
747000 -- [-752.928] (-752.664) (-754.209) (-752.282) * (-751.937) (-753.328) (-751.844) [-751.982] -- 0:00:15
747500 -- [-753.460] (-750.952) (-754.810) (-753.969) * (-754.673) (-752.482) (-753.453) [-750.880] -- 0:00:15
748000 -- [-751.213] (-751.452) (-752.757) (-751.557) * (-750.877) (-754.046) (-752.509) [-750.715] -- 0:00:15
748500 -- (-752.225) [-752.837] (-752.976) (-752.524) * (-752.587) [-752.585] (-754.051) (-751.909) -- 0:00:15
749000 -- (-755.486) (-753.047) (-753.845) [-750.397] * [-751.530] (-750.791) (-752.722) (-750.728) -- 0:00:15
749500 -- (-751.770) (-755.025) (-752.192) [-752.030] * [-752.027] (-755.338) (-758.069) (-750.662) -- 0:00:16
750000 -- (-752.258) (-751.341) [-751.360] (-754.787) * (-753.585) (-753.559) (-755.678) [-750.467] -- 0:00:16
Average standard deviation of split frequencies: 0.008360
750500 -- (-752.397) (-752.771) (-751.249) [-752.703] * [-753.496] (-750.702) (-752.864) (-750.453) -- 0:00:15
751000 -- (-751.918) [-755.076] (-752.138) (-750.903) * (-755.426) [-751.257] (-757.951) (-751.915) -- 0:00:15
751500 -- (-750.497) [-754.958] (-753.301) (-754.977) * (-751.274) (-750.683) [-750.839] (-754.788) -- 0:00:15
752000 -- (-751.819) (-754.950) [-752.361] (-750.884) * (-754.474) (-755.434) [-753.090] (-750.690) -- 0:00:15
752500 -- (-750.982) (-754.820) (-751.467) [-751.366] * (-751.874) (-753.047) [-750.764] (-753.097) -- 0:00:15
753000 -- (-751.111) [-751.435] (-756.419) (-753.002) * (-752.249) [-752.432] (-754.168) (-753.430) -- 0:00:15
753500 -- [-751.102] (-751.851) (-760.680) (-753.601) * (-751.307) [-753.428] (-752.571) (-751.283) -- 0:00:15
754000 -- (-752.021) (-751.755) (-757.246) [-750.769] * (-754.101) (-752.015) (-755.227) [-751.551] -- 0:00:15
754500 -- (-754.547) [-750.912] (-754.809) (-752.115) * (-754.026) [-750.866] (-755.359) (-753.163) -- 0:00:15
755000 -- (-753.860) (-751.348) (-752.219) [-751.767] * (-755.428) [-750.712] (-752.482) (-752.952) -- 0:00:15
Average standard deviation of split frequencies: 0.009080
755500 -- (-751.712) (-752.013) [-750.357] (-751.330) * (-752.750) (-753.007) (-752.000) [-754.648] -- 0:00:15
756000 -- [-750.444] (-757.605) (-751.938) (-751.513) * (-753.514) [-752.885] (-753.332) (-751.082) -- 0:00:15
756500 -- [-751.153] (-754.240) (-753.108) (-753.374) * [-755.316] (-752.756) (-750.852) (-750.586) -- 0:00:15
757000 -- (-751.287) [-753.050] (-751.899) (-757.611) * (-754.468) (-754.184) [-751.480] (-753.440) -- 0:00:15
757500 -- [-751.559] (-753.296) (-753.432) (-754.353) * (-755.327) [-754.579] (-752.334) (-753.754) -- 0:00:15
758000 -- [-753.132] (-752.038) (-751.194) (-753.298) * (-750.993) (-751.874) (-751.331) [-752.765] -- 0:00:15
758500 -- [-757.196] (-751.756) (-752.914) (-752.259) * (-752.349) [-752.285] (-751.650) (-753.054) -- 0:00:15
759000 -- [-752.644] (-752.082) (-753.915) (-752.851) * (-752.800) (-755.281) [-751.586] (-750.081) -- 0:00:15
759500 -- [-755.247] (-752.131) (-750.789) (-751.190) * [-753.821] (-750.792) (-753.526) (-752.666) -- 0:00:15
760000 -- (-753.358) (-752.575) [-750.821] (-752.978) * (-751.815) (-752.722) (-753.648) [-755.137] -- 0:00:15
Average standard deviation of split frequencies: 0.008754
760500 -- (-751.590) [-754.100] (-753.527) (-752.966) * (-750.920) (-754.949) (-754.387) [-750.675] -- 0:00:15
761000 -- (-751.711) (-752.490) [-753.498] (-752.118) * [-752.541] (-754.530) (-753.336) (-750.234) -- 0:00:15
761500 -- (-753.764) (-750.902) [-751.590] (-752.220) * [-752.047] (-754.724) (-753.683) (-750.704) -- 0:00:15
762000 -- (-754.199) (-750.677) (-752.573) [-753.851] * (-752.770) (-755.454) [-754.938] (-751.087) -- 0:00:14
762500 -- [-750.947] (-752.159) (-753.381) (-750.899) * [-752.069] (-752.360) (-751.202) (-750.894) -- 0:00:14
763000 -- [-755.444] (-752.894) (-753.508) (-750.141) * (-752.111) (-750.507) [-750.563] (-751.223) -- 0:00:14
763500 -- [-751.782] (-752.444) (-753.145) (-751.943) * (-752.947) (-752.861) [-752.244] (-761.142) -- 0:00:14
764000 -- (-754.918) (-750.906) [-753.382] (-753.950) * [-754.090] (-752.826) (-752.335) (-755.131) -- 0:00:14
764500 -- (-750.420) [-753.260] (-755.326) (-756.404) * (-754.218) (-752.699) (-752.690) [-751.529] -- 0:00:14
765000 -- (-750.752) [-753.493] (-751.698) (-751.911) * [-752.138] (-751.115) (-754.251) (-754.247) -- 0:00:14
Average standard deviation of split frequencies: 0.008885
765500 -- (-752.669) (-751.699) (-752.280) [-753.177] * (-752.288) [-750.613] (-754.162) (-751.040) -- 0:00:15
766000 -- [-751.909] (-751.434) (-754.197) (-753.641) * (-753.292) (-751.745) (-754.384) [-752.083] -- 0:00:14
766500 -- (-752.543) (-752.532) [-756.037] (-751.114) * (-754.419) [-753.037] (-751.208) (-750.839) -- 0:00:14
767000 -- [-750.895] (-753.817) (-755.961) (-750.592) * (-756.972) (-754.413) (-752.061) [-750.735] -- 0:00:14
767500 -- [-751.839] (-753.519) (-751.980) (-750.935) * (-756.324) (-754.687) [-750.831] (-750.306) -- 0:00:14
768000 -- (-751.429) [-753.834] (-754.874) (-752.729) * (-751.017) [-751.992] (-750.865) (-750.928) -- 0:00:14
768500 -- (-751.748) (-752.763) [-753.159] (-750.838) * (-752.070) [-753.365] (-753.490) (-750.570) -- 0:00:14
769000 -- (-757.388) [-753.661] (-754.580) (-752.009) * [-751.775] (-752.985) (-753.344) (-751.228) -- 0:00:14
769500 -- (-755.035) [-753.170] (-752.838) (-753.502) * (-751.679) (-754.772) [-750.196] (-751.180) -- 0:00:14
770000 -- (-753.106) (-753.210) [-751.943] (-750.608) * [-753.502] (-752.472) (-751.285) (-756.485) -- 0:00:14
Average standard deviation of split frequencies: 0.008564
770500 -- (-752.592) (-751.559) (-756.553) [-750.881] * (-755.049) (-751.805) (-752.642) [-753.190] -- 0:00:14
771000 -- [-753.032] (-753.535) (-752.514) (-753.350) * (-755.514) (-751.333) (-753.536) [-755.647] -- 0:00:14
771500 -- (-750.771) (-754.181) [-750.206] (-754.642) * (-752.399) (-752.191) (-753.724) [-752.400] -- 0:00:14
772000 -- [-750.775] (-758.258) (-753.875) (-752.787) * (-753.943) [-751.056] (-752.293) (-751.181) -- 0:00:14
772500 -- (-752.307) (-757.647) [-751.610] (-753.863) * (-751.765) [-751.219] (-753.143) (-755.714) -- 0:00:14
773000 -- (-755.764) [-752.120] (-751.188) (-756.432) * [-757.066] (-752.405) (-756.696) (-753.325) -- 0:00:14
773500 -- [-750.358] (-752.618) (-751.882) (-751.175) * (-755.847) (-751.749) [-756.295] (-752.507) -- 0:00:14
774000 -- (-753.227) (-751.274) [-752.758] (-750.899) * (-755.297) (-750.904) [-751.381] (-754.262) -- 0:00:14
774500 -- (-752.481) (-752.096) [-753.609] (-752.837) * (-755.412) (-753.326) (-751.731) [-750.853] -- 0:00:14
775000 -- (-754.213) (-750.956) [-750.677] (-754.433) * (-758.463) [-753.553] (-754.513) (-750.248) -- 0:00:14
Average standard deviation of split frequencies: 0.008884
775500 -- [-753.233] (-751.881) (-753.161) (-752.165) * (-753.555) (-753.379) [-753.037] (-750.326) -- 0:00:14
776000 -- [-753.505] (-751.315) (-751.073) (-751.288) * (-750.422) [-752.826] (-751.320) (-752.852) -- 0:00:14
776500 -- (-753.823) [-751.235] (-750.469) (-750.710) * [-753.685] (-753.894) (-754.398) (-752.742) -- 0:00:14
777000 -- (-754.043) (-752.009) (-750.469) [-750.422] * (-753.883) (-752.437) [-752.035] (-751.173) -- 0:00:14
777500 -- (-750.617) (-751.252) [-751.618] (-751.001) * [-752.837] (-755.201) (-754.721) (-753.609) -- 0:00:14
778000 -- (-751.405) [-751.067] (-751.412) (-752.440) * (-753.332) (-753.873) [-750.918] (-754.170) -- 0:00:13
778500 -- (-751.522) (-753.174) (-750.688) [-752.749] * (-754.406) [-750.787] (-753.683) (-756.385) -- 0:00:13
779000 -- (-754.354) [-751.524] (-754.785) (-752.784) * (-752.344) (-753.159) (-751.974) [-754.360] -- 0:00:13
779500 -- (-753.225) (-751.731) [-751.836] (-752.136) * [-751.555] (-751.831) (-751.967) (-754.089) -- 0:00:13
780000 -- [-750.842] (-750.345) (-751.211) (-751.970) * [-751.815] (-756.854) (-752.669) (-754.681) -- 0:00:13
Average standard deviation of split frequencies: 0.008605
780500 -- [-751.776] (-751.675) (-751.186) (-753.286) * (-753.162) (-752.736) (-753.234) [-758.201] -- 0:00:13
781000 -- (-756.563) (-753.773) (-751.280) [-751.154] * [-751.587] (-759.250) (-751.665) (-755.148) -- 0:00:13
781500 -- (-756.895) (-753.594) (-755.250) [-750.781] * (-752.731) (-751.964) (-751.883) [-755.098] -- 0:00:13
782000 -- (-753.717) (-752.960) (-750.984) [-753.478] * (-751.407) (-753.565) [-754.479] (-754.109) -- 0:00:13
782500 -- [-755.597] (-750.747) (-751.633) (-752.552) * (-752.011) (-750.890) [-751.396] (-751.933) -- 0:00:13
783000 -- [-750.894] (-753.698) (-752.702) (-752.060) * (-751.333) [-751.843] (-754.211) (-752.891) -- 0:00:13
783500 -- [-751.679] (-752.797) (-751.719) (-750.562) * (-754.890) (-751.385) (-751.005) [-753.919] -- 0:00:13
784000 -- (-750.890) (-751.856) (-751.656) [-752.816] * (-752.574) (-752.633) (-752.253) [-750.925] -- 0:00:13
784500 -- (-750.986) [-751.704] (-752.670) (-751.943) * (-751.785) (-752.765) [-752.764] (-752.023) -- 0:00:13
785000 -- (-750.542) (-751.014) (-752.902) [-753.601] * (-752.629) [-753.607] (-754.073) (-754.458) -- 0:00:13
Average standard deviation of split frequencies: 0.008696
785500 -- (-753.623) (-751.824) (-750.878) [-752.216] * (-752.840) (-753.198) (-751.869) [-751.592] -- 0:00:13
786000 -- (-752.405) [-751.535] (-750.902) (-752.115) * (-753.789) [-753.837] (-756.189) (-750.416) -- 0:00:13
786500 -- [-751.444] (-752.702) (-750.611) (-754.341) * (-753.919) (-754.122) [-754.653] (-750.234) -- 0:00:13
787000 -- (-750.972) (-751.243) (-753.533) [-753.853] * (-757.596) (-753.223) (-757.447) [-752.406] -- 0:00:13
787500 -- (-750.819) [-750.808] (-754.878) (-754.606) * (-753.579) (-752.219) [-752.371] (-751.624) -- 0:00:13
788000 -- (-753.842) (-750.578) [-751.892] (-753.040) * (-758.228) (-752.252) (-750.619) [-753.197] -- 0:00:13
788500 -- [-752.292] (-755.892) (-757.097) (-754.726) * (-757.559) (-751.925) (-752.608) [-751.836] -- 0:00:13
789000 -- [-755.458] (-753.306) (-756.524) (-754.968) * (-755.469) (-751.550) [-751.824] (-752.528) -- 0:00:13
789500 -- (-751.286) (-756.157) (-753.502) [-750.937] * (-757.240) (-751.176) (-751.230) [-751.176] -- 0:00:13
790000 -- (-754.457) (-758.887) (-751.863) [-751.390] * [-754.066] (-754.317) (-752.033) (-751.393) -- 0:00:13
Average standard deviation of split frequencies: 0.008625
790500 -- (-753.462) [-754.837] (-751.691) (-752.861) * [-751.609] (-755.175) (-755.047) (-751.755) -- 0:00:13
791000 -- (-758.685) (-751.177) [-754.953] (-758.243) * [-752.324] (-752.643) (-754.406) (-753.497) -- 0:00:13
791500 -- (-756.803) (-753.641) [-753.933] (-756.397) * (-751.594) [-750.467] (-753.095) (-754.087) -- 0:00:13
792000 -- (-752.893) [-751.687] (-751.339) (-752.568) * (-754.331) (-754.555) (-752.694) [-751.342] -- 0:00:13
792500 -- (-751.575) [-753.348] (-750.777) (-751.925) * (-753.809) [-752.508] (-751.155) (-753.720) -- 0:00:13
793000 -- (-752.764) (-751.444) (-752.913) [-752.556] * (-755.852) [-752.873] (-753.250) (-752.839) -- 0:00:13
793500 -- (-752.273) (-751.207) [-751.211] (-751.653) * (-753.186) (-753.051) (-750.910) [-752.773] -- 0:00:13
794000 -- (-753.037) (-757.849) [-753.114] (-752.698) * (-752.424) [-751.118] (-756.003) (-755.391) -- 0:00:12
794500 -- (-751.682) [-753.134] (-752.586) (-752.862) * [-753.286] (-752.633) (-752.134) (-757.919) -- 0:00:12
795000 -- [-751.415] (-753.180) (-752.744) (-751.615) * (-752.196) (-758.946) [-751.763] (-754.869) -- 0:00:12
Average standard deviation of split frequencies: 0.008212
795500 -- (-751.462) (-754.663) (-752.288) [-752.684] * (-753.563) (-755.630) (-752.072) [-758.591] -- 0:00:12
796000 -- [-751.826] (-752.797) (-758.795) (-753.352) * (-752.236) (-754.279) (-751.069) [-753.990] -- 0:00:12
796500 -- (-751.239) (-753.902) (-751.547) [-753.358] * (-752.050) (-750.063) (-751.596) [-753.325] -- 0:00:12
797000 -- (-752.851) (-752.523) [-752.200] (-752.432) * (-754.471) (-752.702) (-752.047) [-753.599] -- 0:00:12
797500 -- (-755.003) (-751.318) (-751.727) [-751.973] * (-751.048) (-753.182) [-751.882] (-753.280) -- 0:00:12
798000 -- (-753.084) (-750.911) (-752.775) [-751.836] * (-753.547) (-754.891) [-750.472] (-753.722) -- 0:00:12
798500 -- (-751.654) (-754.204) (-750.932) [-751.602] * [-751.460] (-752.575) (-751.277) (-752.165) -- 0:00:12
799000 -- (-751.579) (-754.171) (-751.818) [-751.170] * [-753.240] (-752.974) (-752.370) (-751.943) -- 0:00:12
799500 -- [-750.755] (-753.038) (-751.276) (-752.772) * (-752.345) (-751.843) (-754.879) [-750.811] -- 0:00:12
800000 -- (-755.370) [-755.084] (-751.005) (-753.566) * (-753.358) (-752.522) [-755.206] (-752.248) -- 0:00:12
