--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:43:56 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2597/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -774.75          -778.73
2       -774.79          -779.57
--------------------------------------
TOTAL     -774.77          -779.24
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.879773    0.085655    0.364706    1.476927    0.845244   1252.48   1315.97    1.000
r(A<->C){all}   0.215161    0.027339    0.000178    0.549487    0.178947     92.43    117.93    1.000
r(A<->G){all}   0.158514    0.017693    0.000034    0.422680    0.121409     76.54    109.17    1.007
r(A<->T){all}   0.159559    0.018818    0.000184    0.440421    0.121461    120.03    211.53    1.000
r(C<->G){all}   0.147746    0.018187    0.000073    0.433683    0.107325    134.46    171.31    1.000
r(C<->T){all}   0.156657    0.018824    0.000048    0.431481    0.118020    300.04    329.18    1.001
r(G<->T){all}   0.162363    0.018986    0.000091    0.437445    0.123311    158.57    169.16    1.000
pi(A){all}      0.237426    0.000329    0.201026    0.270441    0.237503   1087.71   1253.96    1.000
pi(C){all}      0.270127    0.000351    0.234164    0.305977    0.269659   1360.34   1365.13    1.000
pi(G){all}      0.288938    0.000368    0.252900    0.327061    0.288708   1187.18   1229.39    1.001
pi(T){all}      0.203508    0.000279    0.172473    0.236869    0.203391   1314.10   1335.52    1.000
alpha{1,2}      0.398773    0.210979    0.000265    1.351137    0.238669   1105.59   1303.29    1.000
alpha{3}        0.410201    0.229376    0.000204    1.357471    0.244667    941.52   1022.18    1.000
pinvar{all}     0.994047    0.000028    0.984409    0.999921    0.995508   1472.70   1486.85    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-750.842868
Model 2: PositiveSelection	-744.940674
Model 0: one-ratio	-750.398051
Model 7: beta	-750.405893
Model 8: beta&w>1	-744.940673


Model 0 vs 1	0.8896339999998872

Model 2 vs 1	11.804388000000017

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634449_1_2779_MLBR_RS13225)

            Pr(w>1)     post mean +- SE for w

   151 S      1.000**       999.000

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634449_1_2779_MLBR_RS13225)

            Pr(w>1)     post mean +- SE for w

   151 S      0.918         6.617 +- 2.947


Model 8 vs 7	10.93044000000009

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634449_1_2779_MLBR_RS13225)

            Pr(w>1)     post mean +- SE for w

   151 S      1.000**       999.000

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634449_1_2779_MLBR_RS13225)

            Pr(w>1)     post mean +- SE for w

   151 S      0.965*        6.516 +- 2.779

>C1
MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
>C2
MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
YPDEKQVLENTNRWTATATREGNQWKISNLLQVI
>C3
MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
>C4
MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
>C5
MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
YPDEKQVLENTNRWTATATREGNQWKISNLLQVI
>C6
MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=184 

C1              MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
C2              MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
C3              MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
C4              MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
C5              MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
C6              MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
                **************************************************

C1              ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
C2              ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
C3              ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
C4              ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
C5              ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
C6              ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
                **************************************************

C1              AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
C2              AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
C3              AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
C4              AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
C5              AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
C6              AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
                **************************************************

C1              SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
C2              YPDEKQVLENTNRWTATATREGNQWKISNLLQVI
C3              SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
C4              SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
C5              YPDEKQVLENTNRWTATATREGNQWKISNLLQVI
C6              SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
                 *********************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  184 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  184 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [5520]--->[5520]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.476 Mb, Max= 30.724 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
C2              MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
C3              MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
C4              MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
C5              MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
C6              MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
                **************************************************

C1              ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
C2              ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
C3              ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
C4              ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
C5              ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
C6              ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
                **************************************************

C1              AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
C2              AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
C3              AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
C4              AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
C5              AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
C6              AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
                **************************************************

C1              SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
C2              YPDEKQVLENTNRWTATATREGNQWKISNLLQVI
C3              SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
C4              SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
C5              YPDEKQVLENTNRWTATATREGNQWKISNLLQVI
C6              SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
                 *********************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 99.46 C1	 C2	 99.46
TOP	    1    0	 99.46 C2	 C1	 99.46
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 99.46 C1	 C5	 99.46
TOP	    4    0	 99.46 C5	 C1	 99.46
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 99.46 C2	 C3	 99.46
TOP	    2    1	 99.46 C3	 C2	 99.46
BOT	    1    3	 99.46 C2	 C4	 99.46
TOP	    3    1	 99.46 C4	 C2	 99.46
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 99.46 C2	 C6	 99.46
TOP	    5    1	 99.46 C6	 C2	 99.46
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 99.46 C3	 C5	 99.46
TOP	    4    2	 99.46 C5	 C3	 99.46
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 99.46 C4	 C5	 99.46
TOP	    4    3	 99.46 C5	 C4	 99.46
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 99.46 C5	 C6	 99.46
TOP	    5    4	 99.46 C6	 C5	 99.46
AVG	 0	 C1	  *	 99.78
AVG	 1	 C2	  *	 99.57
AVG	 2	 C3	  *	 99.78
AVG	 3	 C4	  *	 99.78
AVG	 4	 C5	  *	 99.57
AVG	 5	 C6	  *	 99.78
TOT	 TOT	  *	 99.71
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC
C2              ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC
C3              ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC
C4              ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC
C5              ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC
C6              ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC
                **************************************************

C1              GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT
C2              GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT
C3              GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT
C4              GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT
C5              GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT
C6              GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT
                **************************************************

C1              TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG
C2              TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG
C3              TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG
C4              TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG
C5              TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG
C6              TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG
                **************************************************

C1              ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT
C2              ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT
C3              ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT
C4              ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT
C5              ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT
C6              ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT
                **************************************************

C1              CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC
C2              CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC
C3              CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC
C4              CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC
C5              CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC
C6              CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC
                **************************************************

C1              ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC
C2              ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC
C3              ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC
C4              ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC
C5              ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC
C6              ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC
                **************************************************

C1              GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA
C2              GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA
C3              GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA
C4              GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA
C5              GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA
C6              GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA
                **************************************************

C1              AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA
C2              AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA
C3              AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA
C4              AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA
C5              AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA
C6              AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA
                **************************************************

C1              ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG
C2              ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG
C3              ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG
C4              ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG
C5              ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG
C6              ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG
                **************************************************

C1              TCTCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC
C2              TATCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC
C3              TCTCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC
C4              TCTCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC
C5              TATCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC
C6              TCTCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC
                *.************************************************

C1              CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA
C2              CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA
C3              CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA
C4              CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA
C5              CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA
C6              CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA
                **************************************************

C1              TC
C2              TC
C3              TC
C4              TC
C5              TC
C6              TC
                **



>C1
ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC
GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT
TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG
ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT
CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC
ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC
GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA
AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA
ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG
TCTCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC
CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA
TC
>C2
ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC
GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT
TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG
ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT
CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC
ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC
GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA
AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA
ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG
TATCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC
CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA
TC
>C3
ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC
GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT
TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG
ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT
CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC
ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC
GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA
AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA
ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG
TCTCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC
CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA
TC
>C4
ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC
GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT
TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG
ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT
CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC
ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC
GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA
AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA
ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG
TCTCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC
CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA
TC
>C5
ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC
GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT
TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG
ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT
CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC
ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC
GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA
AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA
ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG
TATCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC
CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA
TC
>C6
ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC
GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT
TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG
ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT
CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC
ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC
GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA
AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA
ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG
TCTCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC
CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA
TC
>C1
MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
>C2
MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
YPDEKQVLENTNRWTATATREGNQWKISNLLQVI
>C3
MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
>C4
MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
>C5
MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
YPDEKQVLENTNRWTATATREGNQWKISNLLQVI
>C6
MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
SPDEKQVLENTNRWTATATREGNQWKISNLLQVI


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 552 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579858930
      Setting output file names to "/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 2133842622
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5286680284
      Seed = 762963646
      Swapseed = 1579858930
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 5 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1238.768122 -- -24.965149
         Chain 2 -- -1238.769747 -- -24.965149
         Chain 3 -- -1238.769676 -- -24.965149
         Chain 4 -- -1242.072960 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1242.072960 -- -24.965149
         Chain 2 -- -1241.436114 -- -24.965149
         Chain 3 -- -1242.072889 -- -24.965149
         Chain 4 -- -1238.768122 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1238.768] (-1238.770) (-1238.770) (-1242.073) * [-1242.073] (-1241.436) (-1242.073) (-1238.768) 
        500 -- (-787.880) (-779.887) (-786.505) [-777.411] * (-780.300) [-776.995] (-781.522) (-779.199) -- 0:00:00
       1000 -- (-782.232) [-775.321] (-782.742) (-781.723) * (-782.722) [-775.774] (-780.654) (-775.602) -- 0:00:00
       1500 -- (-778.993) [-775.316] (-792.847) (-779.837) * [-780.924] (-782.678) (-779.934) (-777.694) -- 0:00:00
       2000 -- [-775.057] (-787.021) (-778.565) (-780.339) * [-777.565] (-789.441) (-776.263) (-782.134) -- 0:00:00
       2500 -- (-779.957) (-777.946) [-775.081] (-776.992) * [-776.323] (-783.298) (-782.851) (-779.114) -- 0:00:00
       3000 -- [-778.290] (-778.957) (-777.857) (-789.246) * [-778.928] (-778.960) (-778.275) (-774.319) -- 0:00:00
       3500 -- (-783.377) (-779.440) (-785.003) [-773.592] * (-779.807) [-773.080] (-786.220) (-779.817) -- 0:00:00
       4000 -- (-775.746) (-787.729) [-783.066] (-780.897) * [-784.554] (-779.964) (-776.409) (-782.559) -- 0:00:00
       4500 -- (-781.730) [-783.528] (-777.882) (-786.932) * (-787.574) (-792.100) [-783.756] (-776.343) -- 0:00:00
       5000 -- (-780.564) [-781.878] (-781.289) (-781.264) * (-775.136) [-786.178] (-783.440) (-777.586) -- 0:00:00

      Average standard deviation of split frequencies: 0.125708

       5500 -- [-778.782] (-785.686) (-793.107) (-779.626) * [-780.496] (-779.857) (-805.993) (-781.335) -- 0:00:00
       6000 -- (-774.266) [-779.538] (-777.581) (-778.337) * (-782.712) [-782.583] (-793.561) (-783.360) -- 0:00:00
       6500 -- (-775.695) (-789.534) (-779.391) [-776.408] * (-774.082) (-782.062) (-782.511) [-777.248] -- 0:00:00
       7000 -- (-775.299) [-778.482] (-792.103) (-781.643) * (-780.443) [-774.673] (-781.253) (-784.162) -- 0:00:00
       7500 -- (-782.296) [-779.174] (-787.620) (-787.807) * [-779.467] (-778.365) (-789.080) (-778.762) -- 0:00:00
       8000 -- (-778.060) [-777.488] (-774.839) (-782.566) * [-781.132] (-783.178) (-778.396) (-778.248) -- 0:02:04
       8500 -- (-778.641) (-776.930) [-776.772] (-782.420) * (-776.316) [-777.976] (-776.002) (-782.061) -- 0:01:56
       9000 -- (-784.704) [-776.301] (-774.648) (-784.039) * [-781.156] (-781.538) (-777.982) (-775.887) -- 0:01:50
       9500 -- (-778.865) (-774.837) [-775.772] (-776.007) * [-779.719] (-782.212) (-778.013) (-786.155) -- 0:01:44
      10000 -- (-781.678) (-778.038) [-776.797] (-775.683) * [-778.256] (-776.358) (-775.781) (-782.629) -- 0:01:39

      Average standard deviation of split frequencies: 0.110485

      10500 -- (-773.930) [-778.019] (-771.995) (-775.582) * (-779.824) (-786.162) (-777.381) [-777.286] -- 0:01:34
      11000 -- (-774.342) (-776.934) (-771.426) [-775.673] * (-783.048) (-782.581) [-773.789] (-785.095) -- 0:01:29
      11500 -- [-776.706] (-778.502) (-776.134) (-776.236) * (-776.743) (-780.907) (-775.831) [-778.763] -- 0:01:25
      12000 -- (-773.808) (-784.355) [-774.313] (-772.630) * [-780.439] (-775.567) (-780.739) (-781.066) -- 0:01:22
      12500 -- [-780.922] (-777.563) (-772.081) (-778.657) * (-783.273) [-776.005] (-775.871) (-791.173) -- 0:01:19
      13000 -- (-779.297) [-776.418] (-776.566) (-777.492) * (-780.541) [-778.177] (-779.932) (-791.951) -- 0:01:15
      13500 -- [-777.640] (-778.302) (-775.162) (-775.172) * (-780.947) (-778.626) [-775.049] (-774.483) -- 0:01:13
      14000 -- (-779.265) (-777.494) (-775.183) [-775.878] * (-777.248) [-780.097] (-776.411) (-777.087) -- 0:01:10
      14500 -- (-782.150) (-775.592) (-780.379) [-772.477] * (-784.733) [-779.984] (-775.667) (-773.138) -- 0:01:07
      15000 -- (-781.826) (-776.313) (-778.994) [-776.713] * (-781.614) [-778.963] (-774.518) (-774.648) -- 0:01:05

      Average standard deviation of split frequencies: 0.074996

      15500 -- [-773.732] (-777.047) (-784.370) (-775.786) * [-776.348] (-779.604) (-775.267) (-775.695) -- 0:01:03
      16000 -- [-783.609] (-776.441) (-777.709) (-774.168) * (-787.687) [-780.553] (-777.583) (-774.946) -- 0:01:01
      16500 -- (-779.755) (-778.560) [-777.865] (-779.503) * (-776.660) (-790.078) [-780.010] (-774.262) -- 0:00:59
      17000 -- (-787.398) (-775.947) (-778.273) [-775.146] * (-778.311) (-786.324) (-777.687) [-774.788] -- 0:00:57
      17500 -- [-780.625] (-781.750) (-776.454) (-776.743) * (-775.989) [-778.580] (-774.854) (-778.327) -- 0:00:56
      18000 -- (-777.654) (-778.243) (-776.944) [-778.161] * (-778.467) (-775.961) (-775.022) [-776.440] -- 0:00:54
      18500 -- (-782.589) (-775.967) (-774.859) [-778.827] * (-780.820) (-783.368) (-777.259) [-775.354] -- 0:00:53
      19000 -- [-788.240] (-776.514) (-776.445) (-776.669) * (-779.891) [-796.630] (-776.849) (-775.929) -- 0:00:51
      19500 -- (-773.043) [-777.081] (-774.717) (-777.978) * (-779.963) (-789.900) (-776.094) [-775.135] -- 0:00:50
      20000 -- (-779.270) [-777.642] (-775.586) (-776.878) * [-787.077] (-775.123) (-776.445) (-775.451) -- 0:00:49

      Average standard deviation of split frequencies: 0.060826

      20500 -- (-780.617) (-780.611) [-779.756] (-779.197) * (-778.564) (-776.394) (-775.870) [-777.140] -- 0:01:35
      21000 -- [-774.783] (-775.703) (-776.697) (-775.566) * (-784.517) (-776.152) (-773.939) [-774.432] -- 0:01:33
      21500 -- (-781.079) [-777.896] (-776.647) (-776.378) * [-778.888] (-776.549) (-781.955) (-775.913) -- 0:01:31
      22000 -- (-781.100) [-776.450] (-776.599) (-775.360) * [-784.741] (-776.393) (-775.321) (-776.932) -- 0:01:28
      22500 -- (-776.926) (-779.009) [-775.795] (-778.501) * [-778.805] (-775.305) (-775.668) (-775.306) -- 0:01:26
      23000 -- (-781.908) (-776.702) (-778.683) [-777.054] * (-776.700) (-776.451) [-776.286] (-775.720) -- 0:01:24
      23500 -- [-777.401] (-776.391) (-775.333) (-778.425) * [-779.755] (-775.610) (-775.751) (-775.911) -- 0:01:23
      24000 -- (-779.662) (-775.119) (-775.754) [-777.116] * (-780.285) [-773.959] (-779.450) (-774.021) -- 0:01:21
      24500 -- (-778.394) [-778.877] (-774.187) (-778.421) * (-788.711) (-776.701) (-773.382) [-775.594] -- 0:01:19
      25000 -- (-777.658) (-776.614) (-780.745) [-778.716] * [-782.797] (-773.717) (-777.952) (-776.059) -- 0:01:18

      Average standard deviation of split frequencies: 0.054393

      25500 -- (-777.523) [-775.921] (-775.751) (-775.064) * (-784.099) (-776.551) (-776.270) [-775.060] -- 0:01:16
      26000 -- [-775.389] (-776.578) (-775.640) (-775.438) * (-785.925) (-775.393) [-777.692] (-780.187) -- 0:01:14
      26500 -- (-782.424) (-774.718) (-778.251) [-777.079] * (-782.827) [-775.657] (-777.434) (-775.872) -- 0:01:13
      27000 -- (-778.286) [-774.594] (-773.678) (-777.871) * (-776.626) (-776.251) (-775.519) [-777.461] -- 0:01:12
      27500 -- (-781.629) [-776.984] (-777.726) (-775.298) * (-776.701) [-776.397] (-775.931) (-780.696) -- 0:01:10
      28000 -- (-781.972) (-776.229) (-775.561) [-776.639] * [-780.570] (-778.436) (-775.148) (-777.606) -- 0:01:09
      28500 -- [-785.902] (-774.324) (-777.874) (-778.894) * [-775.939] (-779.611) (-775.264) (-778.046) -- 0:01:08
      29000 -- [-790.130] (-776.480) (-779.056) (-777.454) * (-779.473) [-781.009] (-773.500) (-777.634) -- 0:01:06
      29500 -- [-780.391] (-778.967) (-773.715) (-777.222) * (-779.205) [-777.286] (-775.055) (-775.380) -- 0:01:05
      30000 -- (-780.700) (-778.103) (-774.807) [-778.743] * (-773.694) (-776.687) [-774.525] (-773.035) -- 0:01:04