Average standard deviation of split frequencies: 0.008282
800500 -- (-753.042) (-753.144) (-752.339) [-750.880] * (-752.819) (-755.753) [-755.109] (-751.662) -- 0:00:12
801000 -- [-755.155] (-753.864) (-753.425) (-751.538) * [-755.938] (-754.148) (-754.789) (-752.094) -- 0:00:12
801500 -- (-756.734) (-754.965) (-752.892) [-752.653] * [-752.723] (-756.936) (-753.142) (-751.724) -- 0:00:12
802000 -- (-751.654) (-753.005) (-753.571) [-752.123] * [-753.643] (-755.127) (-751.636) (-752.318) -- 0:00:12
802500 -- [-755.413] (-751.832) (-751.642) (-753.779) * (-751.766) (-753.630) [-751.475] (-754.201) -- 0:00:12
803000 -- (-752.392) (-754.228) (-752.174) [-751.568] * (-750.142) [-750.636] (-750.794) (-754.655) -- 0:00:12
803500 -- (-752.821) (-753.493) [-751.659] (-755.187) * (-751.923) (-755.305) [-750.815] (-752.359) -- 0:00:12
804000 -- (-753.482) (-751.561) (-752.054) [-750.710] * (-753.607) (-751.445) (-753.854) [-751.035] -- 0:00:12
804500 -- (-756.724) (-752.638) [-751.379] (-751.983) * (-751.793) [-754.103] (-755.774) (-751.939) -- 0:00:12
805000 -- (-752.910) (-752.834) [-751.594] (-751.004) * [-752.764] (-752.864) (-756.637) (-753.261) -- 0:00:12
Average standard deviation of split frequencies: 0.008110
805500 -- (-751.117) (-753.491) [-756.410] (-752.164) * [-755.300] (-751.679) (-756.178) (-751.329) -- 0:00:12
806000 -- (-751.108) (-752.628) (-755.531) [-750.453] * (-758.248) (-754.142) (-755.328) [-750.074] -- 0:00:12
806500 -- (-751.908) (-751.030) (-753.252) [-751.513] * [-753.078] (-754.322) (-754.459) (-757.129) -- 0:00:12
807000 -- [-753.514] (-752.530) (-751.014) (-754.757) * (-754.361) [-751.979] (-755.001) (-755.882) -- 0:00:12
807500 -- (-752.199) (-751.274) [-752.416] (-756.493) * (-751.140) [-751.409] (-752.267) (-752.432) -- 0:00:12
808000 -- (-753.994) (-754.371) [-751.400] (-756.585) * (-753.796) (-751.579) (-755.792) [-750.999] -- 0:00:12
808500 -- (-754.508) (-752.044) (-751.106) [-751.067] * (-751.718) (-754.229) (-757.736) [-751.529] -- 0:00:12
809000 -- [-752.526] (-751.275) (-751.637) (-753.134) * (-750.830) (-751.980) (-753.990) [-751.195] -- 0:00:12
809500 -- [-751.511] (-750.727) (-750.857) (-750.714) * (-751.498) (-751.348) [-751.891] (-751.227) -- 0:00:12
810000 -- (-755.869) (-750.995) (-752.677) [-753.507] * (-753.486) (-752.072) (-751.579) [-750.715] -- 0:00:11
Average standard deviation of split frequencies: 0.008490
810500 -- [-760.065] (-753.184) (-751.330) (-751.357) * (-754.532) (-752.943) (-752.853) [-750.168] -- 0:00:11
811000 -- [-755.083] (-755.826) (-750.533) (-751.680) * (-751.611) [-752.928] (-751.806) (-751.907) -- 0:00:11
811500 -- [-752.243] (-755.848) (-750.343) (-753.100) * (-751.339) (-753.899) [-753.040] (-750.687) -- 0:00:11
812000 -- (-753.556) (-755.350) [-754.977] (-751.514) * (-750.801) (-751.496) (-751.570) [-752.674] -- 0:00:11
812500 -- (-750.193) (-752.609) [-755.885] (-754.299) * (-750.755) (-753.843) [-751.201] (-753.835) -- 0:00:11
813000 -- (-752.808) (-754.271) [-753.679] (-754.566) * (-751.152) [-751.897] (-750.866) (-755.054) -- 0:00:11
813500 -- [-750.976] (-752.350) (-753.185) (-753.092) * [-751.351] (-755.648) (-752.426) (-751.706) -- 0:00:11
814000 -- (-755.152) (-753.339) (-751.982) [-753.193] * (-751.454) (-752.701) (-754.316) [-752.913] -- 0:00:11
814500 -- [-752.591] (-753.465) (-752.592) (-753.421) * (-751.836) [-754.671] (-753.565) (-752.015) -- 0:00:11
815000 -- [-753.079] (-753.008) (-753.516) (-751.508) * (-753.768) (-753.771) [-751.205] (-753.613) -- 0:00:11
Average standard deviation of split frequencies: 0.008550
815500 -- (-752.040) (-756.005) [-752.330] (-751.845) * (-751.587) (-752.364) [-750.455] (-754.050) -- 0:00:11
816000 -- (-751.729) (-753.615) (-757.766) [-751.552] * (-750.915) (-757.977) [-750.084] (-753.638) -- 0:00:11
816500 -- (-752.100) (-753.151) (-751.215) [-752.015] * (-755.941) (-754.170) (-754.131) [-750.577] -- 0:00:11
817000 -- (-750.957) (-751.273) (-751.241) [-751.472] * [-751.984] (-752.156) (-752.831) (-750.471) -- 0:00:11
817500 -- [-757.649] (-751.711) (-752.420) (-755.879) * (-752.722) (-750.731) [-752.165] (-751.113) -- 0:00:11
818000 -- [-753.787] (-757.580) (-751.738) (-752.190) * (-752.402) [-751.500] (-753.374) (-753.675) -- 0:00:11
818500 -- (-751.487) [-751.500] (-752.819) (-752.056) * (-753.203) (-752.729) [-750.449] (-753.369) -- 0:00:11
819000 -- (-753.407) (-751.793) [-751.907] (-752.720) * (-750.926) (-750.639) (-751.291) [-750.808] -- 0:00:11
819500 -- (-752.477) [-752.455] (-752.433) (-751.020) * (-750.954) (-752.107) (-750.819) [-754.306] -- 0:00:11
820000 -- (-751.776) (-753.417) (-754.901) [-752.055] * (-751.327) (-752.177) (-751.197) [-758.866] -- 0:00:11
Average standard deviation of split frequencies: 0.008425
820500 -- (-754.974) [-751.602] (-751.386) (-750.817) * (-753.091) (-754.201) [-753.032] (-751.976) -- 0:00:11
821000 -- (-751.513) (-754.979) (-752.531) [-751.575] * [-751.412] (-753.659) (-752.077) (-752.316) -- 0:00:11
821500 -- (-754.849) [-752.904] (-751.750) (-755.885) * (-752.815) (-752.124) (-755.281) [-752.811] -- 0:00:11
822000 -- (-751.133) [-751.636] (-758.747) (-755.128) * (-757.349) (-754.682) [-753.094] (-750.351) -- 0:00:11
822500 -- (-750.905) (-752.748) (-757.550) [-753.718] * (-755.429) (-752.976) [-751.148] (-751.627) -- 0:00:11
823000 -- (-752.451) (-751.772) [-756.084] (-752.039) * (-756.658) [-752.817] (-750.607) (-751.126) -- 0:00:11
823500 -- (-756.195) (-751.578) [-754.278] (-751.374) * (-752.607) (-750.878) [-751.151] (-754.156) -- 0:00:11
824000 -- (-752.726) [-752.204] (-753.711) (-752.159) * [-750.712] (-750.698) (-753.074) (-751.750) -- 0:00:11
824500 -- [-753.397] (-751.623) (-751.529) (-751.049) * (-753.227) [-755.193] (-751.951) (-753.495) -- 0:00:11
825000 -- [-752.005] (-751.926) (-751.011) (-753.461) * (-753.447) (-752.436) [-751.333] (-754.080) -- 0:00:11
Average standard deviation of split frequencies: 0.008218
825500 -- (-751.017) [-752.363] (-755.967) (-753.159) * (-755.274) (-754.144) (-750.794) [-751.344] -- 0:00:10
826000 -- (-752.537) (-751.327) [-750.659] (-752.790) * (-751.562) [-754.643] (-751.707) (-753.309) -- 0:00:10
826500 -- (-751.682) (-754.132) [-750.990] (-750.731) * (-751.781) (-752.142) [-753.087] (-754.554) -- 0:00:10
827000 -- (-752.881) (-752.927) [-753.780] (-752.527) * (-754.282) [-750.667] (-752.988) (-751.913) -- 0:00:10
827500 -- (-752.231) (-753.891) (-751.221) [-750.487] * (-751.067) [-755.082] (-752.135) (-752.220) -- 0:00:10
828000 -- (-752.265) (-752.092) (-750.551) [-750.543] * (-752.150) [-753.538] (-753.045) (-752.434) -- 0:00:10
828500 -- (-751.089) (-751.775) [-750.641] (-750.633) * (-751.512) [-751.547] (-756.556) (-756.385) -- 0:00:10
829000 -- (-752.154) [-750.865] (-751.390) (-751.211) * (-753.040) (-753.424) (-750.955) [-751.801] -- 0:00:10
829500 -- [-751.672] (-751.988) (-751.897) (-753.231) * [-750.531] (-759.746) (-754.129) (-751.124) -- 0:00:10
830000 -- (-751.451) [-754.230] (-750.274) (-751.693) * (-754.383) [-751.955] (-753.835) (-751.082) -- 0:00:10
Average standard deviation of split frequencies: 0.007832
830500 -- (-750.433) [-756.116] (-750.626) (-751.485) * (-752.556) (-754.444) [-752.969] (-750.299) -- 0:00:10
831000 -- [-754.790] (-752.616) (-753.505) (-753.430) * (-752.546) (-752.981) [-755.124] (-751.673) -- 0:00:10
831500 -- [-752.357] (-757.328) (-752.712) (-751.614) * (-752.405) (-751.775) (-751.845) [-757.371] -- 0:00:10
832000 -- (-751.553) [-752.617] (-750.869) (-751.548) * (-751.327) [-752.264] (-752.220) (-753.253) -- 0:00:10
832500 -- [-750.705] (-756.558) (-751.734) (-750.444) * (-758.750) [-754.382] (-751.546) (-757.109) -- 0:00:10
833000 -- (-751.204) (-754.751) (-752.901) [-751.627] * (-754.909) (-753.263) [-751.512] (-759.087) -- 0:00:10
833500 -- (-754.456) (-752.035) (-754.079) [-750.560] * (-754.182) [-754.033] (-755.395) (-755.794) -- 0:00:10
834000 -- (-752.389) (-751.297) [-752.030] (-751.569) * (-752.452) (-752.311) (-750.843) [-752.164] -- 0:00:10
834500 -- (-757.896) (-752.250) [-751.710] (-759.037) * (-754.768) (-751.306) (-751.790) [-754.776] -- 0:00:10
835000 -- (-751.502) [-750.877] (-753.593) (-760.632) * (-756.078) (-751.306) (-751.363) [-751.650] -- 0:00:10
Average standard deviation of split frequencies: 0.008007
835500 -- (-754.453) (-751.998) [-751.399] (-754.573) * (-753.536) (-750.841) (-751.493) [-750.948] -- 0:00:10
836000 -- (-752.956) (-755.608) [-750.571] (-751.230) * (-753.966) (-752.091) (-751.545) [-752.276] -- 0:00:10
836500 -- (-754.149) [-751.866] (-751.778) (-754.375) * (-756.012) [-751.383] (-751.547) (-752.091) -- 0:00:10
837000 -- (-754.082) [-751.340] (-753.781) (-753.684) * (-755.571) [-751.396] (-751.342) (-751.855) -- 0:00:10
837500 -- (-755.624) [-755.872] (-754.203) (-750.876) * (-752.671) (-752.344) [-752.537] (-753.550) -- 0:00:10
838000 -- (-752.548) (-753.516) (-761.509) [-752.981] * [-753.531] (-756.164) (-754.434) (-750.452) -- 0:00:10
838500 -- (-752.617) [-752.856] (-759.694) (-752.269) * [-751.007] (-755.008) (-751.544) (-753.689) -- 0:00:10
839000 -- (-754.505) (-752.423) (-754.075) [-750.982] * (-753.298) (-752.412) (-756.387) [-758.267] -- 0:00:10
839500 -- (-751.793) (-752.991) [-755.708] (-754.152) * [-752.334] (-753.470) (-752.420) (-752.036) -- 0:00:10
840000 -- (-754.239) (-753.486) (-752.533) [-752.377] * (-755.529) [-756.239] (-752.263) (-752.981) -- 0:00:10
Average standard deviation of split frequencies: 0.008000
840500 -- (-752.061) (-752.961) [-753.916] (-752.680) * [-751.589] (-756.253) (-754.201) (-755.364) -- 0:00:10
841000 -- (-755.624) [-751.456] (-750.813) (-753.144) * (-750.742) (-752.750) [-752.345] (-750.810) -- 0:00:10
841500 -- (-758.472) (-753.136) (-753.321) [-752.311] * [-752.575] (-751.977) (-759.013) (-752.681) -- 0:00:09
842000 -- (-754.048) (-750.869) (-751.370) [-750.950] * [-750.385] (-752.786) (-755.602) (-751.545) -- 0:00:09
842500 -- (-757.817) [-750.845] (-750.910) (-751.098) * (-751.964) (-751.081) (-752.334) [-751.755] -- 0:00:09
843000 -- (-751.162) (-752.976) [-754.401] (-752.109) * (-753.464) (-751.565) (-756.931) [-754.722] -- 0:00:09
843500 -- (-752.434) (-750.854) [-753.944] (-753.056) * [-750.624] (-751.503) (-754.374) (-758.156) -- 0:00:09
844000 -- [-751.569] (-751.378) (-752.727) (-755.408) * (-752.883) (-752.518) [-751.170] (-752.194) -- 0:00:09
844500 -- [-752.034] (-754.822) (-753.361) (-751.535) * [-752.082] (-751.911) (-753.384) (-751.118) -- 0:00:09
845000 -- [-756.849] (-755.875) (-753.958) (-755.711) * [-755.060] (-751.083) (-753.634) (-750.681) -- 0:00:09
Average standard deviation of split frequencies: 0.008098
845500 -- (-758.927) [-755.344] (-751.599) (-752.910) * (-752.979) (-751.157) (-752.313) [-754.947] -- 0:00:09
846000 -- [-752.765] (-752.095) (-751.749) (-751.976) * (-752.536) [-751.682] (-752.169) (-752.535) -- 0:00:09
846500 -- [-755.831] (-753.509) (-754.236) (-752.314) * (-752.210) [-751.638] (-751.471) (-752.036) -- 0:00:09
847000 -- (-751.868) (-756.169) [-758.201] (-751.509) * (-750.974) [-751.778] (-753.533) (-751.266) -- 0:00:09
847500 -- (-751.553) [-752.140] (-752.851) (-752.050) * (-751.168) [-751.000] (-755.199) (-753.439) -- 0:00:09
848000 -- (-752.264) (-754.988) [-754.416] (-752.291) * (-751.352) [-751.934] (-753.870) (-756.611) -- 0:00:09
848500 -- (-753.908) (-752.304) (-751.651) [-750.742] * (-751.181) (-750.772) (-751.266) [-751.343] -- 0:00:09
849000 -- [-751.663] (-756.585) (-753.738) (-753.944) * (-752.689) [-750.939] (-750.169) (-750.783) -- 0:00:09
849500 -- (-752.218) [-753.957] (-754.102) (-751.753) * (-752.569) (-751.408) (-757.262) [-751.198] -- 0:00:09
850000 -- [-751.427] (-757.447) (-753.953) (-752.199) * (-754.454) (-751.288) (-750.572) [-752.002] -- 0:00:09
Average standard deviation of split frequencies: 0.008139
850500 -- [-752.014] (-753.478) (-752.461) (-751.828) * (-752.580) (-751.766) [-752.108] (-753.711) -- 0:00:09
851000 -- (-751.235) (-757.141) (-750.298) [-757.697] * (-753.962) (-754.669) [-750.971] (-751.759) -- 0:00:09
851500 -- (-750.486) [-752.413] (-753.275) (-759.322) * [-751.967] (-752.682) (-753.787) (-751.004) -- 0:00:09
852000 -- (-752.974) (-755.316) (-754.909) [-753.167] * (-753.604) [-753.528] (-755.877) (-750.218) -- 0:00:09
852500 -- [-754.105] (-752.776) (-755.142) (-754.938) * (-752.544) (-751.289) [-750.773] (-755.592) -- 0:00:09
853000 -- (-752.249) [-752.112] (-753.113) (-754.128) * (-755.094) (-751.363) [-751.714] (-752.951) -- 0:00:09
853500 -- [-751.804] (-753.593) (-752.765) (-757.911) * (-755.432) [-751.194] (-752.586) (-754.293) -- 0:00:09
854000 -- (-751.216) (-752.838) (-753.803) [-752.289] * (-753.282) (-751.896) [-751.401] (-751.733) -- 0:00:09
854500 -- [-752.311] (-754.000) (-756.499) (-754.460) * (-757.794) (-753.753) (-752.352) [-754.723] -- 0:00:09
855000 -- (-751.725) (-756.298) [-753.053] (-753.617) * (-753.488) [-754.913] (-752.884) (-751.822) -- 0:00:09
Average standard deviation of split frequencies: 0.007641
855500 -- (-752.867) [-751.607] (-751.903) (-751.229) * [-751.813] (-751.921) (-752.632) (-752.408) -- 0:00:09
856000 -- (-760.250) (-752.252) (-752.884) [-751.499] * (-753.090) (-756.067) (-752.008) [-751.468] -- 0:00:09
856500 -- (-752.908) (-751.441) [-751.611] (-754.609) * (-752.150) [-752.002] (-753.712) (-751.255) -- 0:00:09
857000 -- (-750.990) [-752.234] (-751.489) (-752.173) * (-751.301) (-756.262) (-755.686) [-751.707] -- 0:00:09
857500 -- (-752.208) [-752.595] (-752.352) (-751.546) * (-751.589) (-750.886) [-751.922] (-751.874) -- 0:00:08
858000 -- [-752.804] (-751.211) (-751.294) (-753.068) * (-751.341) [-750.148] (-753.289) (-755.471) -- 0:00:08
858500 -- (-752.020) [-752.402] (-752.336) (-754.014) * (-755.196) (-751.712) (-753.161) [-753.259] -- 0:00:08
859000 -- (-751.650) [-752.470] (-751.998) (-751.424) * [-752.230] (-750.820) (-751.312) (-752.887) -- 0:00:08
859500 -- (-757.388) (-751.315) (-751.956) [-751.495] * (-755.333) (-750.150) (-752.010) [-752.523] -- 0:00:08
860000 -- (-752.520) [-751.676] (-755.339) (-752.876) * (-759.141) [-750.213] (-752.101) (-751.047) -- 0:00:08
Average standard deviation of split frequencies: 0.007668
860500 -- [-754.056] (-752.603) (-752.449) (-753.559) * (-752.305) (-754.390) (-751.445) [-751.285] -- 0:00:08
861000 -- (-751.142) [-753.089] (-751.036) (-754.271) * (-751.626) (-754.385) [-750.442] (-751.112) -- 0:00:08
861500 -- (-751.901) (-753.069) [-751.291] (-754.058) * (-754.426) (-753.522) [-752.111] (-752.126) -- 0:00:08
862000 -- (-752.005) (-753.590) (-752.672) [-752.518] * (-751.208) (-757.691) (-753.631) [-754.021] -- 0:00:08
862500 -- (-751.796) (-750.512) (-752.010) [-752.062] * (-752.680) [-753.729] (-756.079) (-750.526) -- 0:00:08
863000 -- (-751.500) (-752.979) [-753.471] (-754.178) * [-755.044] (-751.626) (-751.065) (-750.507) -- 0:00:08
863500 -- (-751.196) (-755.374) [-751.372] (-757.174) * (-753.220) (-751.146) (-751.028) [-752.028] -- 0:00:08
864000 -- [-753.652] (-752.326) (-753.267) (-754.389) * [-753.298] (-750.877) (-750.558) (-755.136) -- 0:00:08
864500 -- (-755.320) [-758.754] (-757.101) (-751.353) * (-752.646) (-751.164) [-752.527] (-751.259) -- 0:00:08
865000 -- [-752.556] (-754.663) (-754.543) (-752.403) * (-753.147) (-751.025) (-753.452) [-752.697] -- 0:00:08
Average standard deviation of split frequencies: 0.008131
865500 -- (-752.424) [-753.176] (-753.623) (-753.309) * (-755.128) (-752.221) (-752.413) [-753.193] -- 0:00:08
866000 -- [-751.926] (-755.662) (-754.217) (-752.169) * (-753.030) [-752.274] (-754.649) (-752.550) -- 0:00:08
866500 -- (-755.888) (-756.242) (-755.013) [-753.142] * [-755.490] (-763.592) (-755.403) (-752.463) -- 0:00:08
867000 -- (-754.125) (-757.323) (-751.890) [-751.299] * (-753.421) (-751.579) (-752.561) [-756.698] -- 0:00:08
867500 -- [-753.346] (-751.807) (-751.349) (-751.931) * (-752.768) (-752.010) [-751.463] (-754.582) -- 0:00:08
868000 -- (-752.342) (-753.067) [-751.141] (-752.718) * (-753.151) (-752.934) [-755.737] (-753.758) -- 0:00:08
868500 -- (-753.370) [-756.509] (-752.044) (-752.725) * [-753.472] (-751.281) (-753.678) (-755.219) -- 0:00:08
869000 -- (-754.259) (-756.349) (-752.012) [-750.665] * [-752.316] (-753.745) (-753.899) (-756.252) -- 0:00:08
869500 -- (-751.046) (-755.790) (-753.624) [-751.395] * (-754.397) (-752.403) (-752.051) [-752.175] -- 0:00:08
870000 -- [-751.451] (-753.927) (-754.424) (-751.495) * (-754.092) [-751.264] (-752.078) (-756.467) -- 0:00:08
Average standard deviation of split frequencies: 0.008121
870500 -- (-750.219) [-751.140] (-753.668) (-750.710) * (-753.316) [-752.435] (-752.294) (-753.019) -- 0:00:08
871000 -- (-750.228) (-751.365) (-751.966) [-751.331] * (-752.688) [-756.366] (-752.603) (-752.948) -- 0:00:08
871500 -- [-751.222] (-751.608) (-751.568) (-758.567) * (-754.457) (-756.673) (-752.930) [-751.290] -- 0:00:08
872000 -- (-751.684) [-753.535] (-751.551) (-750.739) * [-752.949] (-756.799) (-751.335) (-751.387) -- 0:00:08
872500 -- (-751.719) (-751.823) (-751.949) [-754.173] * (-753.304) [-752.126] (-752.746) (-751.040) -- 0:00:08
873000 -- (-751.542) (-752.247) (-752.325) [-750.633] * (-756.211) (-754.727) [-751.546] (-751.899) -- 0:00:08
873500 -- (-751.664) [-751.482] (-752.405) (-751.035) * (-752.340) (-752.433) [-759.236] (-750.683) -- 0:00:07
874000 -- (-752.129) (-753.790) (-752.937) [-751.971] * [-751.412] (-755.163) (-751.588) (-756.388) -- 0:00:07
874500 -- (-752.758) (-753.478) [-752.601] (-753.772) * (-752.843) (-752.831) [-752.215] (-751.799) -- 0:00:07
875000 -- (-754.161) [-751.994] (-752.295) (-753.817) * (-754.144) (-755.237) [-750.384] (-750.313) -- 0:00:07
Average standard deviation of split frequencies: 0.008139
875500 -- (-758.022) (-753.515) [-751.585] (-752.932) * (-757.858) (-753.629) [-750.764] (-755.139) -- 0:00:07
876000 -- (-753.902) (-751.212) [-750.814] (-751.198) * (-752.151) (-751.305) (-751.670) [-752.242] -- 0:00:07
876500 -- (-755.081) (-750.696) [-750.856] (-755.182) * [-751.877] (-754.261) (-752.718) (-753.651) -- 0:00:07
877000 -- (-751.920) [-750.728] (-751.368) (-753.212) * (-753.472) [-752.209] (-751.827) (-752.320) -- 0:00:07
877500 -- (-753.490) (-751.854) (-751.617) [-751.263] * (-752.910) (-751.812) [-751.133] (-751.238) -- 0:00:07
878000 -- (-752.387) (-753.626) [-751.718] (-752.105) * [-751.416] (-752.389) (-750.836) (-756.164) -- 0:00:07
878500 -- (-755.096) (-756.062) [-751.010] (-752.788) * (-752.024) [-752.062] (-754.879) (-752.037) -- 0:00:07
879000 -- (-751.625) (-752.870) [-751.749] (-753.635) * [-751.796] (-754.010) (-755.473) (-751.504) -- 0:00:07
879500 -- (-753.934) (-753.470) (-754.215) [-754.748] * (-750.643) (-757.211) [-751.162] (-755.323) -- 0:00:07
880000 -- (-751.321) (-754.637) [-750.482] (-752.559) * (-750.642) (-751.877) (-757.404) [-755.363] -- 0:00:07
Average standard deviation of split frequencies: 0.007962
880500 -- (-752.974) (-751.463) (-752.099) [-752.384] * (-759.621) [-755.355] (-755.510) (-750.487) -- 0:00:07
881000 -- (-751.477) (-753.860) (-755.158) [-751.104] * (-755.863) (-752.340) (-754.491) [-751.146] -- 0:00:07
881500 -- (-752.131) [-753.420] (-752.348) (-750.459) * (-755.376) (-751.547) [-751.247] (-750.687) -- 0:00:07
882000 -- (-753.045) (-751.510) (-751.131) [-751.265] * (-754.350) [-751.971] (-754.037) (-752.965) -- 0:00:07
882500 -- [-754.337] (-751.991) (-752.899) (-751.674) * [-756.731] (-754.978) (-752.138) (-751.159) -- 0:00:07
883000 -- (-753.161) (-751.901) [-750.995] (-758.642) * [-754.078] (-752.218) (-753.232) (-751.038) -- 0:00:07
883500 -- (-756.889) (-751.787) (-751.701) [-752.476] * [-754.054] (-756.489) (-751.201) (-752.045) -- 0:00:07
884000 -- (-754.130) [-754.442] (-753.345) (-751.744) * (-752.395) [-755.450] (-751.107) (-755.520) -- 0:00:07
884500 -- (-752.061) [-751.720] (-754.188) (-750.368) * (-751.278) [-750.875] (-752.029) (-752.907) -- 0:00:07
885000 -- (-750.718) [-752.412] (-752.585) (-750.333) * [-752.466] (-753.208) (-754.035) (-752.134) -- 0:00:07
Average standard deviation of split frequencies: 0.007615
885500 -- (-751.232) [-752.225] (-750.941) (-750.413) * [-751.685] (-753.221) (-752.069) (-750.760) -- 0:00:07
886000 -- (-754.906) (-755.918) (-752.401) [-750.048] * (-754.198) (-751.674) [-751.363] (-752.709) -- 0:00:07
886500 -- (-751.819) [-751.691] (-751.729) (-752.614) * (-751.623) (-750.750) [-752.198] (-752.347) -- 0:00:07
887000 -- [-753.256] (-752.974) (-753.101) (-752.378) * (-750.797) (-752.589) (-752.410) [-751.897] -- 0:00:07
887500 -- (-753.156) [-754.513] (-751.548) (-751.557) * (-751.860) (-753.558) (-751.075) [-750.613] -- 0:00:07
888000 -- (-752.412) (-754.167) [-752.230] (-750.470) * (-752.758) [-756.081] (-756.961) (-751.900) -- 0:00:07
888500 -- [-751.710] (-751.224) (-751.360) (-754.385) * (-752.417) [-753.279] (-761.177) (-751.821) -- 0:00:07
889000 -- [-752.566] (-751.612) (-752.591) (-751.561) * (-750.341) [-751.793] (-753.037) (-751.608) -- 0:00:06
889500 -- [-756.301] (-751.716) (-757.077) (-752.089) * (-752.147) [-751.264] (-751.634) (-751.499) -- 0:00:06
890000 -- (-752.121) [-751.488] (-752.976) (-753.699) * (-750.229) (-750.158) [-752.108] (-752.182) -- 0:00:06
Average standard deviation of split frequencies: 0.007244
890500 -- (-751.499) [-751.468] (-752.556) (-751.947) * (-750.244) [-750.472] (-752.315) (-753.155) -- 0:00:06
891000 -- (-754.580) [-754.940] (-753.566) (-751.632) * [-752.938] (-751.294) (-754.345) (-755.321) -- 0:00:06
891500 -- (-750.721) [-756.477] (-752.374) (-758.916) * (-751.885) [-752.002] (-753.208) (-751.861) -- 0:00:06
892000 -- [-753.119] (-753.074) (-753.662) (-752.993) * [-751.028] (-752.169) (-754.974) (-752.630) -- 0:00:06
892500 -- (-752.101) [-752.807] (-750.612) (-756.383) * [-751.049] (-751.686) (-752.677) (-753.254) -- 0:00:06
893000 -- (-751.303) (-753.376) (-760.468) [-753.188] * [-752.301] (-752.823) (-756.422) (-754.706) -- 0:00:06
893500 -- (-753.007) (-751.691) [-752.267] (-750.439) * (-751.763) [-751.037] (-752.705) (-758.479) -- 0:00:06
894000 -- [-757.325] (-750.867) (-752.311) (-752.407) * (-758.975) (-750.466) (-751.629) [-756.043] -- 0:00:06
894500 -- (-753.406) [-751.480] (-752.422) (-754.117) * [-752.430] (-753.483) (-753.532) (-753.846) -- 0:00:06
895000 -- (-755.235) (-754.039) (-752.496) [-754.956] * (-752.108) (-750.829) [-750.410] (-755.714) -- 0:00:06
Average standard deviation of split frequencies: 0.007070
895500 -- (-753.924) [-753.404] (-752.048) (-752.980) * (-751.912) (-752.678) (-751.815) [-754.238] -- 0:00:06
896000 -- (-754.947) (-755.728) [-751.247] (-752.253) * [-751.093] (-750.785) (-755.267) (-753.949) -- 0:00:06
896500 -- [-752.687] (-752.730) (-751.098) (-751.562) * (-751.739) (-758.177) (-753.442) [-753.880] -- 0:00:06
897000 -- (-754.049) (-751.672) [-750.881] (-756.129) * [-750.572] (-755.225) (-754.687) (-750.720) -- 0:00:06
897500 -- (-751.026) (-752.641) (-751.173) [-751.638] * (-756.563) (-754.290) [-752.921] (-751.078) -- 0:00:06
898000 -- (-751.932) [-752.262] (-751.390) (-753.385) * (-757.020) (-755.382) [-750.608] (-755.861) -- 0:00:06
898500 -- (-751.588) (-752.558) (-752.685) [-752.937] * (-753.460) (-755.896) [-752.428] (-752.034) -- 0:00:06
899000 -- (-754.300) [-751.186] (-752.030) (-750.312) * (-753.545) [-750.483] (-750.758) (-752.716) -- 0:00:06
899500 -- (-753.629) (-753.052) (-751.432) [-751.223] * (-751.868) [-750.570] (-753.672) (-752.765) -- 0:00:06
900000 -- (-751.456) (-752.679) [-753.793] (-754.604) * [-750.930] (-753.316) (-751.039) (-752.195) -- 0:00:06
Average standard deviation of split frequencies: 0.007013
900500 -- (-751.057) (-751.738) [-751.394] (-752.027) * (-752.859) (-750.581) [-754.892] (-753.088) -- 0:00:06
901000 -- (-751.513) [-751.629] (-751.148) (-752.238) * (-750.427) (-751.972) (-755.675) [-753.232] -- 0:00:06
901500 -- (-753.705) (-751.825) (-752.403) [-752.103] * (-750.963) (-755.215) [-754.891] (-755.434) -- 0:00:06
902000 -- (-752.751) (-752.515) [-754.220] (-751.829) * [-751.694] (-754.335) (-756.956) (-752.374) -- 0:00:06
902500 -- (-750.951) [-750.708] (-753.185) (-751.922) * (-752.177) (-754.578) [-752.120] (-752.671) -- 0:00:06
903000 -- (-751.687) (-750.336) (-753.934) [-750.528] * (-753.749) [-751.954] (-755.601) (-757.082) -- 0:00:06
903500 -- [-753.469] (-752.832) (-753.294) (-750.148) * (-752.796) (-751.378) (-754.984) [-755.801] -- 0:00:06
904000 -- (-753.435) (-753.653) (-753.373) [-752.218] * (-750.550) [-752.796] (-751.213) (-752.170) -- 0:00:06
904500 -- (-751.455) [-754.027] (-754.019) (-750.555) * [-751.286] (-753.811) (-755.098) (-752.515) -- 0:00:06
905000 -- (-751.608) (-754.938) (-752.853) [-751.903] * (-750.724) (-751.220) [-752.729] (-753.357) -- 0:00:05
Average standard deviation of split frequencies: 0.007187
905500 -- (-754.706) (-753.300) [-751.689] (-751.690) * (-752.395) (-755.330) (-751.270) [-752.109] -- 0:00:05
906000 -- (-756.998) (-752.266) (-751.660) [-751.182] * (-755.786) (-753.102) [-751.371] (-751.461) -- 0:00:05
906500 -- (-753.518) [-752.599] (-753.643) (-753.315) * (-751.537) (-751.599) [-752.540] (-754.424) -- 0:00:05