      Average standard deviation of split frequencies: 0.044307

      30500 -- (-786.205) (-776.502) [-773.137] (-775.950) * (-781.753) [-776.411] (-775.224) (-776.352) -- 0:01:03
      31000 -- [-781.549] (-773.756) (-772.623) (-777.367) * (-778.862) (-777.823) [-773.323] (-779.934) -- 0:01:02
      31500 -- (-777.469) [-775.561] (-775.232) (-779.983) * (-786.561) (-778.405) (-775.741) [-774.376] -- 0:01:01
      32000 -- (-779.539) (-775.690) (-774.862) [-776.770] * (-778.276) (-774.981) [-777.161] (-774.704) -- 0:01:00
      32500 -- (-784.524) [-776.471] (-775.404) (-776.069) * (-776.538) (-775.048) (-775.648) [-775.376] -- 0:00:59
      33000 -- (-779.827) (-776.498) (-774.769) [-773.682] * (-779.716) [-774.493] (-778.532) (-774.994) -- 0:00:58
      33500 -- [-786.385] (-778.375) (-776.277) (-778.585) * [-781.248] (-777.063) (-776.816) (-775.922) -- 0:00:57
      34000 -- [-779.675] (-776.615) (-776.276) (-778.058) * (-782.349) (-775.197) (-775.374) [-773.057] -- 0:00:56
      34500 -- (-777.900) (-775.885) (-775.592) [-774.226] * (-780.136) [-775.281] (-774.814) (-775.329) -- 0:00:55
      35000 -- [-778.631] (-775.487) (-773.950) (-774.926) * (-777.316) (-775.221) (-776.691) [-775.951] -- 0:00:55

      Average standard deviation of split frequencies: 0.041154

      35500 -- (-777.533) (-774.517) [-777.381] (-776.335) * [-776.183] (-780.795) (-775.696) (-777.868) -- 0:00:54
      36000 -- (-773.965) (-773.440) (-774.002) [-775.832] * (-779.937) [-778.320] (-775.850) (-777.641) -- 0:01:20
      36500 -- [-783.878] (-775.803) (-777.219) (-780.877) * [-773.963] (-775.047) (-775.416) (-775.142) -- 0:01:19
      37000 -- (-787.460) (-775.092) (-776.375) [-776.505] * (-780.326) (-776.314) (-775.279) [-775.434] -- 0:01:18
      37500 -- (-778.622) (-776.531) [-777.356] (-777.204) * [-780.761] (-775.734) (-775.208) (-776.426) -- 0:01:17
      38000 -- (-788.013) (-778.382) [-776.805] (-775.643) * [-781.434] (-776.873) (-776.744) (-772.100) -- 0:01:15
      38500 -- (-780.725) (-778.294) (-777.752) [-774.589] * (-779.060) (-776.570) [-774.976] (-776.557) -- 0:01:14
      39000 -- (-784.703) (-775.134) (-773.707) [-773.403] * [-777.136] (-777.641) (-776.474) (-777.821) -- 0:01:13
      39500 -- [-777.779] (-775.731) (-776.070) (-775.727) * [-781.774] (-776.575) (-774.821) (-775.320) -- 0:01:12
      40000 -- (-786.382) (-775.137) [-773.724] (-779.241) * [-782.428] (-777.498) (-777.609) (-774.952) -- 0:01:12

      Average standard deviation of split frequencies: 0.039744

      40500 -- [-777.262] (-775.573) (-775.149) (-777.244) * [-781.892] (-775.350) (-776.808) (-777.260) -- 0:01:11
      41000 -- [-779.376] (-774.206) (-776.150) (-777.429) * (-779.089) (-776.838) [-777.937] (-773.535) -- 0:01:10
      41500 -- [-775.946] (-777.207) (-774.451) (-780.597) * (-782.861) [-777.005] (-776.440) (-775.531) -- 0:01:09
      42000 -- [-780.044] (-779.100) (-777.139) (-775.183) * (-785.829) [-774.632] (-777.040) (-775.273) -- 0:01:08
      42500 -- [-777.580] (-774.623) (-776.049) (-775.201) * (-782.176) (-775.845) [-772.178] (-781.242) -- 0:01:07
      43000 -- (-777.775) [-778.206] (-781.884) (-774.854) * [-782.195] (-777.708) (-775.936) (-776.860) -- 0:01:06
      43500 -- (-779.255) (-778.065) (-774.888) [-775.847] * (-784.387) (-782.981) (-775.228) [-774.573] -- 0:01:05
      44000 -- [-778.090] (-774.927) (-777.029) (-774.652) * [-776.508] (-775.626) (-777.265) (-776.191) -- 0:01:05
      44500 -- (-787.519) (-774.469) (-774.424) [-771.853] * [-777.771] (-779.742) (-776.272) (-776.059) -- 0:01:04
      45000 -- [-779.234] (-776.884) (-775.206) (-772.757) * [-778.887] (-779.397) (-776.484) (-781.904) -- 0:01:03

      Average standard deviation of split frequencies: 0.030744

      45500 -- (-778.315) (-775.165) (-780.463) [-777.669] * (-775.941) (-776.543) (-775.029) [-777.337] -- 0:01:02
      46000 -- [-778.947] (-775.685) (-774.631) (-776.456) * [-785.510] (-775.228) (-777.549) (-776.515) -- 0:01:02
      46500 -- [-782.658] (-775.913) (-776.605) (-776.836) * (-780.831) [-774.746] (-776.372) (-776.132) -- 0:01:01
      47000 -- [-774.702] (-775.875) (-780.279) (-778.794) * (-778.071) (-777.153) (-776.742) [-778.455] -- 0:01:00
      47500 -- (-778.469) (-774.950) (-785.858) [-775.706] * (-783.258) (-773.710) (-777.459) [-775.010] -- 0:01:00
      48000 -- (-774.045) [-774.990] (-775.238) (-780.453) * (-779.240) [-773.592] (-778.696) (-776.387) -- 0:00:59
      48500 -- [-774.939] (-776.286) (-776.230) (-778.557) * [-781.511] (-774.432) (-779.203) (-777.943) -- 0:00:58
      49000 -- (-772.708) (-776.184) (-776.083) [-777.272] * (-778.860) [-773.228] (-777.889) (-777.465) -- 0:00:58
      49500 -- (-780.087) (-776.209) [-775.179] (-777.218) * (-794.567) (-773.927) (-775.895) [-780.758] -- 0:00:57
      50000 -- (-788.287) (-779.926) [-776.114] (-777.331) * (-782.592) [-774.802] (-777.957) (-776.676) -- 0:00:57

      Average standard deviation of split frequencies: 0.029344

      50500 -- (-782.718) (-773.790) (-777.402) [-777.766] * (-782.008) (-774.808) [-775.690] (-776.306) -- 0:00:56
      51000 -- (-781.692) (-774.731) [-774.747] (-774.449) * (-781.849) (-773.946) [-775.718] (-775.369) -- 0:01:14
      51500 -- [-777.208] (-774.813) (-777.859) (-777.216) * (-785.558) (-777.799) (-774.790) [-774.968] -- 0:01:13
      52000 -- (-778.759) [-775.292] (-778.737) (-775.464) * [-778.995] (-776.604) (-775.227) (-776.415) -- 0:01:12
      52500 -- [-779.051] (-776.441) (-776.446) (-775.943) * (-786.472) [-773.380] (-775.304) (-775.007) -- 0:01:12
      53000 -- (-776.729) (-777.244) (-776.602) [-780.192] * [-783.216] (-774.906) (-778.237) (-776.713) -- 0:01:11
      53500 -- (-788.120) [-780.399] (-775.468) (-777.705) * (-783.652) (-775.910) (-777.128) [-776.433] -- 0:01:10
      54000 -- [-782.427] (-776.857) (-775.846) (-776.529) * (-779.577) (-777.027) [-778.494] (-775.042) -- 0:01:10
      54500 -- (-788.700) [-775.150] (-774.857) (-778.528) * (-776.215) [-776.464] (-774.478) (-776.822) -- 0:01:09
      55000 -- [-778.260] (-775.316) (-777.669) (-773.566) * (-776.898) [-778.696] (-776.703) (-776.417) -- 0:01:08

      Average standard deviation of split frequencies: 0.018239

      55500 -- (-778.876) (-774.064) (-776.692) [-773.039] * [-776.505] (-779.447) (-775.121) (-775.088) -- 0:01:08
      56000 -- [-780.416] (-773.686) (-778.842) (-776.527) * [-781.766] (-777.712) (-775.179) (-776.693) -- 0:01:07
      56500 -- [-776.888] (-777.581) (-775.701) (-776.465) * [-775.694] (-779.185) (-772.978) (-778.121) -- 0:01:06
      57000 -- [-776.666] (-775.880) (-776.143) (-775.105) * [-782.026] (-776.325) (-776.172) (-775.591) -- 0:01:06
      57500 -- [-775.223] (-773.831) (-779.940) (-776.582) * [-777.371] (-775.383) (-774.693) (-776.548) -- 0:01:05
      58000 -- (-785.781) (-775.272) (-774.119) [-777.653] * (-778.109) (-775.143) (-774.082) [-773.594] -- 0:01:04
      58500 -- (-776.949) [-772.638] (-779.798) (-776.100) * [-773.012] (-775.068) (-778.022) (-775.378) -- 0:01:04
      59000 -- (-782.652) [-774.093] (-776.785) (-773.394) * (-776.526) (-777.253) (-774.617) [-773.919] -- 0:01:03
      59500 -- [-780.149] (-775.991) (-775.791) (-773.360) * [-776.046] (-776.507) (-776.983) (-776.206) -- 0:01:03
      60000 -- [-778.912] (-775.718) (-775.585) (-775.852) * (-774.674) [-777.798] (-778.662) (-774.415) -- 0:01:02

      Average standard deviation of split frequencies: 0.027196

      60500 -- (-782.777) [-775.729] (-774.445) (-775.146) * (-774.777) [-777.862] (-775.690) (-775.426) -- 0:01:02
      61000 -- (-778.271) [-775.323] (-777.315) (-776.906) * (-774.571) (-777.208) [-776.302] (-774.613) -- 0:01:01
      61500 -- [-778.457] (-777.009) (-774.698) (-775.676) * (-779.294) [-775.979] (-775.893) (-776.624) -- 0:01:01
      62000 -- (-774.219) [-774.400] (-776.905) (-777.310) * (-777.100) (-775.484) (-776.739) [-776.037] -- 0:01:00
      62500 -- (-777.653) [-775.743] (-778.045) (-777.254) * (-783.650) (-777.883) [-775.051] (-774.956) -- 0:01:00
      63000 -- (-774.851) (-773.902) (-776.645) [-776.356] * (-779.044) [-775.828] (-776.657) (-779.137) -- 0:00:59
      63500 -- [-776.304] (-777.966) (-776.818) (-776.451) * (-778.968) (-775.865) (-777.087) [-775.109] -- 0:00:58
      64000 -- [-776.556] (-776.359) (-777.392) (-775.764) * (-778.084) [-775.299] (-776.296) (-777.337) -- 0:00:58
      64500 -- (-778.946) [-775.932] (-777.331) (-776.866) * (-777.302) (-774.868) [-773.652] (-776.039) -- 0:00:58
      65000 -- [-776.592] (-775.417) (-776.952) (-777.868) * (-777.979) (-776.065) (-777.818) [-776.401] -- 0:00:57

      Average standard deviation of split frequencies: 0.019047

      65500 -- [-775.809] (-775.202) (-775.137) (-782.699) * (-777.052) (-773.566) (-777.542) [-776.688] -- 0:00:57
      66000 -- [-774.202] (-776.730) (-775.691) (-779.222) * [-775.762] (-774.958) (-778.594) (-777.026) -- 0:01:10
      66500 -- (-779.743) (-772.568) (-777.706) [-775.323] * [-775.688] (-774.845) (-779.448) (-775.757) -- 0:01:10
      67000 -- (-777.657) (-774.309) [-775.488] (-774.578) * (-777.817) (-774.863) [-775.001] (-776.106) -- 0:01:09
      67500 -- [-774.998] (-772.517) (-778.223) (-774.838) * (-777.782) (-776.276) (-778.445) [-775.709] -- 0:01:09
      68000 -- [-774.978] (-774.278) (-779.575) (-778.243) * [-776.667] (-774.435) (-778.490) (-777.182) -- 0:01:08
      68500 -- (-779.525) (-775.975) (-779.000) [-773.984] * [-777.141] (-778.457) (-783.487) (-775.260) -- 0:01:07
      69000 -- [-776.144] (-775.038) (-779.783) (-773.703) * [-777.246] (-778.911) (-782.431) (-779.885) -- 0:01:07
      69500 -- (-774.924) [-775.418] (-775.745) (-773.079) * (-778.895) (-775.994) (-775.702) [-777.431] -- 0:01:06
      70000 -- (-775.860) (-776.299) [-773.710] (-776.944) * (-775.501) (-775.942) (-775.685) [-776.187] -- 0:01:06

      Average standard deviation of split frequencies: 0.021918

      70500 -- (-778.599) (-775.353) [-776.451] (-775.123) * [-775.857] (-776.376) (-774.886) (-780.158) -- 0:01:05
      71000 -- (-776.012) (-777.716) (-776.804) [-776.221] * (-780.163) (-777.897) [-777.495] (-777.454) -- 0:01:05
      71500 -- (-773.272) (-774.905) (-777.946) [-772.922] * [-775.341] (-779.273) (-779.056) (-776.791) -- 0:01:04
      72000 -- (-775.581) (-776.052) (-778.457) [-776.905] * (-780.054) [-776.604] (-780.055) (-778.926) -- 0:01:04
      72500 -- [-776.805] (-777.272) (-778.806) (-774.823) * (-775.195) [-775.425] (-779.039) (-772.970) -- 0:01:03
      73000 -- (-775.111) [-774.002] (-779.267) (-773.390) * (-778.089) [-777.873] (-775.371) (-773.001) -- 0:01:03
      73500 -- (-778.766) (-776.151) (-774.519) [-775.887] * (-778.569) (-777.689) [-777.543] (-774.089) -- 0:01:03
      74000 -- [-778.582] (-779.854) (-777.447) (-778.186) * [-775.510] (-776.848) (-777.747) (-775.129) -- 0:01:02
      74500 -- (-779.517) (-777.926) [-775.433] (-774.975) * (-774.429) [-775.897] (-775.232) (-774.986) -- 0:01:02
      75000 -- [-776.944] (-778.239) (-775.913) (-776.271) * (-779.163) [-775.228] (-775.580) (-776.350) -- 0:01:01

      Average standard deviation of split frequencies: 0.024811

      75500 -- (-775.704) [-777.718] (-776.574) (-776.210) * (-778.088) (-778.064) (-775.376) [-775.938] -- 0:01:01
      76000 -- [-774.839] (-773.405) (-775.253) (-775.911) * (-775.250) (-776.086) (-774.924) [-778.450] -- 0:01:00
      76500 -- [-778.778] (-773.841) (-776.102) (-773.897) * [-781.008] (-776.379) (-775.399) (-776.176) -- 0:01:00
      77000 -- (-778.323) (-774.379) [-775.678] (-776.846) * (-776.669) (-780.687) [-774.543] (-776.607) -- 0:00:59
      77500 -- (-776.681) (-776.395) (-777.355) [-773.670] * (-777.007) (-778.528) [-775.363] (-775.181) -- 0:00:59
      78000 -- (-775.764) (-778.075) [-778.708] (-778.529) * (-783.181) (-776.606) (-772.207) [-774.022] -- 0:00:59
      78500 -- (-775.987) (-782.512) (-775.279) [-776.769] * (-780.112) [-772.748] (-773.623) (-774.738) -- 0:00:58
      79000 -- [-774.714] (-777.068) (-771.674) (-778.810) * [-780.247] (-776.673) (-779.852) (-775.064) -- 0:00:58
      79500 -- (-778.886) (-777.247) [-775.991] (-776.938) * (-778.981) (-775.580) [-776.500] (-776.180) -- 0:00:57
      80000 -- (-775.632) (-775.444) [-774.701] (-774.258) * (-775.262) (-774.091) (-777.770) [-774.989] -- 0:00:57