907000 -- (-752.052) (-752.543) [-751.986] (-751.805) * (-753.650) [-751.492] (-750.968) (-752.143) -- 0:00:05
907500 -- (-752.422) (-751.650) (-751.846) [-752.887] * (-751.658) [-752.174] (-750.918) (-751.646) -- 0:00:05
908000 -- (-752.571) (-750.246) (-750.695) [-751.949] * (-751.514) (-751.754) [-751.640] (-750.677) -- 0:00:05
908500 -- [-751.268] (-752.199) (-751.002) (-753.918) * [-750.483] (-754.511) (-751.823) (-751.464) -- 0:00:05
909000 -- (-750.743) [-753.033] (-750.597) (-751.253) * [-755.082] (-753.586) (-751.182) (-756.371) -- 0:00:05
909500 -- (-750.638) (-752.619) (-750.931) [-750.686] * (-757.836) (-754.771) [-752.032] (-755.221) -- 0:00:05
910000 -- (-751.048) (-751.625) [-751.446] (-751.424) * (-755.016) (-755.807) [-751.579] (-751.223) -- 0:00:05
Average standard deviation of split frequencies: 0.007506
910500 -- (-752.905) (-752.645) (-752.202) [-753.351] * (-752.124) (-752.332) (-752.658) [-753.753] -- 0:00:05
911000 -- [-752.256] (-753.463) (-750.808) (-754.226) * (-754.147) (-751.960) (-753.470) [-753.428] -- 0:00:05
911500 -- (-752.842) (-752.364) [-751.671] (-751.307) * (-754.280) [-750.207] (-753.348) (-755.411) -- 0:00:05
912000 -- [-751.382] (-751.934) (-750.823) (-752.208) * (-754.760) (-752.589) [-752.994] (-755.899) -- 0:00:05
912500 -- (-756.209) (-752.920) (-750.821) [-751.182] * (-753.969) [-755.638] (-752.235) (-753.831) -- 0:00:05
913000 -- (-753.803) (-755.400) [-754.407] (-751.464) * (-751.914) (-754.203) [-751.216] (-751.615) -- 0:00:05
913500 -- (-753.659) (-753.681) (-753.262) [-751.961] * (-752.067) (-758.696) [-754.128] (-753.222) -- 0:00:05
914000 -- (-752.569) (-751.337) [-750.584] (-751.536) * (-752.547) [-751.788] (-752.804) (-751.600) -- 0:00:05
914500 -- [-752.571] (-752.788) (-750.565) (-752.751) * (-752.284) [-752.448] (-754.072) (-751.049) -- 0:00:05
915000 -- [-752.511] (-751.322) (-751.081) (-753.567) * (-753.711) (-751.957) [-756.669] (-752.512) -- 0:00:05
Average standard deviation of split frequencies: 0.007301
915500 -- (-752.337) (-752.698) (-750.563) [-761.895] * (-756.365) (-754.784) [-754.566] (-755.305) -- 0:00:05
916000 -- (-755.651) [-753.034] (-752.729) (-754.272) * (-752.505) (-751.097) [-752.684] (-755.267) -- 0:00:05
916500 -- [-751.226] (-751.162) (-751.565) (-752.203) * (-753.406) (-752.845) (-752.646) [-750.812] -- 0:00:05
917000 -- [-752.412] (-750.597) (-752.233) (-752.507) * [-752.610] (-753.019) (-752.011) (-751.013) -- 0:00:05
917500 -- [-754.809] (-752.723) (-751.252) (-751.853) * (-754.364) (-751.605) [-752.969] (-751.100) -- 0:00:05
918000 -- (-754.554) (-750.849) (-754.133) [-753.538] * [-754.311] (-750.616) (-752.424) (-754.058) -- 0:00:05
918500 -- (-750.837) (-752.683) (-752.448) [-757.066] * [-754.654] (-750.884) (-752.758) (-752.992) -- 0:00:05
919000 -- (-753.610) (-753.231) [-752.956] (-752.749) * (-753.571) (-753.097) [-754.046] (-752.033) -- 0:00:05
919500 -- (-755.149) (-755.790) [-750.452] (-751.241) * [-751.783] (-753.679) (-755.230) (-753.002) -- 0:00:05
920000 -- (-752.244) (-754.098) [-751.272] (-751.377) * [-759.009] (-751.237) (-750.883) (-753.301) -- 0:00:05
Average standard deviation of split frequencies: 0.007032
920500 -- (-757.680) (-751.898) (-750.609) [-751.991] * (-752.287) (-751.012) (-752.627) [-752.928] -- 0:00:05
921000 -- (-755.845) (-751.483) [-751.784] (-750.974) * (-751.488) (-751.475) (-751.518) [-751.363] -- 0:00:04
921500 -- (-754.272) (-750.933) (-752.906) [-752.265] * (-751.369) [-752.281] (-751.915) (-751.223) -- 0:00:04
922000 -- (-753.298) [-750.854] (-754.462) (-750.366) * (-751.237) [-754.278] (-750.529) (-750.764) -- 0:00:04
922500 -- (-755.182) (-751.534) [-752.913] (-751.084) * (-753.687) (-751.859) (-757.651) [-752.336] -- 0:00:04
923000 -- (-755.619) (-752.926) (-753.046) [-750.737] * (-751.533) (-752.255) [-754.448] (-752.907) -- 0:00:04
923500 -- [-752.481] (-752.867) (-753.005) (-752.210) * (-750.768) [-753.817] (-751.600) (-757.871) -- 0:00:04
924000 -- (-756.519) (-750.938) [-751.857] (-753.911) * [-751.509] (-751.550) (-752.868) (-751.034) -- 0:00:04
924500 -- (-756.714) (-751.338) (-752.068) [-753.968] * [-752.466] (-751.187) (-751.637) (-750.863) -- 0:00:04
925000 -- (-755.435) (-751.152) (-751.668) [-754.830] * (-750.725) (-753.293) [-756.589] (-751.211) -- 0:00:04
Average standard deviation of split frequencies: 0.007161
925500 -- (-753.585) (-751.768) (-758.848) [-752.141] * [-752.099] (-752.832) (-757.151) (-753.465) -- 0:00:04
926000 -- (-752.659) [-750.473] (-751.124) (-753.069) * [-755.075] (-751.335) (-757.274) (-753.017) -- 0:00:04
926500 -- (-751.131) (-754.047) [-753.823] (-753.494) * (-756.375) [-752.441] (-752.750) (-753.399) -- 0:00:04
927000 -- (-753.941) (-753.798) (-753.984) [-752.780] * (-752.889) (-752.677) (-753.266) [-751.322] -- 0:00:04
927500 -- [-751.143] (-750.311) (-754.704) (-752.468) * (-757.113) [-754.033] (-753.662) (-752.159) -- 0:00:04
928000 -- [-754.193] (-754.299) (-754.024) (-754.308) * (-753.922) (-750.573) [-755.590] (-750.476) -- 0:00:04
928500 -- (-753.285) [-751.747] (-751.372) (-756.332) * (-753.901) (-753.324) [-754.375] (-753.167) -- 0:00:04
929000 -- (-753.046) (-753.231) [-753.280] (-751.889) * (-755.879) [-755.427] (-754.688) (-755.325) -- 0:00:04
929500 -- (-750.933) (-753.595) (-755.854) [-750.653] * (-751.728) (-753.863) (-751.779) [-755.493] -- 0:00:04
930000 -- (-751.275) (-758.506) (-756.859) [-750.941] * (-752.227) [-752.581] (-754.690) (-754.931) -- 0:00:04
Average standard deviation of split frequencies: 0.007260
930500 -- (-750.548) (-752.784) [-752.955] (-751.676) * [-754.430] (-751.703) (-755.812) (-757.275) -- 0:00:04
931000 -- [-750.750] (-753.751) (-753.818) (-756.111) * (-753.442) [-751.115] (-750.674) (-754.082) -- 0:00:04
931500 -- (-753.187) (-754.978) (-751.003) [-753.378] * (-754.724) [-751.098] (-751.040) (-751.501) -- 0:00:04
932000 -- (-753.111) (-751.066) [-751.080] (-756.247) * (-753.531) [-751.209] (-751.432) (-755.533) -- 0:00:04
932500 -- (-753.135) (-754.992) [-750.488] (-754.273) * (-750.864) (-752.568) (-753.187) [-752.843] -- 0:00:04
933000 -- (-753.592) (-753.794) [-753.251] (-752.486) * (-755.553) [-751.039] (-751.503) (-753.330) -- 0:00:04
933500 -- (-755.028) (-754.434) (-753.470) [-750.886] * (-753.764) (-757.588) (-752.763) [-750.566] -- 0:00:04
934000 -- (-751.846) (-751.129) [-751.860] (-751.472) * (-754.789) (-752.413) (-753.480) [-751.077] -- 0:00:04
934500 -- (-751.868) (-753.662) [-751.745] (-751.337) * [-751.180] (-754.216) (-752.154) (-757.142) -- 0:00:04
935000 -- [-754.342] (-756.003) (-752.314) (-754.063) * (-751.230) (-752.539) (-750.497) [-754.249] -- 0:00:04
Average standard deviation of split frequencies: 0.007084
935500 -- (-751.694) (-754.821) (-752.839) [-752.730] * (-752.720) [-753.061] (-752.016) (-750.584) -- 0:00:04
936000 -- [-752.897] (-752.099) (-757.107) (-754.152) * (-755.981) [-752.760] (-754.836) (-753.052) -- 0:00:04
936500 -- (-752.281) (-756.102) [-752.003] (-752.308) * (-754.409) (-752.186) (-751.226) [-750.929] -- 0:00:04
937000 -- (-755.731) (-753.566) (-757.884) [-752.726] * (-756.766) [-751.438] (-751.426) (-751.977) -- 0:00:03
937500 -- [-753.198] (-754.499) (-752.637) (-753.737) * [-756.630] (-750.649) (-754.107) (-750.231) -- 0:00:03
938000 -- (-752.074) (-753.740) [-754.669] (-751.750) * (-752.268) (-753.758) [-751.850] (-751.321) -- 0:00:03
938500 -- (-752.622) [-753.151] (-751.263) (-751.520) * (-751.034) [-751.624] (-753.591) (-752.354) -- 0:00:03
939000 -- (-754.238) [-751.281] (-752.141) (-753.467) * (-752.686) (-753.225) [-755.627] (-751.846) -- 0:00:03
939500 -- (-752.185) (-751.824) (-752.784) [-753.786] * (-752.438) (-753.005) [-754.479] (-751.994) -- 0:00:03
940000 -- (-750.460) (-751.778) (-752.408) [-753.788] * (-752.251) [-752.415] (-753.997) (-754.311) -- 0:00:03
Average standard deviation of split frequencies: 0.007083
940500 -- (-750.833) (-756.457) [-750.558] (-753.973) * (-756.565) (-752.407) (-752.030) [-751.010] -- 0:00:03
941000 -- (-750.177) (-756.161) (-750.478) [-752.700] * (-755.303) (-750.831) [-751.504] (-752.754) -- 0:00:03
941500 -- [-750.454] (-754.038) (-752.503) (-754.476) * (-753.965) (-753.437) [-754.527] (-751.939) -- 0:00:03
942000 -- [-751.235] (-752.208) (-751.865) (-752.510) * (-753.381) (-751.657) (-758.884) [-752.973] -- 0:00:03
942500 -- (-752.686) (-751.513) [-752.032] (-752.206) * (-750.567) (-755.640) (-752.268) [-752.441] -- 0:00:03
943000 -- [-752.548] (-750.357) (-756.978) (-751.563) * (-750.951) [-751.952] (-752.924) (-754.549) -- 0:00:03
943500 -- (-757.617) (-750.716) [-753.472] (-752.350) * (-756.419) (-751.734) [-753.089] (-752.245) -- 0:00:03
944000 -- (-755.135) (-752.962) [-754.603] (-751.559) * (-759.308) [-751.954] (-751.923) (-754.165) -- 0:00:03
944500 -- (-755.553) (-754.907) (-753.335) [-753.811] * (-752.190) (-754.415) (-753.559) [-753.774] -- 0:00:03
945000 -- (-752.023) (-751.855) (-755.292) [-751.710] * [-754.917] (-753.750) (-755.714) (-751.068) -- 0:00:03
Average standard deviation of split frequencies: 0.007010
945500 -- (-753.422) [-751.725] (-752.837) (-754.393) * (-752.701) (-751.903) [-751.502] (-751.348) -- 0:00:03
946000 -- (-752.748) [-750.577] (-753.767) (-752.353) * (-755.393) (-753.571) (-751.461) [-753.298] -- 0:00:03
946500 -- (-752.508) (-751.102) [-754.490] (-752.318) * (-751.863) [-752.191] (-754.843) (-755.725) -- 0:00:03
947000 -- (-751.722) (-753.596) [-753.657] (-751.318) * [-750.948] (-753.331) (-752.596) (-752.750) -- 0:00:03
947500 -- (-752.841) (-753.673) (-751.378) [-751.584] * (-753.188) (-751.019) (-751.536) [-751.563] -- 0:00:03
948000 -- (-751.941) [-750.904] (-752.045) (-751.506) * (-754.253) (-751.605) [-751.192] (-751.064) -- 0:00:03
948500 -- (-751.065) [-751.808] (-752.641) (-751.128) * (-751.304) (-750.724) [-753.221] (-751.066) -- 0:00:03
949000 -- [-753.727] (-753.766) (-752.047) (-751.034) * (-752.872) (-752.576) [-751.581] (-753.571) -- 0:00:03
949500 -- (-751.022) (-753.411) [-753.528] (-753.328) * (-750.317) (-752.480) [-752.329] (-753.558) -- 0:00:03
950000 -- (-753.345) (-750.938) (-751.366) [-751.302] * (-751.005) (-753.664) (-752.769) [-755.290] -- 0:00:03
Average standard deviation of split frequencies: 0.007207
950500 -- (-752.888) (-754.476) [-754.341] (-754.319) * [-750.885] (-750.815) (-753.012) (-756.202) -- 0:00:03
951000 -- (-752.684) (-751.152) (-751.305) [-750.845] * (-758.335) [-750.869] (-752.153) (-751.537) -- 0:00:03
951500 -- [-750.792] (-751.842) (-752.424) (-751.210) * (-750.553) (-752.772) [-750.997] (-752.054) -- 0:00:03
952000 -- [-753.245] (-752.114) (-755.863) (-756.248) * (-755.408) (-752.311) [-751.493] (-753.655) -- 0:00:03
952500 -- (-752.118) (-753.878) [-753.426] (-751.065) * [-751.910] (-751.268) (-754.621) (-754.313) -- 0:00:02
953000 -- [-754.934] (-751.475) (-753.257) (-751.324) * (-755.014) [-751.545] (-752.139) (-753.929) -- 0:00:02
953500 -- (-754.076) [-752.579] (-751.531) (-753.385) * (-753.396) (-754.332) [-753.260] (-753.021) -- 0:00:02
954000 -- [-753.376] (-753.365) (-750.649) (-751.518) * (-751.821) [-757.867] (-752.620) (-754.263) -- 0:00:02
954500 -- [-751.955] (-751.221) (-753.273) (-752.303) * [-750.905] (-752.169) (-752.180) (-752.963) -- 0:00:02
955000 -- [-751.907] (-750.708) (-752.166) (-753.963) * (-751.302) [-751.407] (-750.833) (-750.402) -- 0:00:02
Average standard deviation of split frequencies: 0.006838
955500 -- (-750.316) (-751.234) [-750.432] (-752.644) * (-752.247) (-753.629) [-752.346] (-751.560) -- 0:00:02
956000 -- (-751.007) [-750.815] (-753.720) (-753.307) * (-751.179) (-753.356) (-751.258) [-756.443] -- 0:00:02
956500 -- (-750.619) (-750.766) [-751.212] (-752.667) * [-752.515] (-755.174) (-751.615) (-755.538) -- 0:00:02
957000 -- [-753.160] (-752.781) (-752.383) (-751.872) * (-751.273) (-753.870) [-751.950] (-752.113) -- 0:00:02
957500 -- (-754.034) (-752.071) (-750.557) [-751.539] * (-751.063) (-750.743) [-751.923] (-750.309) -- 0:00:02
958000 -- [-753.865] (-752.813) (-753.062) (-751.413) * (-751.079) (-751.814) (-750.777) [-753.009] -- 0:00:02
958500 -- (-752.192) (-753.653) (-755.719) [-751.241] * (-751.545) (-751.283) (-753.783) [-750.840] -- 0:00:02
959000 -- (-750.194) (-750.980) (-755.275) [-751.522] * [-751.191] (-754.077) (-752.146) (-751.821) -- 0:00:02
959500 -- (-752.316) (-751.162) [-750.454] (-752.266) * (-754.158) [-754.503] (-754.374) (-752.245) -- 0:00:02
960000 -- [-751.821] (-750.926) (-750.905) (-751.906) * (-752.783) (-755.242) [-751.670] (-752.337) -- 0:00:02
Average standard deviation of split frequencies: 0.007328
960500 -- (-751.719) (-751.433) (-750.450) [-752.544] * (-752.409) (-752.624) [-751.155] (-752.478) -- 0:00:02
961000 -- [-751.105] (-756.398) (-751.263) (-751.623) * [-750.647] (-753.368) (-754.714) (-750.552) -- 0:00:02
961500 -- (-750.980) (-756.581) [-750.987] (-751.537) * (-759.416) (-754.745) [-756.227] (-753.289) -- 0:00:02
962000 -- (-755.519) [-754.242] (-751.663) (-751.682) * (-763.181) (-753.023) (-755.881) [-751.061] -- 0:00:02
962500 -- (-751.927) (-753.112) [-757.596] (-754.093) * (-751.128) (-761.424) (-751.547) [-752.063] -- 0:00:02
963000 -- (-754.906) [-759.287] (-753.750) (-751.155) * (-753.742) [-753.598] (-752.115) (-751.555) -- 0:00:02
963500 -- (-750.627) (-754.774) (-753.285) [-751.519] * (-751.472) (-755.084) (-751.036) [-754.919] -- 0:00:02
964000 -- (-750.604) (-756.234) (-754.255) [-751.593] * [-753.424] (-754.462) (-756.998) (-753.893) -- 0:00:02
964500 -- (-752.270) (-752.336) [-751.725] (-753.896) * (-752.403) [-758.644] (-752.719) (-752.995) -- 0:00:02
965000 -- (-753.868) (-751.459) [-755.009] (-756.225) * (-751.798) (-752.395) (-752.883) [-753.468] -- 0:00:02
Average standard deviation of split frequencies: 0.007157
965500 -- (-751.158) (-756.523) [-752.532] (-754.507) * (-751.675) (-750.795) (-751.442) [-763.247] -- 0:00:02
966000 -- [-750.323] (-751.280) (-755.593) (-751.425) * [-754.954] (-750.861) (-753.075) (-758.945) -- 0:00:02
966500 -- (-751.803) (-751.310) [-750.590] (-753.219) * (-752.809) [-752.159] (-754.744) (-751.756) -- 0:00:02
967000 -- (-753.799) (-752.450) (-750.405) [-750.922] * (-752.432) (-755.452) [-754.384] (-752.183) -- 0:00:02
967500 -- (-758.053) [-752.341] (-752.780) (-751.774) * (-753.969) (-754.502) [-752.763] (-754.819) -- 0:00:02
968000 -- (-752.709) [-751.360] (-753.520) (-752.505) * (-756.115) (-753.975) [-751.489] (-752.550) -- 0:00:02
968500 -- (-751.025) (-753.226) (-751.217) [-751.752] * [-754.691] (-753.639) (-752.819) (-752.447) -- 0:00:01
969000 -- (-750.868) [-750.872] (-756.868) (-751.368) * (-752.573) (-753.820) (-754.222) [-753.294] -- 0:00:01
969500 -- (-753.736) (-751.551) [-750.817] (-754.064) * (-752.411) [-753.323] (-753.572) (-750.374) -- 0:00:01
970000 -- [-754.756] (-752.835) (-752.179) (-755.337) * (-752.730) (-752.519) (-751.439) [-751.354] -- 0:00:01
Average standard deviation of split frequencies: 0.007576
970500 -- (-750.618) [-751.606] (-754.069) (-753.018) * [-751.895] (-751.615) (-751.503) (-750.536) -- 0:00:01
971000 -- (-751.652) (-751.311) (-753.113) [-751.106] * (-756.043) [-752.083] (-753.650) (-753.895) -- 0:00:01
971500 -- (-751.339) (-751.966) [-753.343] (-752.072) * [-751.517] (-751.585) (-756.163) (-754.748) -- 0:00:01
972000 -- (-753.995) [-751.150] (-758.250) (-756.319) * (-750.624) (-751.722) (-750.500) [-752.801] -- 0:00:01
972500 -- (-752.471) [-751.139] (-764.519) (-751.844) * [-754.323] (-752.038) (-752.928) (-753.016) -- 0:00:01
973000 -- (-753.008) (-751.461) (-753.233) [-750.950] * (-754.590) (-751.538) (-757.508) [-751.612] -- 0:00:01
973500 -- [-751.725] (-752.828) (-752.579) (-752.987) * (-754.337) (-752.597) [-754.850] (-752.028) -- 0:00:01
974000 -- [-751.005] (-750.992) (-752.848) (-753.844) * (-751.132) (-757.182) (-752.279) [-751.465] -- 0:00:01
974500 -- [-752.303] (-753.955) (-754.128) (-751.607) * [-752.232] (-758.385) (-751.423) (-753.238) -- 0:00:01
975000 -- (-754.642) (-756.688) (-751.745) [-752.587] * (-750.940) (-755.509) [-751.042] (-752.510) -- 0:00:01
Average standard deviation of split frequencies: 0.008271
975500 -- (-757.025) (-755.486) [-753.125] (-751.427) * (-753.311) (-751.667) [-751.951] (-753.938) -- 0:00:01
976000 -- (-752.535) (-753.265) [-751.592] (-753.062) * (-753.198) (-751.003) [-754.185] (-752.732) -- 0:00:01
976500 -- (-752.293) (-751.199) (-752.134) [-751.496] * (-753.019) [-752.134] (-753.819) (-751.490) -- 0:00:01
977000 -- (-753.302) (-750.805) [-750.759] (-752.516) * [-751.553] (-750.914) (-752.812) (-752.794) -- 0:00:01
977500 -- (-751.640) (-750.639) [-750.845] (-752.587) * (-750.978) (-751.718) (-752.685) [-752.678] -- 0:00:01
978000 -- (-751.847) (-751.202) (-752.226) [-752.300] * (-752.013) [-752.919] (-751.861) (-752.754) -- 0:00:01
978500 -- (-751.651) [-752.246] (-751.409) (-751.380) * (-752.708) (-753.018) [-750.406] (-752.271) -- 0:00:01
979000 -- (-751.235) (-751.745) [-754.138] (-751.371) * [-752.359] (-751.229) (-750.379) (-759.785) -- 0:00:01
979500 -- (-753.559) (-750.772) [-753.535] (-752.772) * (-753.158) [-753.216] (-752.670) (-759.906) -- 0:00:01
980000 -- (-750.918) (-752.635) (-752.622) [-751.674] * (-753.501) [-752.207] (-753.032) (-750.896) -- 0:00:01
Average standard deviation of split frequencies: 0.008268
980500 -- (-752.108) (-752.380) [-753.078] (-750.958) * (-752.720) [-751.439] (-760.248) (-752.418) -- 0:00:01
981000 -- (-751.847) (-756.165) [-751.510] (-751.677) * [-752.610] (-755.958) (-754.580) (-754.144) -- 0:00:01
981500 -- (-752.756) (-752.168) [-750.533] (-751.764) * (-755.957) (-752.657) (-754.479) [-753.714] -- 0:00:01
982000 -- (-764.744) [-751.072] (-752.603) (-755.870) * (-751.852) (-754.698) (-752.075) [-751.764] -- 0:00:01
982500 -- (-755.809) (-754.675) [-753.268] (-753.197) * (-751.496) [-751.454] (-752.271) (-752.434) -- 0:00:01
983000 -- [-756.938] (-752.205) (-752.014) (-752.869) * (-751.569) (-753.438) [-750.418] (-756.032) -- 0:00:01
983500 -- (-754.227) (-752.786) [-750.504] (-752.957) * (-750.650) [-751.176] (-750.778) (-753.073) -- 0:00:01
984000 -- (-755.818) (-751.591) (-752.565) [-752.545] * (-751.573) [-750.517] (-752.479) (-753.846) -- 0:00:01
984500 -- [-752.412] (-752.180) (-755.952) (-753.788) * (-752.369) [-750.744] (-754.682) (-761.825) -- 0:00:00
985000 -- (-754.685) (-752.965) (-755.016) [-755.733] * [-755.133] (-751.795) (-756.820) (-753.913) -- 0:00:00
Average standard deviation of split frequencies: 0.008576
985500 -- (-753.971) [-753.553] (-760.217) (-755.359) * (-756.738) (-750.594) [-756.467] (-753.713) -- 0:00:00
986000 -- (-750.980) [-750.947] (-763.001) (-751.664) * (-756.374) [-750.603] (-752.913) (-753.484) -- 0:00:00
986500 -- (-751.468) (-753.600) (-753.155) [-750.943] * (-753.599) (-752.061) (-751.581) [-751.642] -- 0:00:00
987000 -- (-752.497) [-751.433] (-752.819) (-751.850) * (-755.462) (-753.371) [-751.928] (-751.510) -- 0:00:00
987500 -- (-753.574) [-752.802] (-755.191) (-752.548) * (-752.758) (-750.909) [-755.784] (-751.314) -- 0:00:00
988000 -- (-751.333) [-755.283] (-754.841) (-752.248) * (-752.384) [-751.352] (-755.570) (-750.582) -- 0:00:00
988500 -- (-753.855) (-753.899) [-751.591] (-756.193) * (-751.400) [-751.494] (-752.507) (-754.052) -- 0:00:00
989000 -- (-753.496) [-752.472] (-752.457) (-751.356) * (-751.161) (-752.365) (-752.716) [-753.031] -- 0:00:00
989500 -- (-753.820) (-753.162) [-753.666] (-754.010) * (-752.252) (-751.050) (-752.529) [-750.830] -- 0:00:00
990000 -- (-750.587) (-752.663) (-752.297) [-753.730] * (-750.769) (-751.636) (-757.862) [-752.193] -- 0:00:00
Average standard deviation of split frequencies: 0.008089
990500 -- (-750.469) (-752.507) (-752.515) [-751.070] * [-750.793] (-751.773) (-752.954) (-751.722) -- 0:00:00
991000 -- (-751.536) [-750.433] (-751.840) (-751.336) * [-750.491] (-751.284) (-756.169) (-753.247) -- 0:00:00
991500 -- (-751.449) (-756.667) (-752.778) [-753.624] * [-751.202] (-751.284) (-752.255) (-750.985) -- 0:00:00
992000 -- (-754.105) (-754.277) [-752.304] (-753.573) * (-751.716) (-760.886) [-752.046] (-751.786) -- 0:00:00
992500 -- (-757.039) (-752.972) [-752.793] (-751.618) * [-750.426] (-756.665) (-752.646) (-753.086) -- 0:00:00
993000 -- [-751.897] (-752.332) (-752.062) (-755.533) * [-750.694] (-752.606) (-753.108) (-750.666) -- 0:00:00
993500 -- (-752.988) (-756.708) [-751.621] (-754.250) * (-754.370) (-751.729) (-751.643) [-752.077] -- 0:00:00
994000 -- [-754.745] (-753.694) (-755.656) (-752.704) * [-754.782] (-753.027) (-751.968) (-751.353) -- 0:00:00
994500 -- (-751.529) (-756.060) [-751.811] (-751.271) * (-751.526) (-751.217) [-756.872] (-752.509) -- 0:00:00
995000 -- (-753.802) [-751.973] (-751.061) (-750.236) * (-751.275) (-752.568) (-756.890) [-750.604] -- 0:00:00
Average standard deviation of split frequencies: 0.008076
995500 -- (-751.350) [-750.968] (-752.516) (-752.394) * (-750.359) (-751.885) (-754.541) [-751.469] -- 0:00:00
996000 -- (-751.351) (-751.798) (-752.947) [-753.307] * (-752.179) (-754.594) (-751.856) [-753.204] -- 0:00:00
996500 -- (-750.089) [-751.377] (-751.261) (-751.542) * (-755.128) [-752.275] (-753.365) (-754.848) -- 0:00:00
997000 -- [-753.284] (-751.413) (-751.280) (-752.124) * (-750.902) (-750.874) [-752.528] (-751.821) -- 0:00:00
997500 -- (-755.339) [-751.029] (-751.170) (-752.197) * (-752.717) [-756.176] (-757.298) (-752.727) -- 0:00:00
998000 -- (-758.738) [-751.268] (-755.832) (-751.941) * [-751.993] (-751.919) (-753.286) (-750.937) -- 0:00:00
998500 -- (-750.293) (-751.301) (-756.213) [-752.129] * [-751.067] (-752.878) (-755.993) (-750.477) -- 0:00:00
999000 -- (-751.708) (-750.478) (-753.994) [-751.863] * [-751.904] (-755.929) (-751.883) (-752.018) -- 0:00:00
999500 -- (-755.296) (-754.888) [-756.469] (-753.029) * [-756.508] (-754.078) (-752.675) (-756.335) -- 0:00:00
1000000 -- [-751.836] (-753.530) (-753.982) (-752.581) * (-757.178) [-750.839] (-756.837) (-757.097) -- 0:00:00
Average standard deviation of split frequencies: 0.008009
Analysis completed in 1 mins 3 seconds
Analysis used 61.81 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -750.00
Likelihood of best state for "cold" chain of run 2 was -750.00
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.6 % ( 76 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
30.5 % ( 31 %) Dirichlet(Pi{all})
31.6 % ( 27 %) Slider(Pi{all})
79.0 % ( 50 %) Multiplier(Alpha{1,2})
78.3 % ( 52 %) Multiplier(Alpha{3})
22.5 % ( 24 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 76 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 85 %) ParsSPR(Tau{all},V{all})
28.2 % ( 23 %) Multiplier(V{all})
97.3 % ( 97 %) Nodeslider(V{all})
30.6 % ( 28 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.7 % ( 62 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
29.9 % ( 29 %) Dirichlet(Pi{all})
32.1 % ( 31 %) Slider(Pi{all})
78.6 % ( 57 %) Multiplier(Alpha{1,2})
77.9 % ( 45 %) Multiplier(Alpha{3})
22.6 % ( 30 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.0 % ( 65 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 91 %) ParsSPR(Tau{all},V{all})
28.1 % ( 21 %) Multiplier(V{all})
97.3 % ( 97 %) Nodeslider(V{all})
30.4 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166299 0.82 0.67
3 | 166473 167255 0.84
4 | 166609 166252 167112
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166136 0.82 0.67
3 | 167457 166452 0.84
4 | 166936 166224 166795
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -751.86
| 2 1 1 1 |
| 2 2 1 2 2 |
| 2 11 12 21 1 1 2 |
| 22 1 1 * 1 2 2 1 2 1 1 |
| 22 1* 2 2 1 21 1 2 12 2 12|
| 1 * 1 2 2 2*1 2 211 2 2 1|
|2 1 2*11 22 2 2 1 * 1 1 |
| 2* 11 1 2 2 2 2 |
| 2 1 2 11 12 |
|11 1 1 1 1 1 2 2 11 1 |
| 2 2 1 |
| 2 |
| 2 1 2 |
| 2 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -753.62
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -751.77 -755.71
2 -751.71 -756.61
--------------------------------------
TOTAL -751.74 -756.26
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893682 0.089433 0.376787 1.473395 0.858762 1267.81 1384.41 1.000
r(A<->C){all} 0.151438 0.018127 0.000045 0.429099 0.112447 135.97 142.43 1.002
r(A<->G){all} 0.162229 0.019459 0.000044 0.448539 0.123211 130.41 206.29 1.001
r(A<->T){all} 0.175097 0.019836 0.000066 0.452757 0.141213 199.38 226.73 1.003
r(C<->G){all} 0.165205 0.019835 0.000053 0.453140 0.128112 192.97 247.91 1.000
r(C<->T){all} 0.181197 0.020863 0.000122 0.462222 0.146395 194.88 274.53 1.001
r(G<->T){all} 0.164834 0.020610 0.000008 0.461242 0.123024 147.70 173.63 1.001
pi(A){all} 0.228998 0.000315 0.197952 0.267147 0.228012 1165.68 1257.49 1.000
pi(C){all} 0.281769 0.000362 0.244716 0.318980 0.281851 1208.35 1249.71 1.000
pi(G){all} 0.292588 0.000395 0.250960 0.329721 0.292383 1147.00 1150.49 1.000
pi(T){all} 0.196644 0.000295 0.160887 0.227664 0.196798 1200.02 1299.87 1.000
alpha{1,2} 0.416182 0.228647 0.000188 1.416131 0.238986 1157.33 1246.00 1.000
alpha{3} 0.474805 0.244493 0.000184 1.460005 0.307071 1282.11 1391.56 1.001
pinvar{all} 0.997088 0.000012 0.990845 1.000000 0.998202 1084.35 1112.46 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**...