      Average standard deviation of split frequencies: 0.027661

      80500 -- (-775.581) (-776.580) (-779.964) [-774.225] * (-777.064) (-774.710) (-775.396) [-776.336] -- 0:00:57
      81000 -- (-777.289) [-776.258] (-773.355) (-777.538) * (-777.074) (-777.408) [-775.351] (-774.756) -- 0:01:08
      81500 -- (-774.458) [-778.475] (-776.579) (-778.261) * (-778.837) (-777.260) (-775.946) [-776.440] -- 0:01:07
      82000 -- (-774.486) (-776.975) [-776.787] (-776.817) * [-777.337] (-778.075) (-774.556) (-777.679) -- 0:01:07
      82500 -- (-774.514) [-774.044] (-777.110) (-777.178) * (-776.767) (-776.451) [-774.705] (-778.024) -- 0:01:06
      83000 -- (-776.212) (-775.461) [-775.035] (-774.125) * [-777.626] (-776.603) (-780.050) (-776.668) -- 0:01:06
      83500 -- (-776.711) (-780.371) (-776.402) [-775.455] * (-776.070) (-776.248) [-777.457] (-776.526) -- 0:01:05
      84000 -- (-777.305) (-778.398) (-778.963) [-774.860] * (-777.134) (-775.108) [-775.579] (-772.909) -- 0:01:05
      84500 -- (-776.199) (-775.527) [-778.762] (-777.367) * [-776.876] (-777.849) (-774.509) (-777.406) -- 0:01:05
      85000 -- (-775.968) (-777.930) [-777.860] (-777.517) * (-781.034) (-774.463) (-775.250) [-776.025] -- 0:01:04

      Average standard deviation of split frequencies: 0.031599

      85500 -- (-776.475) (-777.000) [-775.149] (-775.447) * (-775.194) (-773.635) (-775.949) [-776.055] -- 0:01:04
      86000 -- [-776.862] (-777.628) (-775.451) (-776.154) * (-777.428) (-771.803) (-778.525) [-774.831] -- 0:01:03
      86500 -- (-773.042) [-774.994] (-775.910) (-777.741) * (-775.858) [-772.488] (-776.935) (-777.023) -- 0:01:03
      87000 -- (-776.786) [-774.734] (-775.264) (-774.244) * (-779.681) (-773.966) [-774.899] (-773.683) -- 0:01:02
      87500 -- (-776.382) (-776.987) [-774.948] (-776.314) * (-779.902) [-777.728] (-776.802) (-774.934) -- 0:01:02
      88000 -- (-775.465) (-773.132) [-773.749] (-777.958) * (-780.375) (-778.800) [-775.109] (-779.733) -- 0:01:02
      88500 -- (-776.799) (-776.254) [-776.462] (-776.660) * (-778.678) (-774.030) [-776.021] (-775.070) -- 0:01:01
      89000 -- (-780.291) (-774.091) (-775.671) [-776.224] * (-776.135) (-772.119) [-776.097] (-781.319) -- 0:01:01
      89500 -- (-780.123) (-779.167) (-778.868) [-779.162] * (-777.803) [-775.158] (-775.160) (-777.596) -- 0:01:01
      90000 -- (-774.835) [-777.933] (-781.957) (-777.863) * (-777.366) [-774.617] (-777.759) (-773.572) -- 0:01:00

      Average standard deviation of split frequencies: 0.036720

      90500 -- (-775.297) [-774.795] (-777.161) (-775.024) * (-785.746) [-775.913] (-778.106) (-779.374) -- 0:01:00
      91000 -- (-777.866) (-777.589) [-773.696] (-774.764) * (-778.354) [-774.953] (-784.353) (-777.797) -- 0:00:59
      91500 -- (-780.355) (-777.932) [-776.621] (-773.779) * (-778.542) (-777.509) (-775.338) [-775.542] -- 0:00:59
      92000 -- [-777.057] (-772.612) (-777.053) (-777.580) * (-780.509) (-775.245) (-774.435) [-777.607] -- 0:00:59
      92500 -- [-774.916] (-782.477) (-776.606) (-777.747) * (-777.680) [-772.924] (-778.106) (-775.797) -- 0:00:58
      93000 -- (-776.243) [-777.782] (-776.247) (-776.495) * (-775.466) [-775.357] (-775.444) (-778.041) -- 0:00:58
      93500 -- (-775.399) [-778.363] (-775.563) (-779.038) * (-775.204) (-773.376) [-776.484] (-774.357) -- 0:00:58
      94000 -- (-776.322) (-776.516) [-777.459] (-775.840) * (-774.970) (-775.258) [-775.093] (-775.946) -- 0:00:57
      94500 -- [-776.439] (-775.363) (-777.468) (-777.164) * (-775.612) [-775.869] (-778.988) (-775.581) -- 0:00:57
      95000 -- (-775.635) [-781.360] (-776.523) (-775.898) * (-776.177) (-776.901) [-774.901] (-775.445) -- 0:00:57

      Average standard deviation of split frequencies: 0.035908

      95500 -- (-776.618) (-774.343) [-775.258] (-776.964) * [-774.114] (-777.392) (-775.026) (-777.411) -- 0:01:06
      96000 -- (-775.524) (-775.099) (-776.406) [-779.683] * [-774.679] (-778.810) (-774.918) (-776.228) -- 0:01:05
      96500 -- [-776.855] (-774.892) (-780.735) (-775.069) * [-775.134] (-779.202) (-778.548) (-776.676) -- 0:01:05
      97000 -- (-777.555) (-775.860) [-775.114] (-774.030) * [-775.672] (-776.478) (-778.110) (-776.387) -- 0:01:05
      97500 -- (-782.358) [-774.676] (-777.202) (-773.963) * (-774.219) [-780.152] (-777.837) (-772.721) -- 0:01:04
      98000 -- (-774.602) (-778.598) (-778.347) [-775.072] * [-776.801] (-777.637) (-774.476) (-773.547) -- 0:01:04
      98500 -- (-774.892) (-778.625) [-776.316] (-777.669) * (-775.823) [-775.198] (-775.240) (-775.385) -- 0:01:04
      99000 -- [-776.851] (-775.212) (-776.747) (-774.295) * (-775.127) (-775.627) [-777.178] (-775.106) -- 0:01:03
      99500 -- (-776.136) (-775.619) [-777.116] (-776.110) * (-776.971) (-775.268) [-777.234] (-775.572) -- 0:01:03
      100000 -- (-778.333) [-775.187] (-778.157) (-776.784) * [-773.834] (-772.842) (-775.384) (-777.129) -- 0:01:02

      Average standard deviation of split frequencies: 0.038048

      100500 -- [-775.105] (-777.535) (-777.720) (-775.126) * (-777.034) (-772.002) (-775.711) [-774.647] -- 0:01:02
      101000 -- [-777.451] (-775.143) (-777.053) (-775.458) * (-774.010) (-781.758) (-776.012) [-778.838] -- 0:01:02
      101500 -- (-775.393) (-777.238) (-781.319) [-773.474] * (-777.936) [-777.442] (-776.493) (-777.365) -- 0:01:01
      102000 -- (-775.953) [-776.123] (-775.271) (-778.884) * (-778.167) (-772.089) [-776.134] (-776.054) -- 0:01:01
      102500 -- (-776.357) [-774.516] (-778.078) (-781.889) * (-776.317) [-773.725] (-775.278) (-776.371) -- 0:01:01
      103000 -- [-775.662] (-775.381) (-776.186) (-784.057) * (-774.607) (-777.481) (-776.708) [-774.439] -- 0:01:00
      103500 -- [-772.545] (-776.802) (-781.231) (-776.143) * (-775.346) (-774.830) (-775.931) [-774.907] -- 0:01:00
      104000 -- (-778.518) (-773.846) [-776.018] (-776.685) * (-776.241) (-773.753) (-776.999) [-775.578] -- 0:01:00
      104500 -- (-775.577) (-777.753) (-776.018) [-778.864] * (-775.110) [-773.990] (-774.866) (-776.541) -- 0:00:59
      105000 -- (-775.670) (-776.357) [-775.911] (-777.640) * (-772.728) (-779.603) (-777.555) [-780.096] -- 0:00:59

      Average standard deviation of split frequencies: 0.038455

      105500 -- [-773.750] (-779.998) (-779.410) (-778.619) * [-774.714] (-778.465) (-775.217) (-776.251) -- 0:00:59
      106000 -- (-776.553) (-776.371) (-776.185) [-775.466] * (-771.646) (-779.771) [-775.252] (-777.747) -- 0:00:59
      106500 -- (-775.151) (-776.488) (-775.325) [-775.154] * (-783.773) [-779.246] (-778.609) (-779.760) -- 0:00:58
      107000 -- (-775.471) [-775.205] (-775.668) (-773.453) * (-776.678) (-776.064) [-776.478] (-772.704) -- 0:00:58
      107500 -- (-776.320) (-779.629) [-775.048] (-776.144) * [-773.552] (-782.467) (-776.961) (-775.518) -- 0:00:58
      108000 -- (-778.002) (-784.679) [-777.097] (-776.890) * (-775.201) (-781.496) (-779.451) [-773.998] -- 0:00:57
      108500 -- (-777.322) (-779.939) [-776.134] (-776.510) * (-777.816) (-779.456) [-775.109] (-775.169) -- 0:00:57
      109000 -- [-779.469] (-775.537) (-780.628) (-777.895) * (-776.502) (-775.861) (-778.856) [-775.463] -- 0:00:57
      109500 -- (-781.475) [-776.302] (-777.041) (-779.194) * [-778.629] (-774.967) (-776.620) (-774.867) -- 0:00:56
      110000 -- (-779.008) (-777.743) [-778.797] (-777.074) * (-775.716) [-776.802] (-778.633) (-777.177) -- 0:00:56

      Average standard deviation of split frequencies: 0.040041

      110500 -- (-777.078) (-776.586) (-777.359) [-773.714] * (-774.950) [-776.424] (-776.427) (-778.573) -- 0:00:56
      111000 -- (-775.302) (-778.763) [-776.796] (-775.051) * [-775.531] (-774.789) (-775.071) (-777.274) -- 0:01:04
      111500 -- (-775.442) (-778.897) [-774.655] (-776.540) * (-776.369) (-777.726) (-776.298) [-777.745] -- 0:01:03
      112000 -- (-778.213) (-778.932) [-775.417] (-775.999) * (-779.984) (-776.275) (-775.005) [-776.274] -- 0:01:03
      112500 -- [-775.631] (-776.661) (-774.678) (-778.247) * (-777.706) (-775.634) [-774.945] (-774.879) -- 0:01:03
      113000 -- (-774.616) [-778.388] (-775.685) (-777.662) * (-779.121) (-776.721) (-778.275) [-776.996] -- 0:01:02
      113500 -- (-782.061) (-774.851) (-780.027) [-776.112] * (-775.062) (-776.158) [-777.355] (-776.563) -- 0:01:02
      114000 -- [-775.859] (-774.406) (-778.568) (-781.517) * (-774.325) (-778.692) [-777.968] (-780.504) -- 0:01:02
      114500 -- [-776.158] (-774.400) (-778.309) (-785.188) * (-774.965) [-774.889] (-776.828) (-779.304) -- 0:01:01
      115000 -- (-775.109) [-774.043] (-775.689) (-778.951) * (-775.376) (-774.646) [-778.050] (-774.988) -- 0:01:01

      Average standard deviation of split frequencies: 0.038742

      115500 -- [-775.006] (-774.392) (-775.599) (-775.316) * [-776.804] (-775.664) (-779.602) (-779.088) -- 0:01:01
      116000 -- (-777.095) (-776.862) (-776.595) [-776.181] * (-777.200) (-774.378) (-779.288) [-778.345] -- 0:01:00
      116500 -- [-775.572] (-775.984) (-778.603) (-775.609) * (-775.938) (-775.894) (-779.711) [-777.695] -- 0:01:00
      117000 -- [-775.776] (-775.216) (-777.026) (-777.571) * (-775.213) [-774.716] (-777.933) (-783.046) -- 0:01:00
      117500 -- [-775.574] (-775.621) (-775.061) (-780.948) * (-777.331) (-774.840) [-777.949] (-779.802) -- 0:01:00
      118000 -- (-775.865) (-773.668) (-776.142) [-778.608] * [-776.018] (-773.507) (-778.389) (-779.156) -- 0:00:59
      118500 -- (-781.017) [-773.697] (-774.164) (-778.632) * (-779.043) [-773.291] (-776.028) (-774.945) -- 0:00:59
      119000 -- (-775.048) [-777.839] (-774.397) (-777.097) * (-775.610) (-773.780) [-778.237] (-776.230) -- 0:00:59
      119500 -- [-775.730] (-782.687) (-777.483) (-783.638) * (-772.940) [-774.260] (-776.638) (-775.950) -- 0:00:58
      120000 -- [-776.071] (-775.483) (-777.659) (-776.738) * (-774.697) [-776.893] (-776.682) (-776.312) -- 0:00:58

      Average standard deviation of split frequencies: 0.034183

      120500 -- (-775.555) [-774.667] (-776.908) (-777.259) * (-778.850) (-776.020) [-775.227] (-777.091) -- 0:00:58
      121000 -- [-776.311] (-775.762) (-776.536) (-777.061) * (-775.548) (-779.596) [-777.322] (-784.300) -- 0:00:58
      121500 -- [-776.923] (-776.823) (-774.744) (-782.948) * (-776.080) (-776.221) [-777.639] (-778.501) -- 0:00:57
      122000 -- (-778.249) [-775.676] (-777.267) (-775.738) * (-774.377) (-779.206) (-773.456) [-776.890] -- 0:00:57
      122500 -- (-776.860) [-774.272] (-774.474) (-776.843) * (-775.913) [-777.212] (-775.063) (-776.320) -- 0:00:57
      123000 -- (-777.185) (-773.974) [-772.987] (-776.907) * (-781.490) [-773.174] (-776.924) (-775.374) -- 0:00:57
      123500 -- [-778.506] (-776.923) (-774.921) (-776.130) * (-777.559) (-775.276) (-774.895) [-774.849] -- 0:00:56
      124000 -- (-775.421) (-775.723) (-775.782) [-775.706] * (-776.971) (-775.889) [-775.175] (-775.151) -- 0:00:56
      124500 -- (-775.777) (-777.088) (-776.035) [-774.522] * (-777.992) (-776.540) [-776.471] (-774.464) -- 0:00:56
      125000 -- (-777.856) (-772.805) (-782.150) [-780.093] * (-777.792) (-777.197) [-777.211] (-776.433) -- 0:00:56

      Average standard deviation of split frequencies: 0.031911

      125500 -- (-776.121) [-775.212] (-788.518) (-776.471) * (-779.751) (-777.077) (-774.046) [-777.242] -- 0:00:55
      126000 -- (-775.798) (-777.999) (-779.092) [-778.652] * (-781.061) (-782.080) [-777.335] (-775.412) -- 0:00:55
      126500 -- (-779.066) [-773.884] (-775.900) (-776.840) * (-775.369) (-774.356) (-775.528) [-773.947] -- 0:01:02
      127000 -- (-776.251) [-776.828] (-772.746) (-781.699) * (-780.706) (-776.084) [-775.439] (-775.649) -- 0:01:01
      127500 -- (-775.894) (-776.599) (-776.319) [-778.084] * (-778.393) (-778.278) (-777.316) [-775.628] -- 0:01:01
      128000 -- (-775.673) (-775.755) [-783.615] (-780.506) * (-776.302) (-780.123) (-778.294) [-775.116] -- 0:01:01
      128500 -- [-777.954] (-774.336) (-775.736) (-780.254) * (-776.416) [-777.122] (-773.625) (-772.901) -- 0:01:01
      129000 -- (-775.507) [-773.542] (-777.032) (-776.187) * (-776.851) [-775.043] (-773.149) (-775.482) -- 0:01:00
      129500 -- (-774.679) [-775.557] (-777.382) (-774.573) * (-776.552) [-773.090] (-775.163) (-776.833) -- 0:01:00
      130000 -- [-781.563] (-774.845) (-776.180) (-778.159) * (-776.995) (-776.392) [-773.967] (-776.312) -- 0:01:00

      Average standard deviation of split frequencies: 0.028649

      130500 -- (-778.517) (-771.761) (-779.589) [-776.419] * [-779.237] (-776.176) (-773.031) (-774.659) -- 0:00:59
      131000 -- [-774.540] (-772.740) (-775.689) (-781.439) * (-775.117) [-773.998] (-773.570) (-773.788) -- 0:00:59
      131500 -- (-778.220) [-775.184] (-776.829) (-775.976) * (-775.866) (-778.143) (-774.573) [-777.818] -- 0:00:59
      132000 -- [-775.050] (-776.533) (-776.391) (-775.364) * (-777.334) [-776.766] (-775.428) (-778.379) -- 0:00:59
      132500 -- (-776.345) (-772.185) (-774.934) [-775.189] * (-777.764) (-775.761) [-775.337] (-779.528) -- 0:00:58
      133000 -- (-780.601) (-772.529) [-776.193] (-774.597) * [-775.742] (-778.484) (-771.431) (-774.756) -- 0:00:58
      133500 -- [-777.348] (-780.202) (-775.939) (-776.152) * (-776.213) (-775.115) [-776.004] (-776.935) -- 0:00:58
      134000 -- [-777.580] (-775.205) (-776.470) (-775.783) * (-776.984) (-774.761) (-777.010) [-777.996] -- 0:00:58
      134500 -- (-775.991) [-773.994] (-775.694) (-777.087) * (-778.642) (-775.306) (-776.034) [-775.131] -- 0:00:57
      135000 -- (-776.302) (-776.384) [-776.926] (-776.480) * (-779.644) [-774.109] (-778.392) (-774.927) -- 0:00:57