8 -- ..*..*
9 -- .*...*
10 -- ...**.
11 -- .**.**
12 -- .*..*.
13 -- .***.*
14 -- .*.***
15 -- ....**
16 -- .****.
17 -- ..****
18 -- ..**..
19 -- ...*.*
20 -- .*.*..
21 -- ..*.*.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 455 0.151566 0.012719 0.142572 0.160560 2
8 449 0.149567 0.010835 0.141905 0.157229 2
9 447 0.148901 0.008009 0.143238 0.154564 2
10 442 0.147235 0.010364 0.139907 0.154564 2
11 434 0.144570 0.003769 0.141905 0.147235 2
12 433 0.144237 0.011777 0.135909 0.152565 2
13 429 0.142905 0.004240 0.139907 0.145903 2
14 424 0.141239 0.004711 0.137908 0.144570 2
15 424 0.141239 0.001884 0.139907 0.142572 2
16 423 0.140906 0.008951 0.134577 0.147235 2
17 417 0.138907 0.013662 0.129247 0.148568 2
18 416 0.138574 0.002827 0.136576 0.140573 2
19 416 0.138574 0.005653 0.134577 0.142572 2
20 413 0.137575 0.007066 0.132578 0.142572 2
21 411 0.136909 0.013662 0.127249 0.146569 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100920 0.010065 0.000037 0.300989 0.068277 1.000 2
length{all}[2] 0.099939 0.010073 0.000098 0.293399 0.068244 1.000 2
length{all}[3] 0.102084 0.010700 0.000035 0.309499 0.070378 1.000 2
length{all}[4] 0.097569 0.010260 0.000020 0.306768 0.067511 1.000 2
length{all}[5] 0.099188 0.009772 0.000038 0.300737 0.069128 1.000 2
length{all}[6] 0.101301 0.010006 0.000002 0.305954 0.070207 1.000 2
length{all}[7] 0.100686 0.010601 0.000049 0.289774 0.070111 0.998 2
length{all}[8] 0.098040 0.009197 0.000198 0.265793 0.072023 0.998 2
length{all}[9] 0.101481 0.010979 0.000262 0.307354 0.068770 1.001 2
length{all}[10] 0.092331 0.008554 0.000154 0.274108 0.063660 0.998 2
length{all}[11] 0.094276 0.008522 0.000115 0.297107 0.064732 0.998 2
length{all}[12] 0.099943 0.009242 0.000091 0.291012 0.071420 0.998 2
length{all}[13] 0.099914 0.013325 0.000026 0.285366 0.067809 0.998 2
length{all}[14] 0.095821 0.008702 0.000590 0.304564 0.065788 1.000 2
length{all}[15] 0.099851 0.011139 0.000055 0.314328 0.067846 0.998 2
length{all}[16] 0.096248 0.007567 0.000521 0.277169 0.068175 1.008 2
length{all}[17] 0.099539 0.008875 0.000814 0.277230 0.071450 1.005 2
length{all}[18] 0.093527 0.008817 0.000028 0.279758 0.066294 1.004 2
length{all}[19] 0.095586 0.008010 0.000076 0.288757 0.070742 0.999 2
length{all}[20] 0.096956 0.010482 0.000091 0.311042 0.062197 0.998 2
length{all}[21] 0.096003 0.008515 0.001015 0.306922 0.065495 1.005 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008009
Maximum standard deviation of split frequencies = 0.013662
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|--------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 44 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 546
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 52 patterns at 182 / 182 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 52 patterns at 182 / 182 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
50752 bytes for conP
4576 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.027210 0.100143 0.024905 0.016274 0.075348 0.056555 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -778.043368
Iterating by ming2
Initial: fx= 778.043368
x= 0.02721 0.10014 0.02491 0.01627 0.07535 0.05655 0.30000 1.30000
1 h-m-p 0.0000 0.0001 437.3292 ++ 760.688989 m 0.0001 13 | 1/8
2 h-m-p 0.0010 0.0104 37.5827 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 399.8584 ++ 752.986659 m 0.0000 44 | 2/8
4 h-m-p 0.0006 0.0141 29.4745 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 357.6799 ++ 751.341199 m 0.0000 75 | 3/8
6 h-m-p 0.0002 0.0166 24.6223 ----------.. | 3/8
7 h-m-p 0.0000 0.0002 309.2228 +++ 735.569273 m 0.0002 106 | 4/8
8 h-m-p 0.0023 0.0237 18.0854 ------------.. | 4/8
9 h-m-p 0.0000 0.0001 253.2832 ++ 728.776560 m 0.0001 138 | 5/8
10 h-m-p 0.0018 0.0526 10.4460 ------------.. | 5/8
11 h-m-p 0.0000 0.0001 179.2899 ++ 724.264680 m 0.0001 170 | 6/8
12 h-m-p 0.7965 8.0000 0.0000 ++ 724.264680 m 8.0000 181 | 6/8
13 h-m-p 0.3227 8.0000 0.0001 -----C 724.264680 0 0.0001 199
Out..
lnL = -724.264680
200 lfun, 200 eigenQcodon, 1200 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.097586 0.102586 0.037802 0.100039 0.094910 0.067549 0.299975 0.838348 0.307400
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 14.421319
np = 9
lnL0 = -811.105550
Iterating by ming2
Initial: fx= 811.105550
x= 0.09759 0.10259 0.03780 0.10004 0.09491 0.06755 0.29998 0.83835 0.30740
1 h-m-p 0.0000 0.0002 409.9267 +++ 772.919701 m 0.0002 15 | 1/9
2 h-m-p 0.0000 0.0001 631.8408 ++ 746.724157 m 0.0001 27 | 2/9
3 h-m-p 0.0000 0.0001 1833.2666 ++ 726.978309 m 0.0001 39 | 3/9
4 h-m-p 0.0001 0.0005 65.1986 ++ 725.518032 m 0.0005 51 | 4/9
5 h-m-p 0.0002 0.0013 140.6663 ++ 725.002819 m 0.0013 63 | 4/9
6 h-m-p 0.0000 0.0002 225.4520 ---------.. | 4/9
7 h-m-p 0.0000 0.0000 255.5325 ++ 724.569621 m 0.0000 94 | 5/9
8 h-m-p 0.0004 0.2102 3.2857 -----------.. | 5/9
9 h-m-p 0.0000 0.0000 181.0033 ++ 724.264710 m 0.0000 127 | 6/9
10 h-m-p 0.0160 8.0000 0.0000 +++++ 724.264710 m 8.0000 142 | 6/9
11 h-m-p 0.0134 0.0670 0.0010 ------------N 724.264710 0 0.0000 169
Out..
lnL = -724.264710
170 lfun, 510 eigenQcodon, 2040 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.087718 0.108603 0.019031 0.087750 0.024513 0.079010 0.264257 1.606880 0.294885 0.115403 1.473031
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 13.792862
np = 11
lnL0 = -789.616018
Iterating by ming2
Initial: fx= 789.616018
x= 0.08772 0.10860 0.01903 0.08775 0.02451 0.07901 0.26426 1.60688 0.29489 0.11540 1.47303
1 h-m-p 0.0000 0.0001 354.0979 ++ 772.850461 m 0.0001 16 | 1/11
2 h-m-p 0.0000 0.0001 300.5334 ++ 768.348323 m 0.0001 30 | 2/11
3 h-m-p 0.0001 0.0006 221.7831 ++ 734.184972 m 0.0006 44 | 3/11
4 h-m-p 0.0001 0.0004 51.4055 ++ 732.488291 m 0.0004 58 | 4/11
5 h-m-p 0.0008 0.0045 11.7196 -----------.. | 4/11
6 h-m-p 0.0000 0.0000 299.5361 ++ 728.762638 m 0.0000 95 | 5/11
7 h-m-p 0.0021 0.0974 4.7160 ------------.. | 5/11
8 h-m-p 0.0000 0.0000 249.4471 ++ 728.749095 m 0.0000 133 | 6/11
9 h-m-p 0.0003 0.1275 3.3515 ----------.. | 6/11
10 h-m-p 0.0000 0.0001 175.5668 ++ 724.264708 m 0.0001 169 | 7/11
11 h-m-p 0.3336 8.0000 0.0000 +++ 724.264708 m 8.0000 184 | 7/11
12 h-m-p 0.0160 8.0000 0.0355 +++++ 724.264701 m 8.0000 205 | 7/11
13 h-m-p 0.1767 1.6969 1.6066 ++ 724.264681 m 1.6969 223 | 8/11
14 h-m-p 1.6000 8.0000 0.1010 ++ 724.264681 m 8.0000 237 | 8/11
15 h-m-p 1.6000 8.0000 0.0463 C 724.264681 0 1.4212 254 | 8/11
16 h-m-p 1.6000 8.0000 0.0036 C 724.264681 0 1.3036 271 | 8/11
17 h-m-p 1.6000 8.0000 0.0003 ++ 724.264681 m 8.0000 288 | 8/11
18 h-m-p 0.1130 8.0000 0.0220 ++Y 724.264681 0 3.3451 307 | 8/11
19 h-m-p 1.6000 8.0000 0.0010 ++ 724.264681 m 8.0000 324 | 8/11
20 h-m-p 0.0077 3.8529 2.0217 --------Y 724.264681 0 0.0000 349 | 8/11
21 h-m-p 0.0160 8.0000 1.6031 +++++ 724.264665 m 8.0000 366 | 8/11
22 h-m-p 1.6000 8.0000 2.3898 ++ 724.264663 m 8.0000 380 | 8/11
23 h-m-p 1.6000 8.0000 2.2278 ++ 724.264662 m 8.0000 394 | 8/11
24 h-m-p 0.1038 0.5188 135.6990 ++ 724.264662 m 0.5188 408 | 8/11
25 h-m-p -0.0000 -0.0000 5.6595
h-m-p: -0.00000000e+00 -0.00000000e+00 5.65945168e+00 724.264662
.. | 8/11
26 h-m-p 0.0160 8.0000 0.0000 C 724.264662 0 0.0040 433 | 7/11
27 h-m-p -0.0000 -0.0000 0.0006
h-m-p: -2.02122787e-12 -1.01061394e-11 6.19426656e-04 724.264662
.. | 7/11
28 h-m-p 0.0160 8.0000 0.0000 C 724.264662 0 0.0160 465
Out..
lnL = -724.264662
466 lfun, 1864 eigenQcodon, 8388 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -724.260555 S = -724.260380 -0.000067
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 52 patterns 0:03
did 20 / 52 patterns 0:03
did 30 / 52 patterns 0:03
did 40 / 52 patterns 0:03
did 50 / 52 patterns 0:03
did 52 / 52 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.051505 0.089467 0.030464 0.071810 0.084942 0.108216 0.000100 0.223012 1.400174
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 29.957461
np = 9
lnL0 = -797.426380
Iterating by ming2
Initial: fx= 797.426380
x= 0.05150 0.08947 0.03046 0.07181 0.08494 0.10822 0.00011 0.22301 1.40017
1 h-m-p 0.0000 0.0000 381.5895 ++ 797.278942 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0083 59.1613 +++++ 774.816391 m 0.0083 29 | 2/9
3 h-m-p 0.0001 0.0003 692.4478 ++ 753.109649 m 0.0003 41 | 3/9
4 h-m-p 0.0008 0.0038 45.7988 ++ 749.543966 m 0.0038 53 | 4/9
5 h-m-p 0.0001 0.0004 274.5266 ++ 741.073919 m 0.0004 65 | 5/9
6 h-m-p 0.0000 0.0000 5083.0327 ++ 738.845209 m 0.0000 77 | 6/9
7 h-m-p 0.0022 0.0108 33.1803 ------------.. | 6/9
8 h-m-p 0.0000 0.0005 170.7446 +++ 724.264719 m 0.0005 112 | 7/9
9 h-m-p 1.6000 8.0000 0.0000 ++ 724.264719 m 8.0000 124 | 7/9
10 h-m-p 0.0145 7.2262 0.2653 -----------N 724.264719 0 0.0000 149 | 7/9
11 h-m-p 0.0160 8.0000 0.0000 +++++ 724.264719 m 8.0000 166 | 7/9
12 h-m-p 0.0001 0.0458 25.2652 +++++ 724.264683 m 0.0458 183 | 8/9
13 h-m-p 1.6000 8.0000 0.0000 C 724.264683 0 1.6000 195 | 8/9
14 h-m-p 0.0160 8.0000 0.0000 Y 724.264683 0 0.0160 208
Out..
lnL = -724.264683
209 lfun, 2299 eigenQcodon, 12540 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.072734 0.069948 0.090669 0.014020 0.058963 0.102620 0.000100 0.900000 0.806736 1.626796 1.300054
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 16.677191
np = 11
lnL0 = -792.639704
Iterating by ming2
Initial: fx= 792.639704
x= 0.07273 0.06995 0.09067 0.01402 0.05896 0.10262 0.00011 0.90000 0.80674 1.62680 1.30005
1 h-m-p 0.0000 0.0000 381.2677 ++ 792.366640 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0005 192.2207 +++ 778.530435 m 0.0005 31 | 2/11
3 h-m-p 0.0002 0.0010 143.3001 ++ 741.167684 m 0.0010 45 | 3/11
4 h-m-p 0.0005 0.0024 76.6134 ++ 733.025402 m 0.0024 59 | 4/11
5 h-m-p 0.0000 0.0000 2272.2343 ++ 731.425785 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0000 381318.5608 ++ 725.668323 m 0.0000 87 | 6/11
7 h-m-p 0.0000 0.0000 19820.8673 ++ 724.264697 m 0.0000 101 | 7/11
8 h-m-p 1.6000 8.0000 0.0000 ++ 724.264697 m 8.0000 115 | 7/11
9 h-m-p 0.0076 1.4329 0.0518 ------Y 724.264697 0 0.0000 139 | 7/11
10 h-m-p 0.0160 8.0000 0.0004 +++++ 724.264697 m 8.0000 160 | 7/11
11 h-m-p 0.0146 7.3095 0.3768 +++++ 724.264668 m 7.3095 181 | 8/11
12 h-m-p 1.6000 8.0000 0.1524 ++ 724.264667 m 8.0000 199 | 8/11
13 h-m-p 0.4538 8.0000 2.6866 +++ 724.264663 m 8.0000 217 | 8/11
14 h-m-p 1.6000 8.0000 1.5258 ++ 724.264662 m 8.0000 231 | 8/11
15 h-m-p 0.4110 3.5036 29.6985 ++ 724.264661 m 3.5036 245 | 8/11
16 h-m-p 1.6000 8.0000 9.0882 -------Y 724.264661 0 0.0000 266 | 8/11
17 h-m-p 1.0000 8.0000 0.0001 C 724.264661 0 1.0000 280 | 8/11
18 h-m-p 0.8078 4.0390 0.0000 ---Y 724.264661 0 0.0032 300
Out..
lnL = -724.264661
301 lfun, 3612 eigenQcodon, 19866 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -724.260507 S = -724.260371 -0.000060
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 52 patterns 0:12
did 20 / 52 patterns 0:12
did 30 / 52 patterns 0:12
did 40 / 52 patterns 0:12
did 50 / 52 patterns 0:12
did 52 / 52 patterns 0:12
Time used: 0:12
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=182
NC_011896_1_WP_010908981_1_2777_MLBR_RS13215 LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
NC_002677_1_NP_302662_1_1534_ML2595 LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
NZ_LVXE01000045_1_WP_010908981_1_1926_A3216_RS10865 LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
NZ_LYPH01000051_1_WP_010908981_1_1949_A8144_RS09315 LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
NZ_CP029543_1_WP_010908981_1_2806_DIJ64_RS14285 LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
NZ_AP014567_1_WP_010908981_1_2874_JK2ML_RS14625 LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH
**************************************************
NC_011896_1_WP_010908981_1_2777_MLBR_RS13215 QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
NC_002677_1_NP_302662_1_1534_ML2595 QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
NZ_LVXE01000045_1_WP_010908981_1_1926_A3216_RS10865 QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
NZ_LYPH01000051_1_WP_010908981_1_1949_A8144_RS09315 QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
NZ_CP029543_1_WP_010908981_1_2806_DIJ64_RS14285 QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
NZ_AP014567_1_WP_010908981_1_2874_JK2ML_RS14625 QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ
**************************************************
NC_011896_1_WP_010908981_1_2777_MLBR_RS13215 ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
NC_002677_1_NP_302662_1_1534_ML2595 ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
NZ_LVXE01000045_1_WP_010908981_1_1926_A3216_RS10865 ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
NZ_LYPH01000051_1_WP_010908981_1_1949_A8144_RS09315 ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
NZ_CP029543_1_WP_010908981_1_2806_DIJ64_RS14285 ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
NZ_AP014567_1_WP_010908981_1_2874_JK2ML_RS14625 ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND
**************************************************
NC_011896_1_WP_010908981_1_2777_MLBR_RS13215 RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
NC_002677_1_NP_302662_1_1534_ML2595 RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
NZ_LVXE01000045_1_WP_010908981_1_1926_A3216_RS10865 RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
NZ_LYPH01000051_1_WP_010908981_1_1949_A8144_RS09315 RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
NZ_CP029543_1_WP_010908981_1_2806_DIJ64_RS14285 RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
NZ_AP014567_1_WP_010908981_1_2874_JK2ML_RS14625 RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
********************************
>NC_011896_1_WP_010908981_1_2777_MLBR_RS13215 TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG >NC_002677_1_NP_302662_1_1534_ML2595 TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG >NZ_LVXE01000045_1_WP_010908981_1_1926_A3216_RS10865 TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG >NZ_LYPH01000051_1_WP_010908981_1_1949_A8144_RS09315 TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG >NZ_CP029543_1_WP_010908981_1_2806_DIJ64_RS14285 TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG >NZ_AP014567_1_WP_010908981_1_2874_JK2ML_RS14625 TTGCCAGAATCGCAAGTGGCAGCCGACGATTCCGGTGTCACGCTCAACCG GTCGCGTCTGGGTCGCGGGTGGCTTACTGGTATCGCTGTAGCGCTTCTCC TGGCCGGCTGCGGCATAGGGACCGGCGGCTACTGCATGCTACGTTACCAC CAGGACAGCCAAGCGATGGCACGCAACGACAACGCTGCGCTGAAAACGGC GCTGGATTGTGTTGCGGCAACGCAGGCTCCGGACACCAATACGATGGCGG CGAGTGAACAGAAAATCATCGACTGCGGTACTGATGCTTTCCACGCCCAA GCTTTGCTGTACACAAACATGCTCGTTCAAGCGTATCAGGCTGCGAACGT ACACGTTCAGGTGTCCGATATGAGAGCAGCGGTTGAGCGCCACAACAACG ACGGTTCCATCGATGTGCTCGTGGCACTTCGCGTCAAGTTGTCTAACGAT CGTGCGCACAACCAAGAAACCGGTTATCGCCTGCGGGTGAAAATGGCTCT CGCTGAGGGCCAGTACAAGATTTCCAAGCTAGACCAGGTGACCAAG
>NC_011896_1_WP_010908981_1_2777_MLBR_RS13215 LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND RAHNQETGYRLRVKMALAEGQYKISKLDQVTK >NC_002677_1_NP_302662_1_1534_ML2595 LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND RAHNQETGYRLRVKMALAEGQYKISKLDQVTK >NZ_LVXE01000045_1_WP_010908981_1_1926_A3216_RS10865 LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND RAHNQETGYRLRVKMALAEGQYKISKLDQVTK >NZ_LYPH01000051_1_WP_010908981_1_1949_A8144_RS09315 LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND RAHNQETGYRLRVKMALAEGQYKISKLDQVTK >NZ_CP029543_1_WP_010908981_1_2806_DIJ64_RS14285 LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND RAHNQETGYRLRVKMALAEGQYKISKLDQVTK >NZ_AP014567_1_WP_010908981_1_2874_JK2ML_RS14625 LPESQVAADDSGVTLNRSRLGRGWLTGIAVALLLAGCGIGTGGYCMLRYH QDSQAMARNDNAALKTALDCVAATQAPDTNTMAASEQKIIDCGTDAFHAQ ALLYTNMLVQAYQAANVHVQVSDMRAAVERHNNDGSIDVLVALRVKLSND RAHNQETGYRLRVKMALAEGQYKISKLDQVTK
#NEXUS
[ID: 5979006405]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908981_1_2777_MLBR_RS13215
NC_002677_1_NP_302662_1_1534_ML2595
NZ_LVXE01000045_1_WP_010908981_1_1926_A3216_RS10865
NZ_LYPH01000051_1_WP_010908981_1_1949_A8144_RS09315
NZ_CP029543_1_WP_010908981_1_2806_DIJ64_RS14285
NZ_AP014567_1_WP_010908981_1_2874_JK2ML_RS14625
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908981_1_2777_MLBR_RS13215,
2 NC_002677_1_NP_302662_1_1534_ML2595,
3 NZ_LVXE01000045_1_WP_010908981_1_1926_A3216_RS10865,
4 NZ_LYPH01000051_1_WP_010908981_1_1949_A8144_RS09315,
5 NZ_CP029543_1_WP_010908981_1_2806_DIJ64_RS14285,
6 NZ_AP014567_1_WP_010908981_1_2874_JK2ML_RS14625
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06827724,2:0.06824417,3:0.07037832,4:0.06751144,5:0.06912764,6:0.0702069);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06827724,2:0.06824417,3:0.07037832,4:0.06751144,5:0.06912764,6:0.0702069);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -751.77 -755.71
2 -751.71 -756.61
--------------------------------------
TOTAL -751.74 -756.26
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2595/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893682 0.089433 0.376787 1.473395 0.858762 1267.81 1384.41 1.000
r(A<->C){all} 0.151438 0.018127 0.000045 0.429099 0.112447 135.97 142.43 1.002
r(A<->G){all} 0.162229 0.019459 0.000044 0.448539 0.123211 130.41 206.29 1.001
r(A<->T){all} 0.175097 0.019836 0.000066 0.452757 0.141213 199.38 226.73 1.003
r(C<->G){all} 0.165205 0.019835 0.000053 0.453140 0.128112 192.97 247.91 1.000
r(C<->T){all} 0.181197 0.020863 0.000122 0.462222 0.146395 194.88 274.53 1.001
r(G<->T){all} 0.164834 0.020610 0.000008 0.461242 0.123024 147.70 173.63 1.001
pi(A){all} 0.228998 0.000315 0.197952 0.267147 0.228012 1165.68 1257.49 1.000
pi(C){all} 0.281769 0.000362 0.244716 0.318980 0.281851 1208.35 1249.71 1.000
pi(G){all} 0.292588 0.000395 0.250960 0.329721 0.292383 1147.00 1150.49 1.000
pi(T){all} 0.196644 0.000295 0.160887 0.227664 0.196798 1200.02 1299.87 1.000
alpha{1,2} 0.416182 0.228647 0.000188 1.416131 0.238986 1157.33 1246.00 1.000
alpha{3} 0.474805 0.244493 0.000184 1.460005 0.307071 1282.11 1391.56 1.001
pinvar{all} 0.997088 0.000012 0.990845 1.000000 0.998202 1084.35 1112.46 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2595/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 182
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 1 1 1 1 1 1
TTC 1 1 1 1 1 1 | TCC 4 4 4 4 4 4 | TAC 4 4 4 4 4 4 | TGC 3 3 3 3 3 3
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 3 3 3 3 3 3
CTC 5 5 5 5 5 5 | CCC 0 0 0 0 0 0 | CAC 5 5 5 5 5 5 | CGC 5 5 5 5 5 5
CTA 2 2 2 2 2 2 | CCA 1 1 1 1 1 1 | Gln CAA 5 5 5 5 5 5 | CGA 0 0 0 0 0 0
CTG 6 6 6 6 6 6 | CCG 1 1 1 1 1 1 | CAG 7 7 7 7 7 7 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 2 2 2 2 2 2 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 4 4 4 4 4 4 | ACC 4 4 4 4 4 4 | AAC 9 9 9 9 9 9 | AGC 1 1 1 1 1 1
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 3 3 3 3 3 3 | Arg AGA 1 1 1 1 1 1
Met ATG 6 6 6 6 6 6 | ACG 4 4 4 4 4 4 | AAG 4 4 4 4 4 4 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 4 4 4 4 4 4 | Ala GCT 8 8 8 8 8 8 | Asp GAT 6 6 6 6 6 6 | Gly GGT 6 6 6 6 6 6
GTC 2 2 2 2 2 2 | GCC 3 3 3 3 3 3 | GAC 7 7 7 7 7 7 | GGC 5 5 5 5 5 5
GTA 2 2 2 2 2 2 | GCA 5 5 5 5 5 5 | Glu GAA 3 3 3 3 3 3 | GGA 0 0 0 0 0 0
GTG 6 6 6 6 6 6 | GCG 11 11 11 11 11 11 | GAG 2 2 2 2 2 2 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908981_1_2777_MLBR_RS13215
position 1: T:0.12088 C:0.24725 A:0.23626 G:0.39560
position 2: T:0.25275 C:0.25824 A:0.31868 G:0.17033
position 3: T:0.21429 C:0.34066 A:0.13187 G:0.31319
Average T:0.19597 C:0.28205 A:0.22894 G:0.29304
#2: NC_002677_1_NP_302662_1_1534_ML2595
position 1: T:0.12088 C:0.24725 A:0.23626 G:0.39560
position 2: T:0.25275 C:0.25824 A:0.31868 G:0.17033
position 3: T:0.21429 C:0.34066 A:0.13187 G:0.31319
Average T:0.19597 C:0.28205 A:0.22894 G:0.29304
#3: NZ_LVXE01000045_1_WP_010908981_1_1926_A3216_RS10865
position 1: T:0.12088 C:0.24725 A:0.23626 G:0.39560
position 2: T:0.25275 C:0.25824 A:0.31868 G:0.17033
position 3: T:0.21429 C:0.34066 A:0.13187 G:0.31319
Average T:0.19597 C:0.28205 A:0.22894 G:0.29304
#4: NZ_LYPH01000051_1_WP_010908981_1_1949_A8144_RS09315
position 1: T:0.12088 C:0.24725 A:0.23626 G:0.39560
position 2: T:0.25275 C:0.25824 A:0.31868 G:0.17033
position 3: T:0.21429 C:0.34066 A:0.13187 G:0.31319
Average T:0.19597 C:0.28205 A:0.22894 G:0.29304
#5: NZ_CP029543_1_WP_010908981_1_2806_DIJ64_RS14285
position 1: T:0.12088 C:0.24725 A:0.23626 G:0.39560
position 2: T:0.25275 C:0.25824 A:0.31868 G:0.17033
position 3: T:0.21429 C:0.34066 A:0.13187 G:0.31319
Average T:0.19597 C:0.28205 A:0.22894 G:0.29304
#6: NZ_AP014567_1_WP_010908981_1_2874_JK2ML_RS14625
position 1: T:0.12088 C:0.24725 A:0.23626 G:0.39560
position 2: T:0.25275 C:0.25824 A:0.31868 G:0.17033
position 3: T:0.21429 C:0.34066 A:0.13187 G:0.31319
Average T:0.19597 C:0.28205 A:0.22894 G:0.29304
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 6 | Tyr Y TAT 12 | Cys C TGT 6
TTC 6 | TCC 24 | TAC 24 | TGC 18
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 12 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 0 | His H CAT 0 | Arg R CGT 18
CTC 30 | CCC 0 | CAC 30 | CGC 30
CTA 12 | CCA 6 | Gln Q CAA 30 | CGA 0
CTG 36 | CCG 6 | CAG 42 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 12 | Asn N AAT 6 | Ser S AGT 6
ATC 24 | ACC 24 | AAC 54 | AGC 6
ATA 6 | ACA 6 | Lys K AAA 18 | Arg R AGA 6
Met M ATG 36 | ACG 24 | AAG 24 | AGG 0
------------------------------------------------------------------------------
Val V GTT 24 | Ala A GCT 48 | Asp D GAT 36 | Gly G GGT 36
GTC 12 | GCC 18 | GAC 42 | GGC 30
GTA 12 | GCA 30 | Glu E GAA 18 | GGA 0
GTG 36 | GCG 66 | GAG 12 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.12088 C:0.24725 A:0.23626 G:0.39560
position 2: T:0.25275 C:0.25824 A:0.31868 G:0.17033
position 3: T:0.21429 C:0.34066 A:0.13187 G:0.31319
Average T:0.19597 C:0.28205 A:0.22894 G:0.29304
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -724.264680 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299975 1.300054
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908981_1_2777_MLBR_RS13215: 0.000004, NC_002677_1_NP_302662_1_1534_ML2595: 0.000004, NZ_LVXE01000045_1_WP_010908981_1_1926_A3216_RS10865: 0.000004, NZ_LYPH01000051_1_WP_010908981_1_1949_A8144_RS09315: 0.000004, NZ_CP029543_1_WP_010908981_1_2806_DIJ64_RS14285: 0.000004, NZ_AP014567_1_WP_010908981_1_2874_JK2ML_RS14625: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29998
omega (dN/dS) = 1.30005
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 433.0 113.0 1.3001 0.0000 0.0000 0.0 0.0
7..2 0.000 433.0 113.0 1.3001 0.0000 0.0000 0.0 0.0
7..3 0.000 433.0 113.0 1.3001 0.0000 0.0000 0.0 0.0
7..4 0.000 433.0 113.0 1.3001 0.0000 0.0000 0.0 0.0
7..5 0.000 433.0 113.0 1.3001 0.0000 0.0000 0.0 0.0
7..6 0.000 433.0 113.0 1.3001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -724.264710 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.264257 0.654670 0.000054