      Average standard deviation of split frequencies: 0.025780

      135500 -- (-775.453) [-776.200] (-776.179) (-775.323) * [-779.542] (-773.096) (-775.913) (-777.479) -- 0:00:57
      136000 -- [-773.641] (-777.383) (-777.086) (-774.544) * (-778.626) [-773.105] (-779.293) (-779.590) -- 0:00:57
      136500 -- [-774.484] (-778.456) (-775.146) (-776.271) * [-774.811] (-772.803) (-775.085) (-778.959) -- 0:00:56
      137000 -- (-772.683) [-776.164] (-776.455) (-774.711) * (-775.994) (-777.212) (-776.632) [-777.745] -- 0:00:56
      137500 -- (-774.548) (-775.593) [-775.568] (-775.419) * (-773.546) (-775.932) (-773.857) [-775.808] -- 0:00:56
      138000 -- (-775.844) [-778.431] (-774.835) (-774.583) * (-775.498) (-780.460) [-774.178] (-778.836) -- 0:00:56
      138500 -- (-775.405) (-774.003) [-773.530] (-779.288) * (-775.159) [-774.756] (-774.442) (-785.186) -- 0:00:55
      139000 -- (-774.432) (-773.695) (-775.878) [-774.514] * (-774.240) (-777.028) [-777.318] (-778.252) -- 0:00:55
      139500 -- (-777.310) [-776.453] (-772.429) (-776.015) * (-774.547) (-773.882) (-780.245) [-771.876] -- 0:00:55
      140000 -- [-775.190] (-779.477) (-778.029) (-775.791) * (-776.333) (-773.097) [-777.645] (-774.771) -- 0:00:55

      Average standard deviation of split frequencies: 0.026415

      140500 -- [-775.195] (-776.088) (-775.493) (-775.976) * (-772.701) [-775.231] (-775.963) (-780.935) -- 0:00:55
      141000 -- (-775.883) [-773.478] (-779.775) (-777.196) * (-772.798) [-778.278] (-778.847) (-776.970) -- 0:00:54
      141500 -- [-776.523] (-776.933) (-777.375) (-780.609) * (-776.012) (-779.612) [-774.278] (-777.443) -- 0:01:00
      142000 -- (-778.946) (-776.240) [-775.783] (-779.990) * (-779.226) (-776.122) [-777.627] (-775.324) -- 0:01:00
      142500 -- (-775.047) (-776.947) [-776.146] (-778.576) * (-778.126) [-779.044] (-775.600) (-775.725) -- 0:01:00
      143000 -- (-776.069) (-774.596) (-775.976) [-777.827] * (-776.290) (-775.196) [-773.403] (-776.945) -- 0:00:59
      143500 -- (-775.776) [-775.474] (-777.246) (-777.193) * (-774.810) [-775.041] (-775.893) (-775.120) -- 0:00:59
      144000 -- [-773.944] (-775.763) (-774.290) (-774.751) * (-778.287) (-775.148) (-776.747) [-775.660] -- 0:00:59
      144500 -- [-774.290] (-776.459) (-776.170) (-776.482) * (-775.060) (-773.149) [-775.856] (-777.120) -- 0:00:59
      145000 -- (-774.156) [-775.171] (-774.504) (-777.493) * [-776.184] (-778.974) (-776.620) (-775.482) -- 0:00:58

      Average standard deviation of split frequencies: 0.024811

      145500 -- (-777.004) [-774.101] (-778.309) (-774.905) * (-774.146) (-776.460) [-777.971] (-778.330) -- 0:00:58
      146000 -- (-778.698) (-775.079) [-774.735] (-776.109) * (-777.012) (-778.584) [-776.415] (-778.362) -- 0:00:58
      146500 -- (-776.353) [-776.532] (-778.590) (-773.670) * (-780.535) (-779.883) (-775.161) [-776.306] -- 0:00:58
      147000 -- (-773.789) (-775.260) [-775.187] (-773.191) * (-777.018) [-774.394] (-774.749) (-774.069) -- 0:00:58
      147500 -- (-776.548) [-777.859] (-775.844) (-775.836) * (-778.799) [-775.414] (-775.778) (-776.087) -- 0:00:57
      148000 -- (-775.678) (-778.346) [-776.028] (-777.080) * [-774.782] (-779.154) (-776.999) (-776.350) -- 0:00:57
      148500 -- [-775.052] (-777.884) (-773.202) (-777.720) * [-781.051] (-774.720) (-774.815) (-776.346) -- 0:00:57
      149000 -- (-773.414) [-777.840] (-775.305) (-779.312) * (-775.214) (-774.903) (-778.796) [-774.657] -- 0:00:57
      149500 -- [-776.341] (-775.812) (-773.791) (-778.241) * (-774.886) (-773.984) (-776.087) [-774.564] -- 0:00:56
      150000 -- (-775.798) (-776.845) (-774.384) [-774.901] * (-776.689) [-775.385] (-775.180) (-776.682) -- 0:00:56

      Average standard deviation of split frequencies: 0.026073

      150500 -- (-775.700) (-775.222) [-774.742] (-774.812) * [-776.856] (-776.694) (-774.366) (-778.113) -- 0:00:56
      151000 -- (-775.019) (-775.337) (-775.857) [-782.721] * (-775.269) [-778.362] (-777.094) (-778.069) -- 0:00:56
      151500 -- [-777.812] (-775.570) (-778.777) (-773.754) * (-781.211) (-778.965) [-775.264] (-774.629) -- 0:00:56
      152000 -- (-776.496) (-774.997) [-774.755] (-774.566) * (-775.987) (-778.335) [-776.660] (-775.264) -- 0:00:55
      152500 -- (-776.999) (-774.791) [-778.137] (-777.250) * (-775.319) (-780.811) (-776.620) [-774.740] -- 0:00:55
      153000 -- [-779.248] (-775.609) (-777.138) (-776.963) * (-777.780) (-776.132) [-776.651] (-773.476) -- 0:00:55
      153500 -- (-779.405) (-777.192) [-776.220] (-776.686) * (-776.149) (-777.321) (-776.115) [-776.092] -- 0:00:55
      154000 -- (-775.518) (-778.266) (-777.096) [-777.441] * (-775.583) (-774.621) (-776.462) [-775.251] -- 0:00:54
      154500 -- (-773.756) [-773.012] (-776.340) (-782.347) * (-775.464) (-775.367) [-776.300] (-775.504) -- 0:00:54
      155000 -- (-775.747) (-778.361) [-776.056] (-779.468) * [-775.693] (-775.254) (-777.200) (-775.715) -- 0:00:54

      Average standard deviation of split frequencies: 0.027364

      155500 -- [-774.863] (-774.003) (-775.316) (-777.974) * [-778.440] (-776.331) (-776.389) (-775.243) -- 0:00:54
      156000 -- (-776.145) [-775.393] (-777.849) (-776.071) * (-776.042) (-777.098) (-776.446) [-775.492] -- 0:00:54
      156500 -- (-774.175) (-775.064) (-775.038) [-777.415] * (-778.145) (-775.419) (-781.144) [-773.713] -- 0:00:59
      157000 -- (-777.498) [-773.984] (-776.853) (-780.607) * [-775.305] (-774.651) (-776.432) (-776.170) -- 0:00:59
      157500 -- (-775.868) [-775.342] (-775.415) (-778.387) * (-776.696) (-774.369) [-772.614] (-776.811) -- 0:00:58
      158000 -- [-774.233] (-774.878) (-775.423) (-777.313) * (-776.255) (-777.813) (-776.187) [-775.413] -- 0:00:58
      158500 -- (-776.713) (-776.775) (-775.417) [-777.303] * (-775.039) (-778.767) [-776.205] (-774.431) -- 0:00:58
      159000 -- (-777.731) (-775.162) (-781.976) [-774.866] * [-777.755] (-776.298) (-774.365) (-776.972) -- 0:00:58
      159500 -- (-778.137) (-777.011) (-776.618) [-775.570] * (-773.887) (-777.697) [-778.586] (-774.743) -- 0:00:57
      160000 -- (-778.597) [-777.592] (-777.138) (-774.827) * (-782.871) (-776.606) [-776.380] (-776.111) -- 0:00:57

      Average standard deviation of split frequencies: 0.028478

      160500 -- (-774.173) (-777.575) (-777.735) [-777.507] * (-774.337) (-776.127) (-776.135) [-776.694] -- 0:00:57
      161000 -- (-773.307) (-775.638) (-780.974) [-778.526] * (-775.691) [-775.028] (-776.597) (-774.966) -- 0:00:57
      161500 -- (-774.047) (-774.703) (-780.468) [-774.218] * (-774.762) [-773.186] (-777.346) (-775.842) -- 0:00:57
      162000 -- (-775.360) [-777.344] (-779.680) (-774.455) * [-773.882] (-773.688) (-775.322) (-773.859) -- 0:00:56
      162500 -- (-781.011) (-778.016) [-776.463] (-774.195) * [-774.345] (-774.541) (-775.948) (-775.951) -- 0:00:56
      163000 -- [-778.880] (-777.343) (-777.593) (-778.185) * (-777.565) (-777.294) (-774.435) [-773.536] -- 0:00:56
      163500 -- (-775.990) (-776.987) (-777.991) [-778.114] * (-778.841) (-774.847) (-772.928) [-775.811] -- 0:00:56
      164000 -- (-776.309) (-776.847) (-774.326) [-775.443] * [-775.935] (-776.398) (-775.422) (-775.603) -- 0:00:56
      164500 -- (-775.261) (-776.275) [-777.129] (-778.753) * [-777.598] (-776.603) (-773.337) (-776.636) -- 0:00:55
      165000 -- (-779.732) [-775.013] (-775.927) (-778.338) * (-775.146) [-773.077] (-775.299) (-776.939) -- 0:00:55

      Average standard deviation of split frequencies: 0.026754

      165500 -- (-775.814) (-776.280) [-775.565] (-776.418) * [-775.234] (-777.817) (-774.821) (-774.975) -- 0:00:55
      166000 -- [-774.857] (-774.667) (-774.486) (-780.096) * (-775.413) [-774.241] (-782.253) (-774.519) -- 0:00:55
      166500 -- (-774.424) [-774.593] (-777.420) (-779.687) * (-778.173) (-776.339) [-777.695] (-774.330) -- 0:00:55
      167000 -- (-777.056) (-775.911) [-777.052] (-777.346) * (-777.169) (-777.099) [-774.995] (-774.744) -- 0:00:54
      167500 -- (-775.591) (-775.855) [-779.197] (-777.603) * (-779.143) (-775.948) (-777.121) [-777.315] -- 0:00:54
      168000 -- [-774.785] (-783.522) (-779.036) (-777.223) * (-778.643) [-777.775] (-775.970) (-775.607) -- 0:00:54
      168500 -- (-778.733) (-782.711) [-775.007] (-775.397) * (-776.333) [-774.159] (-777.734) (-774.521) -- 0:00:54
      169000 -- (-775.253) (-778.622) (-775.280) [-775.777] * (-776.517) (-778.946) (-777.938) [-775.023] -- 0:00:54
      169500 -- (-777.950) (-776.651) (-780.288) [-776.460] * (-775.495) (-777.796) (-775.203) [-774.711] -- 0:00:53
      170000 -- (-775.558) (-776.873) [-775.601] (-775.560) * (-775.454) (-777.610) (-777.487) [-777.089] -- 0:00:53

      Average standard deviation of split frequencies: 0.023939

      170500 -- (-774.398) [-780.847] (-776.436) (-775.484) * (-775.648) (-776.612) [-775.896] (-780.801) -- 0:00:53
      171000 -- [-776.305] (-776.333) (-777.526) (-776.511) * [-775.401] (-777.335) (-776.151) (-775.803) -- 0:00:53
      171500 -- (-775.543) [-775.085] (-776.227) (-777.236) * (-774.954) (-775.712) (-774.714) [-774.214] -- 0:00:53
      172000 -- (-775.275) (-774.779) (-780.458) [-775.433] * (-777.322) (-773.952) (-776.413) [-771.476] -- 0:00:57
      172500 -- (-777.876) (-775.955) [-778.179] (-778.701) * (-780.042) (-774.661) (-774.536) [-774.765] -- 0:00:57
      173000 -- (-778.244) (-776.987) [-776.653] (-775.373) * (-778.851) [-775.235] (-775.817) (-778.957) -- 0:00:57
      173500 -- (-774.531) [-778.154] (-775.842) (-781.027) * (-775.788) [-776.354] (-774.592) (-781.999) -- 0:00:57
      174000 -- (-777.631) [-779.317] (-776.972) (-777.369) * (-776.720) [-777.179] (-775.250) (-778.508) -- 0:00:56
      174500 -- (-773.791) (-776.429) [-779.187] (-775.456) * (-778.412) (-778.814) (-775.597) [-776.474] -- 0:00:56
      175000 -- [-776.191] (-781.282) (-775.690) (-777.148) * (-774.865) [-776.015] (-774.431) (-775.054) -- 0:00:56

      Average standard deviation of split frequencies: 0.021991

      175500 -- (-776.168) [-775.999] (-775.449) (-775.038) * (-777.591) (-782.325) [-774.784] (-776.200) -- 0:00:56
      176000 -- (-775.231) [-776.217] (-774.822) (-775.191) * (-775.145) [-777.367] (-774.183) (-785.955) -- 0:00:56
      176500 -- (-776.467) (-780.064) [-774.404] (-776.164) * (-778.963) [-774.647] (-774.651) (-776.973) -- 0:00:55
      177000 -- (-776.917) (-775.326) [-777.234] (-775.530) * (-776.992) [-772.672] (-776.488) (-776.408) -- 0:00:55
      177500 -- (-780.065) (-775.880) (-776.540) [-776.440] * [-776.410] (-770.929) (-782.982) (-776.048) -- 0:00:55
      178000 -- (-774.092) (-777.824) [-773.862] (-778.734) * (-778.841) [-773.549] (-778.401) (-778.011) -- 0:00:55
      178500 -- [-773.489] (-775.021) (-777.100) (-778.763) * (-781.300) [-773.167] (-774.900) (-776.794) -- 0:00:55
      179000 -- (-777.504) (-775.385) (-776.789) [-777.324] * (-779.524) [-775.011] (-778.342) (-777.171) -- 0:00:55
      179500 -- [-776.462] (-776.215) (-776.055) (-774.559) * [-774.227] (-778.429) (-776.414) (-778.651) -- 0:00:54
      180000 -- (-775.287) (-774.896) [-780.150] (-778.276) * (-775.999) [-778.124] (-778.145) (-775.472) -- 0:00:54

      Average standard deviation of split frequencies: 0.018990

      180500 -- [-773.430] (-777.451) (-778.590) (-777.357) * (-776.616) (-782.518) (-777.130) [-775.170] -- 0:00:54
      181000 -- [-774.993] (-776.869) (-774.865) (-776.951) * (-772.996) (-777.217) (-777.862) [-775.527] -- 0:00:54
      181500 -- [-774.918] (-775.700) (-772.971) (-776.083) * (-774.376) (-779.811) (-780.022) [-777.987] -- 0:00:54
      182000 -- [-775.777] (-775.864) (-777.354) (-776.268) * (-775.453) (-776.847) [-774.924] (-781.606) -- 0:00:53
      182500 -- (-776.010) (-778.358) [-773.103] (-774.870) * [-775.790] (-776.434) (-777.248) (-778.425) -- 0:00:53
      183000 -- (-774.394) (-784.684) [-776.413] (-778.620) * (-776.286) [-776.194] (-774.614) (-776.681) -- 0:00:53
      183500 -- (-774.113) (-779.183) [-775.776] (-777.028) * (-778.140) (-776.503) [-774.429] (-774.781) -- 0:00:53
      184000 -- (-779.937) [-777.992] (-778.526) (-774.759) * (-776.613) [-774.699] (-775.297) (-774.772) -- 0:00:53
      184500 -- (-776.233) (-775.443) [-778.553] (-776.141) * (-775.261) [-775.572] (-774.214) (-775.117) -- 0:00:53
      185000 -- (-776.575) (-775.579) [-775.375] (-776.211) * (-775.159) [-774.454] (-774.901) (-775.346) -- 0:00:52

      Average standard deviation of split frequencies: 0.018942

      185500 -- (-774.957) [-775.957] (-776.839) (-774.748) * (-775.417) (-774.771) [-775.518] (-774.629) -- 0:00:52
      186000 -- (-775.602) (-778.656) (-779.115) [-775.376] * [-774.759] (-776.339) (-776.278) (-778.856) -- 0:00:52
      186500 -- (-775.758) (-778.272) (-775.258) [-777.844] * (-777.240) (-774.976) (-780.297) [-777.182] -- 0:00:52
      187000 -- (-778.491) (-777.262) (-780.715) [-778.561] * (-775.596) (-774.969) (-775.438) [-775.369] -- 0:00:52
      187500 -- (-773.598) [-778.680] (-778.370) (-777.570) * (-777.926) [-774.202] (-775.248) (-774.827) -- 0:00:56
      188000 -- [-773.706] (-781.210) (-775.502) (-774.825) * (-775.358) [-776.534] (-774.552) (-775.109) -- 0:00:56
      188500 -- (-774.449) [-781.048] (-774.375) (-777.585) * (-775.255) (-773.229) [-773.317] (-775.996) -- 0:00:55
      189000 -- (-775.014) (-782.280) [-777.186] (-776.183) * (-776.528) (-779.779) (-775.420) [-773.617] -- 0:00:55
      189500 -- (-776.785) (-777.040) [-773.452] (-776.852) * [-776.752] (-776.238) (-775.140) (-777.071) -- 0:00:55
      190000 -- (-774.080) (-775.395) (-774.704) [-774.027] * (-776.494) [-772.549] (-774.444) (-779.278) -- 0:00:55

      Average standard deviation of split frequencies: 0.017444

      190500 -- (-774.920) (-775.809) [-779.924] (-775.442) * [-777.066] (-773.931) (-773.655) (-777.073) -- 0:00:55
      191000 -- (-779.711) (-777.930) [-776.300] (-778.711) * (-775.256) [-774.257] (-776.107) (-774.709) -- 0:00:55
      191500 -- [-775.262] (-776.014) (-777.228) (-780.018) * (-777.206) [-778.195] (-777.842) (-775.510) -- 0:00:54
      192000 -- [-774.333] (-774.973) (-777.031) (-773.548) * (-775.802) [-772.497] (-775.423) (-776.256) -- 0:00:54
      192500 -- [-776.567] (-783.150) (-780.884) (-772.811) * (-776.063) (-773.305) [-773.662] (-776.577) -- 0:00:54
      193000 -- [-775.647] (-775.870) (-775.598) (-773.339) * (-777.434) (-774.182) (-775.485) [-773.103] -- 0:00:54
      193500 -- (-775.694) (-777.152) [-777.884] (-777.425) * (-779.451) (-778.624) (-774.400) [-775.222] -- 0:00:54
      194000 -- (-775.993) [-774.646] (-776.715) (-780.630) * (-779.440) (-777.670) [-774.220] (-777.259) -- 0:00:54
      194500 -- (-774.044) (-778.453) [-773.921] (-775.599) * (-775.990) (-775.152) (-775.757) [-775.907] -- 0:00:53
      195000 -- (-774.381) [-777.339] (-775.693) (-776.676) * (-777.932) [-778.892] (-774.729) (-776.570) -- 0:00:53

      Average standard deviation of split frequencies: 0.016709

      195500 -- (-776.617) [-775.938] (-775.709) (-776.335) * (-775.941) (-778.232) [-777.015] (-774.670) -- 0:00:53
      196000 -- (-776.775) (-780.593) (-774.423) [-776.441] * (-775.748) (-773.347) (-777.789) [-775.561] -- 0:00:53
      196500 -- (-777.956) (-778.058) [-775.959] (-779.994) * (-775.718) [-774.990] (-776.533) (-779.426) -- 0:00:53
      197000 -- (-777.720) (-777.488) [-776.845] (-778.221) * (-776.434) (-776.131) [-777.741] (-780.537) -- 0:00:52
      197500 -- (-778.199) [-777.186] (-776.640) (-778.319) * [-775.595] (-776.245) (-778.730) (-776.080) -- 0:00:52
      198000 -- (-777.414) [-776.216] (-776.354) (-778.924) * (-778.068) (-775.940) [-778.780] (-779.372) -- 0:00:52
      198500 -- (-774.790) [-775.367] (-776.275) (-775.401) * [-777.928] (-775.834) (-776.894) (-778.948) -- 0:00:52
      199000 -- (-775.483) (-776.126) (-777.307) [-775.672] * [-776.334] (-777.897) (-780.932) (-777.547) -- 0:00:52
      199500 -- (-776.286) (-777.975) (-775.166) [-776.151] * (-778.415) (-776.503) (-784.200) [-775.738] -- 0:00:52
      200000 -- (-775.691) [-773.893] (-776.146) (-777.354) * (-777.037) (-775.554) (-780.252) [-773.505] -- 0:00:51

      Average standard deviation of split frequencies: 0.017488

      200500 -- (-775.661) (-776.530) (-777.258) [-774.533] * [-774.447] (-775.649) (-778.624) (-779.695) -- 0:00:51
      201000 -- (-772.883) [-774.692] (-780.286) (-775.271) * (-774.403) (-776.003) (-774.207) [-778.164] -- 0:00:51
      201500 -- [-775.484] (-777.222) (-777.430) (-775.859) * (-775.908) (-778.952) (-774.171) [-776.351] -- 0:00:51
      202000 -- [-778.049] (-780.077) (-773.881) (-778.540) * (-775.570) [-775.183] (-776.125) (-779.875) -- 0:00:51
      202500 -- (-775.363) [-780.068] (-775.471) (-776.815) * (-776.570) (-777.839) [-772.232] (-775.853) -- 0:00:55
      203000 -- (-775.228) (-787.794) (-774.421) [-778.491] * (-777.307) [-777.129] (-772.836) (-775.384) -- 0:00:54
      203500 -- (-776.552) (-775.716) [-777.975] (-781.072) * (-778.005) [-775.605] (-776.841) (-774.137) -- 0:00:54
      204000 -- (-777.300) (-776.397) [-774.923] (-782.179) * (-777.177) [-776.248] (-778.837) (-784.116) -- 0:00:54
      204500 -- (-777.540) (-775.947) (-776.993) [-781.113] * (-775.838) (-777.317) [-773.762] (-778.004) -- 0:00:54
      205000 -- [-773.871] (-775.602) (-777.330) (-774.958) * (-776.054) (-777.649) [-772.148] (-776.812) -- 0:00:54

      Average standard deviation of split frequencies: 0.017343

      205500 -- (-774.952) [-775.364] (-777.078) (-775.834) * (-777.451) [-772.705] (-776.297) (-777.072) -- 0:00:54
      206000 -- (-773.979) (-774.782) (-773.675) [-776.417] * (-774.588) (-774.493) [-774.655] (-780.774) -- 0:00:53
      206500 -- [-782.027] (-774.973) (-776.517) (-774.606) * (-778.782) (-775.852) [-774.393] (-776.800) -- 0:00:53
      207000 -- (-780.749) [-775.412] (-777.631) (-776.823) * (-779.394) [-775.632] (-777.110) (-775.704) -- 0:00:53
      207500 -- (-780.330) (-776.059) [-776.223] (-775.672) * (-778.369) (-780.322) (-778.361) [-777.207] -- 0:00:53
      208000 -- [-776.212] (-776.590) (-774.974) (-775.360) * [-775.492] (-777.339) (-775.491) (-776.061) -- 0:00:53
      208500 -- (-775.762) (-775.208) (-775.376) [-778.301] * [-777.923] (-776.927) (-774.423) (-775.752) -- 0:00:53
      209000 -- (-776.091) (-774.847) (-776.543) [-775.539] * (-776.115) [-774.808] (-773.969) (-775.178) -- 0:00:52
      209500 -- (-776.023) (-775.729) (-775.296) [-773.792] * (-776.648) (-774.738) (-776.708) [-776.075] -- 0:00:52
      210000 -- (-776.291) (-773.814) (-775.119) [-776.218] * (-774.619) (-781.653) (-776.280) [-776.630] -- 0:00:52

      Average standard deviation of split frequencies: 0.016253

      210500 -- (-775.985) [-780.173] (-775.297) (-776.893) * (-776.295) [-780.135] (-773.518) (-776.933) -- 0:00:52
      211000 -- (-773.319) (-775.508) (-775.783) [-775.183] * (-775.757) (-777.033) (-775.315) [-776.129] -- 0:00:52
      211500 -- [-775.611] (-775.835) (-773.853) (-779.504) * (-774.144) (-775.993) (-775.192) [-776.284] -- 0:00:52
      212000 -- (-777.483) [-775.239] (-775.849) (-774.554) * (-781.233) (-778.254) [-775.379] (-775.832) -- 0:00:52
      212500 -- (-776.637) [-775.045] (-776.120) (-777.515) * [-775.082] (-775.971) (-776.766) (-776.486) -- 0:00:51
      213000 -- (-776.792) [-776.682] (-775.216) (-777.623) * [-778.560] (-778.044) (-777.834) (-776.161) -- 0:00:51
      213500 -- (-780.327) [-777.773] (-775.864) (-777.724) * [-775.771] (-773.916) (-773.736) (-777.923) -- 0:00:51
      214000 -- (-775.298) (-778.308) (-775.998) [-776.481] * (-775.177) (-779.049) (-778.683) [-778.027] -- 0:00:51
      214500 -- [-775.861] (-777.057) (-772.983) (-777.061) * (-775.190) (-777.280) (-776.894) [-775.425] -- 0:00:51
      215000 -- [-778.007] (-775.643) (-774.292) (-777.543) * (-774.850) (-774.214) [-776.308] (-776.262) -- 0:00:51

      Average standard deviation of split frequencies: 0.015622

      215500 -- (-775.230) [-776.307] (-775.801) (-777.612) * (-775.618) [-774.996] (-773.274) (-775.053) -- 0:00:50
      216000 -- (-774.296) (-778.442) (-777.380) [-775.260] * (-778.481) [-774.551] (-774.573) (-779.267) -- 0:00:50
      216500 -- [-775.596] (-777.565) (-777.195) (-775.062) * [-773.565] (-775.670) (-776.157) (-776.319) -- 0:00:50
      217000 -- (-773.961) (-777.527) (-777.738) [-773.828] * (-773.310) (-776.009) (-775.986) [-777.445] -- 0:00:50
      217500 -- (-776.674) [-776.299] (-777.375) (-774.486) * (-776.001) [-776.262] (-773.399) (-778.918) -- 0:00:50
      218000 -- (-772.860) [-779.198] (-776.871) (-773.851) * (-776.787) [-775.810] (-778.119) (-775.277) -- 0:00:53
      218500 -- [-775.090] (-776.518) (-777.146) (-774.226) * (-776.041) (-775.766) (-774.316) [-776.068] -- 0:00:53
      219000 -- (-779.157) (-778.484) (-774.224) [-777.733] * (-776.459) (-776.782) (-774.602) [-776.559] -- 0:00:53
      219500 -- (-776.334) (-775.919) [-778.786] (-774.934) * (-774.541) (-776.909) (-777.338) [-777.666] -- 0:00:53
      220000 -- (-774.150) [-776.834] (-777.269) (-775.174) * [-776.092] (-780.862) (-777.562) (-775.880) -- 0:00:53

      Average standard deviation of split frequencies: 0.012930

      220500 -- (-775.103) (-776.147) [-776.230] (-777.290) * (-774.990) (-775.248) (-778.271) [-776.509] -- 0:00:53
      221000 -- (-776.091) (-777.274) [-774.897] (-775.784) * (-777.134) (-775.982) [-774.091] (-777.595) -- 0:00:52
      221500 -- (-775.042) [-775.157] (-774.970) (-775.700) * (-778.576) (-775.917) [-774.096] (-775.993) -- 0:00:52
      222000 -- (-778.169) (-775.113) (-775.075) [-779.536] * [-774.769] (-775.552) (-774.916) (-776.591) -- 0:00:52
      222500 -- (-775.054) [-774.672] (-779.771) (-779.366) * [-775.302] (-777.625) (-773.662) (-780.164) -- 0:00:52
      223000 -- [-774.599] (-776.007) (-781.097) (-778.342) * (-775.887) (-777.886) [-776.093] (-776.625) -- 0:00:52
      223500 -- [-773.878] (-778.257) (-776.700) (-777.196) * [-774.750] (-776.068) (-777.417) (-777.113) -- 0:00:52
      224000 -- (-772.147) (-775.151) (-776.273) [-778.472] * (-775.122) (-775.462) [-776.658] (-774.870) -- 0:00:51
      224500 -- (-776.099) [-775.494] (-775.570) (-775.843) * (-778.412) (-778.686) (-777.494) [-778.342] -- 0:00:51
      225000 -- (-774.665) (-775.626) (-774.736) [-775.855] * (-777.572) (-779.636) [-775.214] (-774.937) -- 0:00:51

      Average standard deviation of split frequencies: 0.011308

      225500 -- (-775.807) (-776.976) [-775.720] (-776.702) * (-777.016) (-776.360) (-775.106) [-774.979] -- 0:00:51
      226000 -- (-776.653) (-775.893) (-776.834) [-774.250] * (-777.343) [-775.287] (-775.086) (-775.524) -- 0:00:51
      226500 -- (-775.071) (-778.554) (-776.745) [-773.260] * (-776.074) (-774.727) [-775.082] (-777.255) -- 0:00:51
      227000 -- [-775.567] (-775.170) (-775.651) (-772.644) * (-776.003) (-776.519) (-777.042) [-776.230] -- 0:00:51
      227500 -- (-773.863) (-774.992) [-774.940] (-773.729) * (-775.906) (-776.037) (-779.044) [-776.568] -- 0:00:50
      228000 -- [-775.245] (-774.886) (-773.310) (-775.999) * (-776.691) [-775.396] (-776.271) (-775.393) -- 0:00:50
      228500 -- (-774.233) [-779.775] (-775.390) (-778.088) * (-773.050) (-777.222) [-775.526] (-775.398) -- 0:00:50
      229000 -- (-775.115) [-775.744] (-776.823) (-773.790) * (-776.157) (-776.195) [-775.592] (-776.501) -- 0:00:50
      229500 -- (-774.500) (-775.357) [-773.748] (-779.884) * [-783.139] (-774.105) (-774.861) (-775.788) -- 0:00:50
      230000 -- [-772.365] (-776.774) (-775.302) (-775.397) * (-774.507) [-775.138] (-775.562) (-774.903) -- 0:00:50

      Average standard deviation of split frequencies: 0.012943

      230500 -- (-773.864) [-776.492] (-775.595) (-773.737) * [-774.280] (-777.053) (-775.219) (-775.103) -- 0:00:50
      231000 -- [-774.513] (-775.309) (-775.781) (-774.344) * (-773.533) (-778.115) [-777.770] (-774.989) -- 0:00:49
      231500 -- (-773.795) (-776.885) (-775.876) [-776.660] * [-774.544] (-772.463) (-775.912) (-779.471) -- 0:00:49
      232000 -- (-772.914) [-778.873] (-778.754) (-776.716) * (-775.575) [-775.802] (-775.177) (-775.495) -- 0:00:49
      232500 -- (-777.143) (-779.861) [-774.663] (-775.620) * (-774.747) [-776.765] (-776.694) (-775.839) -- 0:00:49
      233000 -- [-773.487] (-776.315) (-777.339) (-776.335) * (-775.472) (-772.814) [-776.686] (-777.475) -- 0:00:49
      233500 -- (-776.526) (-775.779) (-777.276) [-776.346] * [-776.912] (-781.240) (-775.632) (-775.711) -- 0:00:52
      234000 -- (-776.885) (-776.187) [-776.299] (-774.871) * [-774.562] (-781.944) (-775.057) (-777.897) -- 0:00:52
      234500 -- [-774.788] (-777.479) (-777.662) (-776.084) * [-779.475] (-776.539) (-774.940) (-776.999) -- 0:00:52
      235000 -- (-773.310) (-776.043) [-777.440] (-775.280) * [-777.509] (-777.185) (-775.973) (-774.532) -- 0:00:52

      Average standard deviation of split frequencies: 0.012931

      235500 -- [-775.551] (-775.922) (-775.477) (-778.280) * (-776.661) [-776.297] (-776.949) (-775.462) -- 0:00:51
      236000 -- (-776.684) [-775.722] (-775.712) (-774.910) * (-775.849) [-774.356] (-776.235) (-778.345) -- 0:00:51
      236500 -- [-773.530] (-775.463) (-773.906) (-776.473) * [-775.180] (-775.305) (-774.341) (-778.740) -- 0:00:51
      237000 -- (-776.912) [-775.434] (-778.280) (-777.113) * (-774.900) (-774.621) (-774.128) [-774.887] -- 0:00:51
      237500 -- (-775.755) [-774.301] (-776.293) (-775.121) * (-776.996) (-775.321) [-773.094] (-775.019) -- 0:00:51
      238000 -- (-773.867) (-776.059) [-773.957] (-775.626) * [-773.814] (-776.138) (-774.469) (-779.331) -- 0:00:51
      238500 -- (-776.064) (-773.742) [-776.224] (-776.127) * (-775.502) (-775.224) (-775.930) [-776.401] -- 0:00:51
      239000 -- [-777.660] (-776.851) (-777.689) (-773.725) * (-774.365) (-776.388) [-774.252] (-776.534) -- 0:00:50
      239500 -- (-776.920) [-773.541] (-778.417) (-774.307) * (-775.804) [-777.663] (-774.569) (-775.775) -- 0:00:50
      240000 -- (-775.442) (-777.525) [-774.193] (-775.144) * (-778.061) [-775.134] (-778.095) (-776.865) -- 0:00:50

      Average standard deviation of split frequencies: 0.012577

      240500 -- (-775.522) (-776.386) (-779.721) [-776.300] * (-778.518) (-776.825) (-781.358) [-775.454] -- 0:00:50
      241000 -- (-775.019) (-775.289) (-778.065) [-774.859] * (-777.495) (-773.611) (-775.117) [-775.668] -- 0:00:50
      241500 -- (-775.376) (-775.234) (-774.632) [-772.733] * (-775.580) [-776.309] (-776.843) (-776.404) -- 0:00:50
      242000 -- (-775.425) [-774.256] (-780.891) (-774.895) * (-778.380) (-780.343) [-775.929] (-774.854) -- 0:00:50
      242500 -- (-774.116) [-774.926] (-776.185) (-776.303) * (-774.077) (-780.178) [-772.371] (-778.693) -- 0:00:49
      243000 -- [-776.950] (-775.425) (-777.307) (-777.237) * (-776.652) (-775.486) [-776.926] (-777.787) -- 0:00:49
      243500 -- (-775.724) (-775.515) [-776.184] (-777.723) * (-775.434) [-775.465] (-778.638) (-779.242) -- 0:00:49
      244000 -- (-777.721) (-778.613) (-776.087) [-776.446] * (-775.090) [-776.680] (-775.518) (-780.058) -- 0:00:49
      244500 -- (-775.713) (-777.126) (-775.140) [-778.570] * [-777.569] (-775.607) (-775.971) (-775.555) -- 0:00:49
      245000 -- (-776.617) (-778.432) (-776.453) [-775.819] * [-775.416] (-776.223) (-774.875) (-774.277) -- 0:00:49