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908981_1_2777_MLBR_RS13215: 0.000004, NC_002677_1_NP_302662_1_1534_ML2595: 0.000004, NZ_LVXE01000045_1_WP_010908981_1_1926_A3216_RS10865: 0.000004, NZ_LYPH01000051_1_WP_010908981_1_1949_A8144_RS09315: 0.000004, NZ_CP029543_1_WP_010908981_1_2806_DIJ64_RS14285: 0.000004, NZ_AP014567_1_WP_010908981_1_2874_JK2ML_RS14625: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.26426
MLEs of dN/dS (w) for site classes (K=2)
p: 0.65467 0.34533
w: 0.00005 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 434.0 112.0 0.3454 0.0000 0.0000 0.0 0.0
7..2 0.000 434.0 112.0 0.3454 0.0000 0.0000 0.0 0.0
7..3 0.000 434.0 112.0 0.3454 0.0000 0.0000 0.0 0.0
7..4 0.000 434.0 112.0 0.3454 0.0000 0.0000 0.0 0.0
7..5 0.000 434.0 112.0 0.3454 0.0000 0.0000 0.0 0.0
7..6 0.000 434.0 112.0 0.3454 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -724.264662 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000000 0.000000 0.000001 59.993329
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908981_1_2777_MLBR_RS13215: 0.000004, NC_002677_1_NP_302662_1_1534_ML2595: 0.000004, NZ_LVXE01000045_1_WP_010908981_1_1926_A3216_RS10865: 0.000004, NZ_LYPH01000051_1_WP_010908981_1_1949_A8144_RS09315: 0.000004, NZ_CP029543_1_WP_010908981_1_2806_DIJ64_RS14285: 0.000004, NZ_AP014567_1_WP_010908981_1_2874_JK2ML_RS14625: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 0.00000 1.00000 59.99333
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 442.5 103.5 59.9933 0.0000 0.0000 0.0 0.0
7..2 0.000 442.5 103.5 59.9933 0.0000 0.0000 0.0 0.0
7..3 0.000 442.5 103.5 59.9933 0.0000 0.0000 0.0 0.0
7..4 0.000 442.5 103.5 59.9933 0.0000 0.0000 0.0 0.0
7..5 0.000 442.5 103.5 59.9933 0.0000 0.0000 0.0 0.0
7..6 0.000 442.5 103.5 59.9933 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908981_1_2777_MLBR_RS13215)
Pr(w>1) post mean +- SE for w
1 L 1.000** 59.993
2 P 1.000** 59.993
3 E 1.000** 59.993
4 S 1.000** 59.993
5 Q 1.000** 59.993
6 V 1.000** 59.993
7 A 1.000** 59.993
8 A 1.000** 59.993
9 D 1.000** 59.993
10 D 1.000** 59.993
11 S 1.000** 59.993
12 G 1.000** 59.993
13 V 1.000** 59.993
14 T 1.000** 59.993
15 L 1.000** 59.993
16 N 1.000** 59.993
17 R 1.000** 59.993
18 S 1.000** 59.993
19 R 1.000** 59.993
20 L 1.000** 59.993
21 G 1.000** 59.993
22 R 1.000** 59.993
23 G 1.000** 59.993
24 W 1.000** 59.993
25 L 1.000** 59.993
26 T 1.000** 59.993
27 G 1.000** 59.993
28 I 1.000** 59.993
29 A 1.000** 59.993
30 V 1.000** 59.993
31 A 1.000** 59.993
32 L 1.000** 59.993
33 L 1.000** 59.993
34 L 1.000** 59.993
35 A 1.000** 59.993
36 G 1.000** 59.993
37 C 1.000** 59.993
38 G 1.000** 59.993
39 I 1.000** 59.993
40 G 1.000** 59.993
41 T 1.000** 59.993
42 G 1.000** 59.993
43 G 1.000** 59.993
44 Y 1.000** 59.993
45 C 1.000** 59.993
46 M 1.000** 59.993
47 L 1.000** 59.993
48 R 1.000** 59.993
49 Y 1.000** 59.993
50 H 1.000** 59.993
51 Q 1.000** 59.993
52 D 1.000** 59.993
53 S 1.000** 59.993
54 Q 1.000** 59.993
55 A 1.000** 59.993
56 M 1.000** 59.993
57 A 1.000** 59.993
58 R 1.000** 59.993
59 N 1.000** 59.993
60 D 1.000** 59.993
61 N 1.000** 59.993
62 A 1.000** 59.993
63 A 1.000** 59.993
64 L 1.000** 59.993
65 K 1.000** 59.993
66 T 1.000** 59.993
67 A 1.000** 59.993
68 L 1.000** 59.993
69 D 1.000** 59.993
70 C 1.000** 59.993
71 V 1.000** 59.993
72 A 1.000** 59.993
73 A 1.000** 59.993
74 T 1.000** 59.993
75 Q 1.000** 59.993
76 A 1.000** 59.993
77 P 1.000** 59.993
78 D 1.000** 59.993
79 T 1.000** 59.993
80 N 1.000** 59.993
81 T 1.000** 59.993
82 M 1.000** 59.993
83 A 1.000** 59.993
84 A 1.000** 59.993
85 S 1.000** 59.993
86 E 1.000** 59.993
87 Q 1.000** 59.993
88 K 1.000** 59.993
89 I 1.000** 59.993
90 I 1.000** 59.993
91 D 1.000** 59.993
92 C 1.000** 59.993
93 G 1.000** 59.993
94 T 1.000** 59.993
95 D 1.000** 59.993
96 A 1.000** 59.993
97 F 1.000** 59.993
98 H 1.000** 59.993
99 A 1.000** 59.993
100 Q 1.000** 59.993
101 A 1.000** 59.993
102 L 1.000** 59.993
103 L 1.000** 59.993
104 Y 1.000** 59.993
105 T 1.000** 59.993
106 N 1.000** 59.993
107 M 1.000** 59.993
108 L 1.000** 59.993
109 V 1.000** 59.993
110 Q 1.000** 59.993
111 A 1.000** 59.993
112 Y 1.000** 59.993
113 Q 1.000** 59.993
114 A 1.000** 59.993
115 A 1.000** 59.993
116 N 1.000** 59.993
117 V 1.000** 59.993
118 H 1.000** 59.993
119 V 1.000** 59.993
120 Q 1.000** 59.993
121 V 1.000** 59.993
122 S 1.000** 59.993
123 D 1.000** 59.993
124 M 1.000** 59.993
125 R 1.000** 59.993
126 A 1.000** 59.993
127 A 1.000** 59.993
128 V 1.000** 59.993
129 E 1.000** 59.993
130 R 1.000** 59.993
131 H 1.000** 59.993
132 N 1.000** 59.993
133 N 1.000** 59.993
134 D 1.000** 59.993
135 G 1.000** 59.993
136 S 1.000** 59.993
137 I 1.000** 59.993
138 D 1.000** 59.993
139 V 1.000** 59.993
140 L 1.000** 59.993
141 V 1.000** 59.993
142 A 1.000** 59.993
143 L 1.000** 59.993
144 R 1.000** 59.993
145 V 1.000** 59.993
146 K 1.000** 59.993
147 L 1.000** 59.993
148 S 1.000** 59.993
149 N 1.000** 59.993
150 D 1.000** 59.993
151 R 1.000** 59.993
152 A 1.000** 59.993
153 H 1.000** 59.993
154 N 1.000** 59.993
155 Q 1.000** 59.993
156 E 1.000** 59.993
157 T 1.000** 59.993
158 G 1.000** 59.993
159 Y 1.000** 59.993
160 R 1.000** 59.993
161 L 1.000** 59.993
162 R 1.000** 59.993
163 V 1.000** 59.993
164 K 1.000** 59.993
165 M 1.000** 59.993
166 A 1.000** 59.993
167 L 1.000** 59.993
168 A 1.000** 59.993
169 E 1.000** 59.993
170 G 1.000** 59.993
171 Q 1.000** 59.993
172 Y 1.000** 59.993
173 K 1.000** 59.993
174 I 1.000** 59.993
175 S 1.000** 59.993
176 K 1.000** 59.993
177 L 1.000** 59.993
178 D 1.000** 59.993
179 Q 1.000** 59.993
180 V 1.000** 59.993
181 T 1.000** 59.993
182 K 1.000** 59.993
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908981_1_2777_MLBR_RS13215)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -724.264683 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.567394 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908981_1_2777_MLBR_RS13215: 0.000004, NC_002677_1_NP_302662_1_1534_ML2595: 0.000004, NZ_LVXE01000045_1_WP_010908981_1_1926_A3216_RS10865: 0.000004, NZ_LYPH01000051_1_WP_010908981_1_1949_A8144_RS09315: 0.000004, NZ_CP029543_1_WP_010908981_1_2806_DIJ64_RS14285: 0.000004, NZ_AP014567_1_WP_010908981_1_2874_JK2ML_RS14625: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.56739 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.99990 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 442.5 103.5 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 442.5 103.5 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 442.5 103.5 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 442.5 103.5 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 442.5 103.5 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 442.5 103.5 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -724.264661 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 98.999923 23.821353 100.970073
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908981_1_2777_MLBR_RS13215: 0.000004, NC_002677_1_NP_302662_1_1534_ML2595: 0.000004, NZ_LVXE01000045_1_WP_010908981_1_1926_A3216_RS10865: 0.000004, NZ_LYPH01000051_1_WP_010908981_1_1949_A8144_RS09315: 0.000004, NZ_CP029543_1_WP_010908981_1_2806_DIJ64_RS14285: 0.000004, NZ_AP014567_1_WP_010908981_1_2874_JK2ML_RS14625: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 98.99992 q = 23.82135
(p1 = 0.99999) w = 100.97007
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.74486 0.76906 0.78295 0.79374 0.80321 0.81216 0.82118 0.83096 0.84277 0.86155 100.97007
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 442.5 103.5 100.9691 0.0000 0.0000 0.0 0.0
7..2 0.000 442.5 103.5 100.9691 0.0000 0.0000 0.0 0.0
7..3 0.000 442.5 103.5 100.9691 0.0000 0.0000 0.0 0.0
7..4 0.000 442.5 103.5 100.9691 0.0000 0.0000 0.0 0.0
7..5 0.000 442.5 103.5 100.9691 0.0000 0.0000 0.0 0.0
7..6 0.000 442.5 103.5 100.9691 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908981_1_2777_MLBR_RS13215)
Pr(w>1) post mean +- SE for w
1 L 1.000** 100.969
2 P 1.000** 100.969
3 E 1.000** 100.969
4 S 1.000** 100.969
5 Q 1.000** 100.969
6 V 1.000** 100.969
7 A 1.000** 100.969
8 A 1.000** 100.969
9 D 1.000** 100.969
10 D 1.000** 100.969
11 S 1.000** 100.969
12 G 1.000** 100.969
13 V 1.000** 100.969
14 T 1.000** 100.969
15 L 1.000** 100.969
16 N 1.000** 100.969
17 R 1.000** 100.969
18 S 1.000** 100.969
19 R 1.000** 100.969
20 L 1.000** 100.969
21 G 1.000** 100.969
22 R 1.000** 100.969
23 G 1.000** 100.969
24 W 1.000** 100.969
25 L 1.000** 100.969
26 T 1.000** 100.969
27 G 1.000** 100.969
28 I 1.000** 100.969
29 A 1.000** 100.969
30 V 1.000** 100.969
31 A 1.000** 100.969
32 L 1.000** 100.969
33 L 1.000** 100.969
34 L 1.000** 100.969
35 A 1.000** 100.969
36 G 1.000** 100.969
37 C 1.000** 100.969
38 G 1.000** 100.969
39 I 1.000** 100.969
40 G 1.000** 100.969
41 T 1.000** 100.969
42 G 1.000** 100.969
43 G 1.000** 100.969
44 Y 1.000** 100.969
45 C 1.000** 100.969
46 M 1.000** 100.969
47 L 1.000** 100.969
48 R 1.000** 100.969
49 Y 1.000** 100.969
50 H 1.000** 100.969
51 Q 1.000** 100.969
52 D 1.000** 100.969
53 S 1.000** 100.969
54 Q 1.000** 100.969
55 A 1.000** 100.969
56 M 1.000** 100.969
57 A 1.000** 100.969
58 R 1.000** 100.969
59 N 1.000** 100.969
60 D 1.000** 100.969
61 N 1.000** 100.969
62 A 1.000** 100.969
63 A 1.000** 100.969
64 L 1.000** 100.969
65 K 1.000** 100.969
66 T 1.000** 100.969
67 A 1.000** 100.969
68 L 1.000** 100.969
69 D 1.000** 100.969
70 C 1.000** 100.969
71 V 1.000** 100.969
72 A 1.000** 100.969
73 A 1.000** 100.969
74 T 1.000** 100.969
75 Q 1.000** 100.969
76 A 1.000** 100.969
77 P 1.000** 100.969
78 D 1.000** 100.969
79 T 1.000** 100.969
80 N 1.000** 100.969
81 T 1.000** 100.969
82 M 1.000** 100.969
83 A 1.000** 100.969
84 A 1.000** 100.969
85 S 1.000** 100.969
86 E 1.000** 100.969
87 Q 1.000** 100.969
88 K 1.000** 100.969
89 I 1.000** 100.969
90 I 1.000** 100.969
91 D 1.000** 100.969
92 C 1.000** 100.969
93 G 1.000** 100.969
94 T 1.000** 100.969
95 D 1.000** 100.969
96 A 1.000** 100.969
97 F 1.000** 100.969
98 H 1.000** 100.969
99 A 1.000** 100.969
100 Q 1.000** 100.969
101 A 1.000** 100.969
102 L 1.000** 100.969
103 L 1.000** 100.969
104 Y 1.000** 100.969
105 T 1.000** 100.969
106 N 1.000** 100.969
107 M 1.000** 100.969
108 L 1.000** 100.969
109 V 1.000** 100.969
110 Q 1.000** 100.969
111 A 1.000** 100.969
112 Y 1.000** 100.969
113 Q 1.000** 100.969
114 A 1.000** 100.969
115 A 1.000** 100.969
116 N 1.000** 100.969
117 V 1.000** 100.969
118 H 1.000** 100.969
119 V 1.000** 100.969
120 Q 1.000** 100.969
121 V 1.000** 100.969
122 S 1.000** 100.969
123 D 1.000** 100.969
124 M 1.000** 100.969
125 R 1.000** 100.969
126 A 1.000** 100.969
127 A 1.000** 100.969
128 V 1.000** 100.969
129 E 1.000** 100.969
130 R 1.000** 100.969
131 H 1.000** 100.969
132 N 1.000** 100.969
133 N 1.000** 100.969
134 D 1.000** 100.969
135 G 1.000** 100.969
136 S 1.000** 100.969
137 I 1.000** 100.969
138 D 1.000** 100.969
139 V 1.000** 100.969
140 L 1.000** 100.969
141 V 1.000** 100.969
142 A 1.000** 100.969
143 L 1.000** 100.969
144 R 1.000** 100.969
145 V 1.000** 100.969
146 K 1.000** 100.969
147 L 1.000** 100.969
148 S 1.000** 100.969
149 N 1.000** 100.969
150 D 1.000** 100.969
151 R 1.000** 100.969
152 A 1.000** 100.969
153 H 1.000** 100.969
154 N 1.000** 100.969
155 Q 1.000** 100.969
156 E 1.000** 100.969
157 T 1.000** 100.969
158 G 1.000** 100.969
159 Y 1.000** 100.969
160 R 1.000** 100.969
161 L 1.000** 100.969
162 R 1.000** 100.969
163 V 1.000** 100.969
164 K 1.000** 100.969
165 M 1.000** 100.969
166 A 1.000** 100.969
167 L 1.000** 100.969
168 A 1.000** 100.969
169 E 1.000** 100.969
170 G 1.000** 100.969
171 Q 1.000** 100.969
172 Y 1.000** 100.969
173 K 1.000** 100.969
174 I 1.000** 100.969
175 S 1.000** 100.969
176 K 1.000** 100.969
177 L 1.000** 100.969
178 D 1.000** 100.969
179 Q 1.000** 100.969
180 V 1.000** 100.969
181 T 1.000** 100.969
182 K 1.000** 100.969
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908981_1_2777_MLBR_RS13215)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:12
Model 1: NearlyNeutral -724.26471 Model 2: PositiveSelection -724.264662 Model 0: one-ratio -724.26468 Model 7: beta -724.264683 Model 8: beta&w>1 -724.264661 Model 0 vs 1 6.000000007588824E-5 Model 2 vs 1 9.599999998499698E-5 Model 8 vs 7 4.399999988891068E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