      Average standard deviation of split frequencies: 0.011195

      245500 -- (-776.004) (-775.504) [-773.761] (-775.037) * [-776.897] (-774.919) (-779.013) (-781.248) -- 0:00:49
      246000 -- (-775.201) [-774.498] (-776.862) (-780.553) * (-776.043) (-777.864) (-778.050) [-778.004] -- 0:00:49
      246500 -- (-776.655) (-776.387) [-773.930] (-775.507) * [-773.960] (-775.551) (-775.003) (-774.791) -- 0:00:48
      247000 -- (-778.499) [-775.716] (-777.571) (-777.958) * (-775.149) (-776.158) [-777.374] (-776.597) -- 0:00:48
      247500 -- (-777.287) (-778.425) (-778.548) [-777.344] * (-776.001) (-777.655) (-777.056) [-775.988] -- 0:00:48
      248000 -- (-775.322) (-777.450) (-778.686) [-778.818] * (-779.263) (-780.072) [-774.875] (-775.652) -- 0:00:48
      248500 -- (-776.428) (-780.620) (-776.107) [-777.434] * (-773.669) (-781.188) (-778.091) [-775.813] -- 0:00:48
      249000 -- (-776.218) (-779.139) [-776.086] (-777.564) * (-772.740) (-774.501) (-773.744) [-778.648] -- 0:00:51
      249500 -- (-777.338) (-777.805) (-777.943) [-778.767] * [-778.132] (-775.911) (-777.111) (-777.282) -- 0:00:51
      250000 -- [-777.514] (-778.916) (-777.820) (-777.654) * (-776.983) (-774.536) (-778.196) [-775.846] -- 0:00:51

      Average standard deviation of split frequencies: 0.010888

      250500 -- (-780.894) (-775.023) [-778.465] (-776.290) * (-778.459) [-774.774] (-778.302) (-775.096) -- 0:00:50
      251000 -- (-780.749) [-775.155] (-775.641) (-777.044) * (-774.389) (-777.448) (-781.340) [-775.330] -- 0:00:50
      251500 -- (-780.333) [-777.031] (-776.794) (-777.122) * (-775.261) [-776.829] (-778.916) (-778.144) -- 0:00:50
      252000 -- (-776.105) [-776.864] (-780.585) (-775.468) * [-774.078] (-775.191) (-776.133) (-776.808) -- 0:00:50
      252500 -- (-778.883) (-778.398) (-778.295) [-774.934] * (-775.772) [-775.595] (-775.741) (-776.761) -- 0:00:50
      253000 -- (-777.671) [-775.860] (-779.230) (-775.656) * (-776.534) [-773.750] (-776.279) (-777.616) -- 0:00:50
      253500 -- (-776.098) [-775.963] (-777.661) (-775.100) * (-779.221) (-777.591) (-776.647) [-777.176] -- 0:00:50
      254000 -- [-777.573] (-776.558) (-775.041) (-776.584) * (-779.544) [-773.907] (-776.767) (-775.561) -- 0:00:49
      254500 -- [-773.442] (-775.369) (-776.779) (-780.367) * (-779.838) [-775.189] (-775.233) (-779.979) -- 0:00:49
      255000 -- (-777.960) (-776.158) (-776.698) [-775.572] * (-775.157) (-780.698) [-774.695] (-777.651) -- 0:00:49

      Average standard deviation of split frequencies: 0.011049

      255500 -- [-777.023] (-777.956) (-778.116) (-780.274) * [-775.293] (-776.696) (-774.991) (-775.868) -- 0:00:49
      256000 -- (-777.292) (-779.593) [-772.834] (-776.443) * [-772.907] (-775.362) (-774.789) (-776.197) -- 0:00:49
      256500 -- (-778.273) [-774.430] (-776.300) (-777.405) * (-775.605) (-780.919) [-776.981] (-775.434) -- 0:00:49
      257000 -- (-775.504) (-775.677) (-780.567) [-778.219] * (-776.800) (-777.354) (-775.545) [-775.978] -- 0:00:49
      257500 -- [-776.755] (-778.893) (-780.283) (-777.303) * (-775.054) (-776.081) [-776.312] (-774.900) -- 0:00:49
      258000 -- (-776.158) (-778.506) [-775.735] (-775.493) * (-775.332) (-776.465) [-777.474] (-776.242) -- 0:00:48
      258500 -- (-778.835) (-776.717) [-777.616] (-777.823) * (-775.096) (-773.231) (-776.715) [-775.490] -- 0:00:48
      259000 -- (-779.845) (-776.179) [-775.267] (-778.339) * [-776.195] (-774.972) (-774.099) (-776.531) -- 0:00:48
      259500 -- (-773.198) [-776.579] (-777.844) (-778.671) * (-776.224) (-776.511) (-775.971) [-774.527] -- 0:00:48
      260000 -- (-776.114) [-776.014] (-774.944) (-775.070) * (-774.887) (-778.270) [-776.632] (-775.250) -- 0:00:48

      Average standard deviation of split frequencies: 0.011612

      260500 -- (-775.762) (-775.190) (-775.052) [-776.981] * [-775.632] (-776.556) (-779.652) (-779.795) -- 0:00:48
      261000 -- (-774.683) (-780.606) (-775.500) [-777.729] * [-776.922] (-777.682) (-775.049) (-777.598) -- 0:00:48
      261500 -- (-774.545) [-776.282] (-775.422) (-775.021) * (-776.540) [-774.947] (-778.643) (-774.429) -- 0:00:48
      262000 -- (-776.176) (-777.631) [-774.848] (-775.935) * (-775.550) (-774.827) (-777.964) [-779.143] -- 0:00:47
      262500 -- (-775.881) [-779.564] (-775.500) (-778.411) * (-775.807) [-776.130] (-779.809) (-774.755) -- 0:00:50
      263000 -- (-776.087) (-775.302) [-776.428] (-774.316) * (-775.733) [-773.728] (-778.941) (-779.295) -- 0:00:50
      263500 -- [-777.045] (-777.159) (-775.722) (-776.314) * (-774.946) [-775.516] (-773.921) (-781.299) -- 0:00:50
      264000 -- [-776.780] (-778.721) (-778.315) (-777.227) * (-775.027) (-775.556) [-775.561] (-778.212) -- 0:00:50
      264500 -- (-777.977) [-778.292] (-777.323) (-775.699) * (-774.470) (-775.476) (-776.384) [-778.571] -- 0:00:50
      265000 -- (-774.922) [-774.614] (-777.763) (-774.460) * (-776.871) (-777.534) [-777.355] (-780.979) -- 0:00:49

      Average standard deviation of split frequencies: 0.012219

      265500 -- (-776.119) [-772.656] (-772.548) (-773.866) * (-774.774) [-777.328] (-780.028) (-775.057) -- 0:00:49
      266000 -- (-776.062) [-774.814] (-775.315) (-777.745) * (-776.043) (-776.581) (-776.683) [-779.095] -- 0:00:49
      266500 -- (-776.677) (-775.193) [-774.839] (-779.021) * (-775.989) (-774.919) (-774.699) [-779.763] -- 0:00:49
      267000 -- (-777.257) (-775.923) [-777.442] (-776.893) * [-775.938] (-776.840) (-777.922) (-775.018) -- 0:00:49
      267500 -- (-776.695) (-778.383) (-777.532) [-776.620] * (-775.239) (-778.180) [-773.010] (-774.808) -- 0:00:49
      268000 -- (-774.658) (-778.554) (-775.311) [-773.299] * (-776.100) (-780.687) (-775.671) [-783.262] -- 0:00:49
      268500 -- (-777.306) (-778.748) [-780.880] (-774.841) * (-775.575) (-778.615) (-777.401) [-777.014] -- 0:00:49
      269000 -- (-777.153) [-777.031] (-776.331) (-776.098) * [-774.824] (-779.992) (-774.447) (-776.713) -- 0:00:48
      269500 -- [-777.833] (-781.534) (-777.489) (-775.716) * (-775.081) [-774.279] (-779.567) (-776.013) -- 0:00:48
      270000 -- (-776.359) [-774.315] (-776.048) (-775.615) * (-776.113) (-776.317) (-776.441) [-774.541] -- 0:00:48

      Average standard deviation of split frequencies: 0.011092

      270500 -- (-777.062) (-772.391) [-778.316] (-777.177) * (-777.659) (-776.422) (-775.289) [-774.226] -- 0:00:48
      271000 -- [-774.766] (-778.323) (-776.982) (-774.785) * [-775.681] (-776.082) (-774.615) (-775.307) -- 0:00:48
      271500 -- (-773.828) (-775.775) (-778.617) [-778.846] * (-778.566) (-779.737) [-775.925] (-776.395) -- 0:00:48
      272000 -- (-774.390) (-776.817) (-777.483) [-775.595] * (-777.287) [-775.573] (-776.403) (-776.941) -- 0:00:48
      272500 -- (-778.627) (-780.404) (-776.253) [-775.415] * (-777.251) [-777.198] (-775.134) (-780.311) -- 0:00:48
      273000 -- [-772.541] (-779.797) (-776.765) (-774.748) * (-778.978) (-777.558) (-776.151) [-776.833] -- 0:00:47
      273500 -- [-772.458] (-774.741) (-776.046) (-776.510) * (-779.758) (-776.154) [-777.028] (-779.264) -- 0:00:47
      274000 -- (-773.218) (-776.374) [-775.080] (-776.499) * [-779.110] (-775.954) (-776.804) (-776.476) -- 0:00:50
      274500 -- (-782.589) (-777.669) [-775.337] (-779.319) * (-775.559) [-776.342] (-781.494) (-774.668) -- 0:00:50
      275000 -- (-776.289) (-775.888) [-774.570] (-777.158) * (-776.519) [-775.424] (-776.987) (-775.558) -- 0:00:50

      Average standard deviation of split frequencies: 0.011686

      275500 -- (-775.758) [-774.950] (-774.210) (-775.515) * [-775.638] (-775.527) (-777.475) (-775.523) -- 0:00:49
      276000 -- (-775.386) (-776.604) (-777.094) [-775.276] * [-775.894] (-775.605) (-774.270) (-777.938) -- 0:00:49
      276500 -- (-778.149) [-774.766] (-776.910) (-777.157) * (-776.175) [-775.807] (-777.151) (-781.045) -- 0:00:49
      277000 -- (-777.984) (-774.875) (-776.787) [-775.076] * (-777.246) (-777.421) [-776.232] (-779.611) -- 0:00:49
      277500 -- [-775.968] (-772.331) (-773.819) (-775.656) * (-776.122) (-777.909) [-774.393] (-775.459) -- 0:00:49
      278000 -- [-775.990] (-776.149) (-774.189) (-774.942) * (-775.459) (-774.799) [-778.490] (-776.195) -- 0:00:49
      278500 -- [-772.343] (-774.428) (-780.063) (-775.537) * (-778.311) (-777.363) [-776.118] (-775.262) -- 0:00:49
      279000 -- (-773.584) (-775.375) [-779.499] (-774.855) * (-775.046) (-777.111) [-776.329] (-775.286) -- 0:00:49
      279500 -- (-772.810) (-776.086) (-778.979) [-776.249] * [-776.969] (-778.018) (-776.131) (-775.389) -- 0:00:48
      280000 -- (-779.531) (-776.903) [-775.607] (-776.189) * (-778.831) (-780.271) (-778.382) [-775.725] -- 0:00:48

      Average standard deviation of split frequencies: 0.012553

      280500 -- (-774.204) (-776.626) [-776.219] (-777.202) * (-775.440) (-779.178) (-776.339) [-776.003] -- 0:00:48
      281000 -- (-775.322) (-774.167) (-772.658) [-775.178] * [-777.604] (-776.797) (-776.530) (-776.855) -- 0:00:48
      281500 -- (-775.788) (-775.980) (-774.882) [-776.891] * (-774.868) [-777.389] (-775.338) (-776.806) -- 0:00:48
      282000 -- (-775.469) (-774.974) (-776.212) [-774.193] * (-778.214) (-777.664) (-774.927) [-776.818] -- 0:00:48
      282500 -- (-781.283) (-776.257) [-773.634] (-775.264) * [-777.651] (-775.430) (-777.297) (-776.373) -- 0:00:48
      283000 -- (-779.804) (-779.514) [-773.593] (-777.349) * (-773.220) [-775.617] (-777.404) (-776.289) -- 0:00:48
      283500 -- (-778.386) (-775.363) (-775.599) [-777.958] * (-779.050) (-778.900) [-775.258] (-775.107) -- 0:00:48
      284000 -- (-775.708) (-776.372) (-777.451) [-776.943] * (-778.424) (-778.677) [-775.721] (-775.698) -- 0:00:47
      284500 -- [-774.993] (-774.918) (-774.583) (-775.801) * [-774.472] (-780.039) (-775.175) (-780.506) -- 0:00:47
      285000 -- (-775.665) [-774.749] (-775.225) (-776.838) * (-776.447) (-775.138) [-779.854] (-777.409) -- 0:00:47

      Average standard deviation of split frequencies: 0.013620

      285500 -- (-776.331) (-779.052) [-776.127] (-776.478) * (-778.241) (-777.741) (-777.762) [-777.911] -- 0:00:47
      286000 -- (-777.049) [-780.286] (-776.884) (-776.897) * (-775.603) [-775.992] (-775.747) (-776.418) -- 0:00:47
      286500 -- (-774.044) [-780.434] (-773.953) (-779.158) * (-776.098) (-777.746) (-775.089) [-778.105] -- 0:00:47
      287000 -- [-775.674] (-774.603) (-775.149) (-776.089) * (-778.096) (-776.410) [-775.222] (-777.543) -- 0:00:47
      287500 -- (-776.657) (-776.296) [-774.676] (-777.812) * [-775.527] (-779.287) (-775.020) (-777.861) -- 0:00:49
      288000 -- (-776.276) [-773.627] (-775.400) (-781.562) * [-778.527] (-775.707) (-774.921) (-777.495) -- 0:00:49
      288500 -- [-774.251] (-775.134) (-776.586) (-777.745) * (-776.990) (-775.607) (-775.660) [-777.670] -- 0:00:49
      289000 -- (-775.608) [-777.453] (-773.052) (-775.857) * (-776.412) (-780.014) (-778.280) [-775.148] -- 0:00:49
      289500 -- (-774.888) (-773.129) (-774.629) [-777.170] * (-775.543) (-777.855) (-775.506) [-775.118] -- 0:00:49
      290000 -- (-775.921) (-773.582) [-775.057] (-777.864) * (-777.178) (-778.381) (-780.379) [-777.720] -- 0:00:48

      Average standard deviation of split frequencies: 0.013231

      290500 -- (-776.633) (-776.316) [-774.618] (-776.302) * (-774.947) [-775.545] (-777.813) (-776.152) -- 0:00:48
      291000 -- (-780.052) [-774.912] (-775.069) (-776.204) * (-775.460) (-776.266) (-779.122) [-778.106] -- 0:00:48
      291500 -- (-777.756) (-778.369) (-776.149) [-777.389] * (-776.718) [-777.136] (-775.464) (-777.399) -- 0:00:48
      292000 -- (-778.025) (-777.479) [-773.686] (-776.464) * (-777.545) (-776.867) (-775.395) [-776.896] -- 0:00:48
      292500 -- (-780.238) (-774.840) [-776.014] (-777.153) * (-777.609) [-773.714] (-775.160) (-775.416) -- 0:00:48
      293000 -- (-779.775) [-775.279] (-779.251) (-779.880) * (-776.215) [-777.361] (-775.686) (-776.817) -- 0:00:48
      293500 -- (-776.416) (-774.998) (-776.266) [-775.873] * (-776.210) (-778.863) [-773.906] (-775.358) -- 0:00:48
      294000 -- (-776.719) (-774.774) [-775.386] (-776.050) * (-776.164) (-780.363) (-776.175) [-775.810] -- 0:00:48
      294500 -- (-779.592) (-775.225) (-777.773) [-776.028] * [-775.580] (-777.329) (-777.054) (-775.669) -- 0:00:47
      295000 -- (-776.850) (-772.726) [-777.665] (-775.259) * (-778.143) (-777.573) [-775.403] (-776.222) -- 0:00:47

      Average standard deviation of split frequencies: 0.014156

      295500 -- [-773.974] (-773.598) (-775.089) (-776.905) * [-778.747] (-775.976) (-774.857) (-775.792) -- 0:00:47
      296000 -- (-774.318) [-775.221] (-777.632) (-776.271) * [-775.659] (-774.891) (-778.965) (-779.479) -- 0:00:47
      296500 -- [-778.919] (-778.713) (-775.542) (-775.805) * (-779.390) (-776.486) (-777.151) [-776.618] -- 0:00:47
      297000 -- (-780.078) (-776.973) [-777.372] (-774.954) * [-776.070] (-780.409) (-776.539) (-774.882) -- 0:00:47
      297500 -- (-776.212) (-776.039) [-776.135] (-777.918) * (-776.167) (-779.439) (-775.973) [-776.194] -- 0:00:47
      298000 -- (-776.753) [-775.946] (-778.159) (-775.078) * (-779.501) (-778.174) (-776.238) [-776.145] -- 0:00:47
      298500 -- (-777.399) (-774.446) [-775.214] (-774.981) * [-777.288] (-775.184) (-780.576) (-774.251) -- 0:00:47
      299000 -- (-778.782) (-777.937) (-779.542) [-776.404] * (-778.230) (-774.848) (-780.193) [-776.065] -- 0:00:46
      299500 -- (-774.032) [-773.356] (-777.032) (-776.536) * (-780.563) [-776.389] (-778.052) (-777.148) -- 0:00:46
      300000 -- (-776.128) (-775.606) (-777.430) [-777.062] * (-775.537) [-777.268] (-779.708) (-776.950) -- 0:00:46

      Average standard deviation of split frequencies: 0.014111

      300500 -- (-775.832) (-777.206) (-780.737) [-776.408] * (-776.007) [-775.497] (-775.671) (-780.230) -- 0:00:46
      301000 -- (-777.410) (-772.091) (-778.302) [-774.324] * (-776.874) (-777.626) (-775.036) [-775.776] -- 0:00:46
      301500 -- (-775.531) (-775.781) (-778.855) [-777.740] * (-775.846) [-774.115] (-774.822) (-775.659) -- 0:00:46
      302000 -- (-776.164) (-773.663) [-775.986] (-776.787) * (-776.271) (-775.540) (-774.997) [-773.433] -- 0:00:46
      302500 -- (-778.154) (-773.851) [-775.490] (-774.054) * (-776.325) (-777.038) (-776.499) [-777.304] -- 0:00:48
      303000 -- (-776.901) (-775.067) (-775.029) [-774.117] * (-776.603) (-776.077) [-775.648] (-776.600) -- 0:00:48
      303500 -- (-778.505) [-777.367] (-775.483) (-775.468) * (-776.426) (-777.185) [-775.016] (-775.164) -- 0:00:48
      304000 -- [-777.261] (-777.561) (-778.012) (-775.993) * (-775.682) (-776.865) [-776.369] (-775.281) -- 0:00:48
      304500 -- [-774.589] (-773.363) (-776.708) (-776.596) * (-775.127) (-777.594) (-775.893) [-775.278] -- 0:00:47
      305000 -- (-776.063) [-773.482] (-777.190) (-776.095) * [-776.920] (-776.341) (-783.991) (-773.921) -- 0:00:47

      Average standard deviation of split frequencies: 0.012162

      305500 -- (-777.376) (-778.078) (-774.758) [-775.370] * (-775.244) (-774.437) (-783.627) [-778.903] -- 0:00:47
      306000 -- (-772.451) (-777.987) [-775.916] (-778.099) * (-775.513) [-776.919] (-783.561) (-774.756) -- 0:00:47
      306500 -- [-775.705] (-775.958) (-777.786) (-776.053) * (-777.451) (-776.600) (-779.615) [-776.287] -- 0:00:47
      307000 -- (-776.315) [-774.653] (-778.338) (-777.083) * (-776.733) (-775.099) [-776.501] (-777.208) -- 0:00:47
      307500 -- (-777.560) [-779.465] (-776.635) (-785.636) * (-774.722) (-776.739) [-777.219] (-778.308) -- 0:00:47
      308000 -- (-776.255) [-775.140] (-778.150) (-777.022) * [-775.516] (-780.168) (-773.535) (-779.426) -- 0:00:47
      308500 -- [-778.013] (-776.268) (-778.140) (-776.773) * (-776.574) (-779.881) (-775.458) [-774.951] -- 0:00:47
      309000 -- (-776.583) (-776.023) (-775.676) [-775.005] * [-775.023] (-778.139) (-779.464) (-776.632) -- 0:00:46
      309500 -- (-774.795) (-775.641) (-773.853) [-775.979] * [-776.572] (-776.787) (-775.859) (-781.138) -- 0:00:46
      310000 -- (-777.641) [-775.986] (-775.898) (-776.132) * (-777.286) (-775.804) [-776.728] (-776.315) -- 0:00:46

      Average standard deviation of split frequencies: 0.013657

      310500 -- (-776.416) [-774.372] (-779.139) (-780.058) * (-776.864) (-776.633) [-772.520] (-776.630) -- 0:00:46
      311000 -- (-774.263) (-774.915) [-775.604] (-775.882) * (-774.051) (-773.980) (-776.200) [-776.252] -- 0:00:46
      311500 -- (-776.743) (-776.696) (-779.382) [-775.228] * (-775.127) [-776.783] (-775.300) (-776.425) -- 0:00:46
      312000 -- (-783.767) (-774.638) (-776.823) [-774.066] * (-776.794) [-775.067] (-775.152) (-774.944) -- 0:00:46
      312500 -- (-777.547) (-774.053) [-776.552] (-776.995) * (-779.516) [-776.408] (-776.793) (-773.059) -- 0:00:46
      313000 -- (-779.338) [-775.965] (-776.202) (-777.365) * [-776.333] (-774.681) (-777.799) (-773.260) -- 0:00:46
      313500 -- (-779.644) (-778.512) [-775.948] (-774.941) * [-775.170] (-775.638) (-778.099) (-774.976) -- 0:00:45
      314000 -- (-780.428) (-776.205) [-776.040] (-776.534) * (-780.306) (-775.711) (-777.242) [-777.177] -- 0:00:45
      314500 -- (-776.540) [-773.659] (-777.015) (-774.006) * (-780.517) (-774.948) [-773.896] (-779.121) -- 0:00:45
      315000 -- (-776.250) (-774.800) [-779.025] (-775.438) * (-777.186) (-775.133) [-776.133] (-780.828) -- 0:00:45

      Average standard deviation of split frequencies: 0.013675

      315500 -- (-775.891) [-775.747] (-783.607) (-775.692) * (-773.985) [-774.418] (-778.271) (-774.536) -- 0:00:45
      316000 -- (-778.245) (-777.802) (-780.588) [-776.047] * (-781.026) [-776.039] (-776.304) (-780.442) -- 0:00:45
      316500 -- (-775.986) (-778.304) [-775.583] (-776.192) * (-772.829) [-774.935] (-778.364) (-776.866) -- 0:00:45
      317000 -- [-776.124] (-775.219) (-776.140) (-787.088) * [-778.148] (-773.399) (-777.416) (-780.387) -- 0:00:45
      317500 -- (-776.334) [-776.476] (-776.851) (-774.660) * (-779.889) [-776.848] (-779.000) (-777.614) -- 0:00:45
      318000 -- (-776.510) [-775.682] (-776.217) (-779.158) * (-774.817) (-780.110) (-775.115) [-772.692] -- 0:00:45
      318500 -- (-775.984) [-776.810] (-777.617) (-783.137) * (-774.951) (-778.666) [-777.689] (-773.246) -- 0:00:47
      319000 -- (-775.771) [-775.175] (-776.941) (-777.906) * [-775.622] (-784.219) (-777.140) (-773.771) -- 0:00:46
      319500 -- (-776.619) [-776.429] (-776.936) (-777.194) * (-773.799) (-783.648) (-775.914) [-775.662] -- 0:00:46
      320000 -- (-776.379) [-776.175] (-775.412) (-780.839) * (-776.093) (-783.479) (-776.575) [-776.453] -- 0:00:46

      Average standard deviation of split frequencies: 0.013639

      320500 -- (-777.065) [-778.694] (-776.154) (-777.590) * (-775.552) (-785.455) (-775.747) [-773.296] -- 0:00:46
      321000 -- [-775.638] (-775.554) (-775.635) (-779.461) * (-776.223) [-775.539] (-771.574) (-775.944) -- 0:00:46
      321500 -- [-776.127] (-775.208) (-777.857) (-778.699) * [-775.219] (-775.369) (-776.568) (-776.204) -- 0:00:46
      322000 -- [-773.125] (-776.139) (-775.848) (-773.917) * (-775.269) (-775.508) (-775.649) [-773.718] -- 0:00:46
      322500 -- (-775.335) [-777.287] (-778.025) (-776.799) * [-775.573] (-777.316) (-776.730) (-774.379) -- 0:00:46
      323000 -- (-774.815) (-777.036) (-775.895) [-775.625] * [-777.216] (-776.897) (-775.378) (-773.020) -- 0:00:46
      323500 -- (-775.902) (-776.601) (-775.173) [-774.004] * (-777.057) (-774.349) (-775.263) [-774.768] -- 0:00:46
      324000 -- (-777.524) [-775.076] (-775.326) (-774.547) * [-778.968] (-775.141) (-776.233) (-774.471) -- 0:00:45
      324500 -- (-777.191) [-775.325] (-777.699) (-776.884) * (-776.260) [-776.523] (-776.199) (-773.571) -- 0:00:45
      325000 -- (-775.853) [-775.871] (-779.224) (-778.473) * (-774.844) (-777.664) (-777.281) [-776.067] -- 0:00:45

      Average standard deviation of split frequencies: 0.014219

      325500 -- (-776.750) [-778.800] (-775.735) (-776.022) * (-776.530) [-775.970] (-772.759) (-775.712) -- 0:00:45
      326000 -- (-775.489) [-776.159] (-778.152) (-779.365) * [-779.978] (-774.560) (-773.899) (-774.026) -- 0:00:45
      326500 -- (-777.235) (-778.079) [-776.786] (-775.700) * (-779.506) [-775.958] (-778.162) (-776.518) -- 0:00:45
      327000 -- (-779.604) (-778.360) (-780.381) [-776.090] * (-774.861) [-777.357] (-776.466) (-776.052) -- 0:00:45
      327500 -- (-775.083) (-775.241) [-776.247] (-777.094) * (-778.951) [-776.585] (-775.097) (-772.972) -- 0:00:45
      328000 -- (-777.803) (-776.018) (-776.201) [-775.893] * (-775.205) (-776.605) [-774.444] (-773.404) -- 0:00:45
      328500 -- (-775.555) [-775.316] (-776.863) (-775.825) * [-775.739] (-776.239) (-773.889) (-774.232) -- 0:00:44
      329000 -- (-775.282) [-777.941] (-777.038) (-778.116) * [-777.168] (-774.147) (-774.183) (-775.877) -- 0:00:44
      329500 -- (-775.863) (-776.566) (-775.989) [-777.248] * (-773.728) [-776.852] (-774.004) (-776.775) -- 0:00:44
      330000 -- [-774.255] (-775.549) (-777.774) (-776.145) * [-777.076] (-775.900) (-775.618) (-774.347) -- 0:00:44

      Average standard deviation of split frequencies: 0.014177

      330500 -- [-778.768] (-777.916) (-775.213) (-775.473) * (-775.080) [-779.936] (-775.029) (-775.218) -- 0:00:44
      331000 -- [-775.349] (-777.128) (-774.955) (-775.374) * (-779.946) (-776.994) [-774.628] (-774.659) -- 0:00:44
      331500 -- (-777.656) [-775.502] (-775.399) (-775.316) * (-774.678) (-777.256) [-774.849] (-775.560) -- 0:00:46
      332000 -- (-779.006) [-775.016] (-774.947) (-777.432) * [-775.152] (-778.219) (-772.216) (-785.069) -- 0:00:46
      332500 -- (-777.695) (-774.686) (-778.231) [-776.857] * (-775.093) [-775.863] (-773.272) (-782.088) -- 0:00:46
      333000 -- (-774.080) (-775.044) [-776.773] (-779.812) * [-773.876] (-776.967) (-773.137) (-777.726) -- 0:00:46
      333500 -- [-776.172] (-774.926) (-774.395) (-776.474) * (-776.374) (-774.703) [-775.891] (-778.222) -- 0:00:45
      334000 -- [-777.036] (-775.623) (-777.154) (-780.154) * [-774.768] (-775.402) (-776.425) (-777.082) -- 0:00:45
      334500 -- [-776.341] (-774.535) (-775.776) (-776.394) * (-773.730) [-773.371] (-777.235) (-776.621) -- 0:00:45
      335000 -- (-777.525) (-776.595) (-775.554) [-777.913] * (-776.557) (-775.181) [-777.303] (-775.652) -- 0:00:45

      Average standard deviation of split frequencies: 0.014965

      335500 -- (-775.534) (-775.626) (-778.649) [-774.022] * (-778.245) [-775.328] (-774.736) (-775.257) -- 0:00:45
      336000 -- (-775.979) (-776.017) (-777.089) [-775.414] * [-775.411] (-781.392) (-775.664) (-774.490) -- 0:00:45
      336500 -- (-781.820) [-774.784] (-780.464) (-776.466) * (-776.913) (-775.929) [-775.751] (-780.484) -- 0:00:45
      337000 -- (-775.564) (-778.934) (-776.352) [-776.477] * (-776.434) (-778.579) [-772.912] (-775.413) -- 0:00:45
      337500 -- (-775.172) [-775.954] (-775.260) (-776.157) * [-778.629] (-778.028) (-775.167) (-774.248) -- 0:00:45
      338000 -- (-776.894) [-775.194] (-775.771) (-772.541) * (-781.460) [-778.173] (-775.655) (-777.264) -- 0:00:45
      338500 -- (-779.366) [-775.227] (-777.282) (-777.115) * (-779.230) (-777.688) (-773.853) [-778.364] -- 0:00:44
      339000 -- (-775.856) (-775.249) (-780.883) [-775.351] * (-775.518) (-777.678) [-774.280] (-777.959) -- 0:00:44
      339500 -- (-777.236) (-776.883) [-774.119] (-778.212) * (-773.166) (-777.721) (-777.633) [-776.336] -- 0:00:44
      340000 -- (-772.880) (-775.418) [-773.210] (-775.081) * (-774.339) [-775.332] (-777.810) (-775.471) -- 0:00:44

      Average standard deviation of split frequencies: 0.015452

      340500 -- [-774.083] (-774.846) (-774.376) (-774.997) * (-775.056) [-776.012] (-776.167) (-775.705) -- 0:00:44
      341000 -- [-780.825] (-775.280) (-775.866) (-776.325) * (-776.377) (-775.207) [-776.529] (-780.692) -- 0:00:44
      341500 -- (-776.561) (-777.298) (-778.512) [-773.977] * (-775.771) (-779.802) (-773.485) [-774.926] -- 0:00:44
      342000 -- (-776.219) (-778.902) [-774.737] (-775.762) * (-775.928) (-776.189) [-775.855] (-772.810) -- 0:00:44
      342500 -- (-775.804) (-776.758) [-774.377] (-777.429) * [-773.645] (-777.783) (-776.344) (-776.476) -- 0:00:44
      343000 -- (-775.221) (-777.901) [-778.090] (-777.591) * [-775.683] (-780.969) (-780.720) (-775.633) -- 0:00:44
      343500 -- (-779.338) (-777.149) [-776.594] (-777.561) * (-774.253) (-777.615) (-778.899) [-774.307] -- 0:00:43
      344000 -- (-775.950) [-774.823] (-776.415) (-779.112) * [-774.001] (-776.336) (-776.385) (-775.023) -- 0:00:43
      344500 -- (-776.198) [-777.348] (-779.286) (-776.172) * (-775.994) [-776.434] (-775.423) (-779.504) -- 0:00:43
      345000 -- (-775.512) (-775.916) [-775.279] (-779.861) * (-778.904) (-777.775) [-775.857] (-775.688) -- 0:00:43

      Average standard deviation of split frequencies: 0.014987

      345500 -- (-778.737) (-775.137) [-775.403] (-776.251) * (-774.743) (-776.696) (-775.718) [-776.122] -- 0:00:43
      346000 -- (-777.170) [-775.848] (-775.281) (-774.569) * (-775.689) (-774.189) [-776.270] (-776.013) -- 0:00:43
      346500 -- (-776.513) (-775.107) (-779.741) [-772.360] * (-772.753) [-776.476] (-775.238) (-780.772) -- 0:00:43
      347000 -- (-776.487) (-775.959) (-775.951) [-774.610] * (-775.007) (-779.212) [-777.668] (-778.804) -- 0:00:43
      347500 -- (-777.042) (-778.956) [-774.609] (-775.422) * [-775.997] (-776.890) (-778.337) (-778.823) -- 0:00:45
      348000 -- (-776.255) [-775.308] (-775.470) (-777.834) * (-779.508) [-774.732] (-775.941) (-774.582) -- 0:00:44
      348500 -- (-778.512) (-774.337) (-775.323) [-774.337] * [-773.830] (-775.978) (-777.156) (-774.660) -- 0:00:44
      349000 -- (-778.840) [-774.311] (-775.368) (-777.076) * (-772.360) (-779.572) (-774.951) [-775.160] -- 0:00:44
      349500 -- [-776.951] (-778.309) (-774.671) (-775.218) * (-772.412) (-776.719) [-775.577] (-774.334) -- 0:00:44
      350000 -- [-774.949] (-777.908) (-776.623) (-777.502) * (-776.298) [-776.445] (-775.090) (-776.513) -- 0:00:44

      Average standard deviation of split frequencies: 0.014787

      350500 -- (-776.930) [-775.141] (-775.055) (-774.855) * (-776.527) (-775.583) [-775.445] (-776.185) -- 0:00:44
      351000 -- (-775.385) [-774.769] (-773.846) (-779.285) * (-774.995) (-774.232) (-775.837) [-775.599] -- 0:00:44
      351500 -- (-776.213) (-776.147) [-772.979] (-777.208) * (-773.595) [-775.592] (-775.154) (-776.617) -- 0:00:44
      352000 -- (-783.650) [-776.237] (-774.848) (-774.452) * [-773.449] (-774.576) (-776.172) (-775.240) -- 0:00:44
      352500 -- (-777.317) (-777.714) [-775.885] (-775.424) * (-778.885) (-774.369) (-775.901) [-775.877] -- 0:00:44
      353000 -- (-778.867) [-776.464] (-774.901) (-775.040) * (-778.063) (-772.752) [-775.764] (-775.718) -- 0:00:43
      353500 -- (-775.830) [-774.617] (-777.206) (-775.218) * [-775.773] (-777.992) (-776.116) (-779.657) -- 0:00:43
      354000 -- (-782.420) (-775.132) [-775.088] (-780.424) * (-776.561) (-773.554) [-780.560] (-772.411) -- 0:00:43
      354500 -- (-779.217) (-775.970) [-773.771] (-774.878) * (-775.531) (-775.188) (-771.364) [-779.756] -- 0:00:43
      355000 -- (-777.354) (-777.017) [-775.522] (-776.872) * [-775.146] (-775.609) (-773.890) (-776.004) -- 0:00:43

      Average standard deviation of split frequencies: 0.015007

      355500 -- (-778.242) (-775.574) (-778.175) [-774.470] * (-776.449) (-779.700) (-776.062) [-775.168] -- 0:00:43
      356000 -- (-776.434) (-778.761) [-774.779] (-775.892) * (-778.608) (-774.014) (-782.793) [-772.744] -- 0:00:43
      356500 -- (-775.925) (-777.666) [-774.211] (-779.909) * (-778.034) (-776.374) [-779.548] (-777.421) -- 0:00:43
      357000 -- [-777.742] (-775.447) (-778.545) (-781.205) * [-775.784] (-774.647) (-774.341) (-775.584) -- 0:00:43
      357500 -- [-775.635] (-779.553) (-775.284) (-776.552) * [-772.948] (-775.912) (-776.157) (-777.286) -- 0:00:43
      358000 -- (-776.531) (-774.095) [-778.020] (-776.496) * (-775.560) (-773.624) (-778.128) [-777.129] -- 0:00:43
      358500 -- (-774.977) (-777.377) [-775.555] (-775.657) * (-776.311) (-776.602) [-776.009] (-775.842) -- 0:00:42
      359000 -- (-775.108) (-778.225) (-776.047) [-775.176] * (-776.212) [-779.174] (-778.761) (-773.199) -- 0:00:42
      359500 -- (-774.670) (-777.529) [-777.123] (-776.498) * [-775.133] (-775.197) (-779.124) (-775.057) -- 0:00:42
      360000 -- (-774.383) (-775.493) [-775.330] (-776.199) * (-773.697) (-775.054) [-775.672] (-775.333) -- 0:00:42

      Average standard deviation of split frequencies: 0.014958

      360500 -- (-776.566) [-775.414] (-774.089) (-775.731) * (-778.673) (-772.668) [-775.415] (-778.443) -- 0:00:42
      361000 -- (-779.198) (-777.140) [-775.097] (-775.418) * [-778.338] (-773.759) (-776.219) (-777.258) -- 0:00:42
      361500 -- (-781.086) [-778.458] (-777.371) (-777.671) * (-784.695) [-771.862] (-776.416) (-779.984) -- 0:00:42
      362000 -- (-779.186) (-776.875) (-774.508) [-775.995] * (-778.352) [-775.293] (-779.394) (-777.330) -- 0:00:42
      362500 -- (-776.853) [-777.376] (-773.244) (-775.406) * (-775.949) [-777.400] (-777.525) (-777.290) -- 0:00:42
      363000 -- [-775.574] (-775.534) (-777.489) (-774.687) * (-778.972) [-774.220] (-774.516) (-776.715) -- 0:00:43
      363500 -- (-777.198) (-776.564) [-775.732] (-776.070) * (-776.593) (-780.294) [-775.346] (-780.854) -- 0:00:43
      364000 -- (-775.956) (-777.671) [-779.472] (-779.548) * [-775.966] (-775.101) (-777.063) (-780.361) -- 0:00:43
      364500 -- (-777.657) (-780.933) (-779.235) [-773.656] * (-776.249) (-778.261) [-776.464] (-776.123) -- 0:00:43
      365000 -- (-774.797) (-777.184) [-777.639] (-776.789) * (-774.364) [-774.553] (-773.443) (-777.236) -- 0:00:43

      Average standard deviation of split frequencies: 0.014740

      365500 -- (-775.649) (-778.146) (-780.150) [-773.593] * [-773.639] (-775.805) (-776.885) (-776.455) -- 0:00:43
      366000 -- (-776.477) [-776.735] (-773.896) (-781.612) * [-774.023] (-776.620) (-778.109) (-777.493) -- 0:00:43
      366500 -- (-780.366) (-777.194) (-777.946) [-780.708] * (-774.608) (-777.408) [-777.371] (-776.079) -- 0:00:43
      367000 -- (-780.429) (-777.376) [-775.429] (-776.575) * (-775.550) (-778.305) (-774.574) [-777.767] -- 0:00:43
      367500 -- (-778.136) (-774.465) [-775.554] (-780.059) * (-775.465) (-777.191) (-777.406) [-778.210] -- 0:00:43
      368000 -- (-778.134) [-774.218] (-774.398) (-778.531) * (-775.855) (-777.689) (-776.020) [-776.138] -- 0:00:42
      368500 -- (-775.281) (-776.671) (-776.742) [-777.435] * (-774.862) (-776.271) (-777.514) [-775.277] -- 0:00:42
      369000 -- (-777.247) (-780.091) [-777.816] (-778.152) * (-775.541) (-776.136) (-776.408) [-774.808] -- 0:00:42
      369500 -- (-777.746) (-782.583) [-775.545] (-774.045) * [-778.449] (-776.235) (-775.804) (-774.791) -- 0:00:42
      370000 -- [-773.944] (-774.991) (-775.139) (-778.210) * (-776.619) (-778.721) (-776.325) [-774.812] -- 0:00:42

      Average standard deviation of split frequencies: 0.014696

      370500 -- [-773.797] (-774.853) (-774.663) (-776.901) * (-774.975) (-778.204) (-775.083) [-773.915] -- 0:00:42
      371000 -- [-774.845] (-775.814) (-775.729) (-775.111) * (-776.085) (-779.290) (-778.709) [-775.604] -- 0:00:42
      371500 -- (-776.536) [-774.821] (-774.965) (-777.233) * (-776.064) (-784.017) (-776.973) [-772.566] -- 0:00:42
      372000 -- [-779.820] (-776.481) (-774.715) (-774.321) * (-776.903) (-775.387) (-774.914) [-781.169] -- 0:00:42
      372500 -- (-776.268) (-774.740) (-778.814) [-775.098] * [-774.998] (-774.921) (-777.202) (-780.769) -- 0:00:42
      373000 -- (-782.099) (-772.667) (-776.903) [-774.671] * (-777.815) (-776.536) [-775.643] (-776.620) -- 0:00:42
      373500 -- (-777.183) (-776.657) [-776.342] (-774.303) * (-774.388) [-776.851] (-774.053) (-780.346) -- 0:00:41
      374000 -- (-774.094) (-774.899) (-779.112) [-775.310] * [-772.588] (-775.937) (-775.768) (-776.694) -- 0:00:41
      374500 -- (-776.544) [-774.695] (-775.194) (-775.610) * (-772.786) (-775.678) [-775.968] (-775.929) -- 0:00:41
      375000 -- (-776.025) (-776.273) [-777.451] (-776.569) * (-778.872) (-775.036) [-775.914] (-777.719) -- 0:00:41

      Average standard deviation of split frequencies: 0.013930

      375500 -- [-777.517] (-775.500) (-777.986) (-774.360) * (-780.097) (-778.056) (-777.932) [-776.475] -- 0:00:41
      376000 -- (-790.375) (-772.127) [-772.496] (-773.508) * [-778.859] (-775.230) (-780.309) (-776.611) -- 0:00:41
      376500 -- (-786.639) [-777.387] (-779.030) (-773.221) * (-772.896) (-773.668) [-779.185] (-774.996) -- 0:00:41
      377000 -- (-779.398) [-774.295] (-782.085) (-775.163) * (-775.050) [-777.854] (-776.426) (-774.696) -- 0:00:41
      377500 -- [-777.346] (-773.938) (-777.268) (-778.656) * (-775.055) [-774.721] (-776.785) (-777.953) -- 0:00:41
      378000 -- (-777.322) (-774.437) (-775.209) [-775.372] * (-775.364) (-774.739) [-777.261] (-775.938) -- 0:00:42
      378500 -- (-774.589) (-775.672) [-776.586] (-776.797) * (-775.317) (-776.530) (-774.527) [-776.691] -- 0:00:42
      379000 -- (-780.327) (-775.928) (-776.467) [-773.932] * (-774.749) (-776.300) (-777.106) [-774.859] -- 0:00:42
      379500 -- (-776.163) (-776.057) (-776.271) [-774.393] * (-775.975) (-776.901) (-777.613) [-774.598] -- 0:00:42
      380000 -- (-775.371) (-776.857) [-777.209] (-774.378) * (-773.512) (-777.888) [-777.284] (-776.275) -- 0:00:42

      Average standard deviation of split frequencies: 0.013347

      380500 -- (-777.994) [-776.533] (-775.524) (-777.936) * (-775.686) [-776.074] (-776.924) (-775.640) -- 0:00:42
      381000 -- (-777.093) (-776.408) (-775.362) [-775.001] * (-774.047) (-777.136) [-773.186] (-775.332) -- 0:00:42
      381500 -- (-776.336) (-777.394) (-775.808) [-774.298] * (-779.910) (-774.521) (-777.064) [-774.776] -- 0:00:42
      382000 -- (-775.552) (-775.019) (-775.764) [-773.826] * (-774.250) [-774.148] (-778.448) (-775.231) -- 0:00:42
      382500 -- (-776.025) [-775.481] (-777.476) (-773.871) * (-777.848) (-778.538) [-780.281] (-774.940) -- 0:00:41
      383000 -- (-776.480) [-778.496] (-776.131) (-774.636) * (-777.880) [-775.691] (-775.992) (-775.236) -- 0:00:41
      383500 -- (-776.995) (-783.615) (-775.414) [-776.156] * (-775.188) (-775.042) (-777.149) [-772.639] -- 0:00:41
      384000 -- (-778.597) (-778.767) [-777.683] (-775.517) * (-774.862) (-776.924) (-775.379) [-776.112] -- 0:00:41
      384500 -- (-779.916) (-777.594) [-777.265] (-773.499) * (-774.240) (-775.388) (-778.128) [-775.062] -- 0:00:41
      385000 -- (-778.612) (-779.932) (-776.605) [-778.194] * [-775.747] (-778.414) (-776.407) (-780.209) -- 0:00:41

      Average standard deviation of split frequencies: 0.012470

      385500 -- (-774.781) [-778.398] (-779.412) (-776.905) * [-773.943] (-778.103) (-777.377) (-776.565) -- 0:00:41
      386000 -- (-774.876) (-775.542) (-778.571) [-777.506] * [-774.333] (-779.958) (-776.087) (-775.104) -- 0:00:41
      386500 -- (-777.918) [-774.936] (-776.901) (-779.061) * [-775.688] (-775.348) (-773.925) (-779.183) -- 0:00:41
      387000 -- (-778.009) (-774.919) (-775.529) [-775.798] * (-776.109) (-775.915) [-776.660] (-776.147) -- 0:00:41
      387500 -- (-779.300) (-775.148) [-779.109] (-774.076) * (-775.604) [-778.860] (-776.087) (-779.483) -- 0:00:41
      388000 -- (-774.991) [-775.257] (-775.873) (-775.512) * (-777.193) (-775.050) (-778.072) [-778.831] -- 0:00:41
      388500 -- (-774.742) [-776.211] (-775.352) (-776.645) * (-777.430) (-774.455) [-776.932] (-781.422) -- 0:00:40
      389000 -- [-774.651] (-774.867) (-775.929) (-776.169) * (-774.002) [-774.158] (-779.246) (-781.679) -- 0:00:40
      389500 -- (-779.396) (-774.867) (-776.129) [-776.292] * [-775.545] (-777.433) (-776.367) (-777.486) -- 0:00:42
      390000 -- (-775.689) (-775.658) [-776.911] (-772.344) * (-774.738) (-776.997) (-777.312) [-776.637] -- 0:00:42

      Average standard deviation of split frequencies: 0.012871

      390500 -- (-774.583) [-776.150] (-776.620) (-775.898) * [-774.899] (-775.670) (-775.053) (-777.874) -- 0:00:42
      391000 -- (-776.402) (-776.901) [-781.460] (-774.306) * [-776.362] (-775.670) (-775.209) (-777.005) -- 0:00:42
      391500 -- (-778.153) [-774.892] (-778.632) (-774.159) * [-776.162] (-778.181) (-775.267) (-774.689) -- 0:00:41
      392000 -- [-776.736] (-782.378) (-776.902) (-771.483) * (-777.987) [-774.763] (-775.149) (-775.668) -- 0:00:41
      392500 -- [-777.129] (-773.804) (-779.287) (-775.295) * (-778.496) (-775.989) [-774.055] (-776.849) -- 0:00:41
      393000 -- (-778.188) (-782.195) (-776.290) [-776.294] * [-778.936] (-775.594) (-775.370) (-775.176) -- 0:00:41
      393500 -- (-776.714) (-777.813) (-775.296) [-773.080] * (-776.243) [-775.935] (-777.091) (-775.492) -- 0:00:41
      394000 -- (-780.603) [-777.752] (-774.761) (-775.108) * [-776.056] (-776.211) (-776.439) (-776.028) -- 0:00:41
      394500 -- [-776.159] (-777.085) (-776.807) (-775.300) * (-776.758) [-776.185] (-776.949) (-777.380) -- 0:00:41
      395000 -- (-775.423) (-776.606) [-775.559] (-775.616) * (-776.437) [-776.367] (-773.957) (-776.166) -- 0:00:41

      Average standard deviation of split frequencies: 0.012781

      395500 -- (-777.499) [-776.047] (-775.728) (-776.094) * (-775.390) [-775.286] (-775.067) (-778.329) -- 0:00:41
      396000 -- [-775.024] (-776.092) (-777.245) (-773.623) * (-776.756) (-778.617) [-775.459] (-777.486) -- 0:00:41
      396500 -- [-775.916] (-777.989) (-777.701) (-774.062) * [-775.398] (-777.006) (-775.042) (-776.947) -- 0:00:41
      397000 -- (-780.053) [-776.834] (-774.590) (-774.514) * (-776.643) [-777.670] (-775.690) (-776.642) -- 0:00:41
      397500 -- (-777.054) [-774.420] (-775.360) (-778.839) * (-778.679) [-772.726] (-775.714) (-777.060) -- 0:00:40
      398000 -- (-777.554) [-776.679] (-773.021) (-775.231) * (-776.675) (-775.379) [-779.606] (-777.929) -- 0:00:40
      398500 -- (-775.436) (-775.824) (-775.252) [-775.770] * (-774.925) [-774.032] (-775.880) (-774.067) -- 0:00:40
      399000 -- (-778.221) (-775.025) (-774.826) [-773.725] * (-781.152) (-774.303) (-775.414) [-773.686] -- 0:00:40
      399500 -- (-775.964) [-778.760] (-777.124) (-773.695) * (-779.793) (-774.372) (-776.086) [-777.455] -- 0:00:40
      400000 -- (-776.649) (-776.286) (-776.342) [-776.161] * (-779.647) [-775.671] (-777.744) (-776.096) -- 0:00:40

      Average standard deviation of split frequencies: 0.013269

      400500 -- (-778.500) (-776.272) [-775.600] (-775.809) * [-775.528] (-774.444) (-778.834) (-775.759) -- 0:00:40
      401000 -- (-775.761) (-775.599) (-775.789) [-772.670] * (-776.078) (-771.735) [-775.684] (-774.854) -- 0:00:40
      401500 -- (-777.054) [-775.672] (-777.829) (-780.686) * [-778.560] (-775.963) (-776.456) (-774.712) -- 0:00:40
      402000 -- (-776.330) [-775.142] (-778.209) (-775.898) * [-778.736] (-779.800) (-775.191) (-774.202) -- 0:00:40
      402500 -- [-774.906] (-775.607) (-778.849) (-776.075) * (-777.270) (-775.281) (-774.002) [-775.140] -- 0:00:40
      403000 -- [-775.446] (-774.826) (-775.718) (-776.014) * [-774.735] (-774.706) (-774.699) (-773.132) -- 0:00:39
      403500 -- (-776.521) (-777.293) (-777.303) [-775.270] * (-774.652) (-772.433) [-775.502] (-777.429) -- 0:00:39
      404000 -- (-773.143) (-773.604) (-775.707) [-777.400] * [-775.018] (-779.712) (-775.292) (-784.030) -- 0:00:39
      404500 -- (-777.105) (-775.361) (-775.870) [-776.611] * (-773.644) [-777.629] (-776.483) (-775.163) -- 0:00:41
      405000 -- [-775.772] (-775.466) (-777.182) (-776.757) * (-773.844) (-778.547) (-780.336) [-776.064] -- 0:00:41

      Average standard deviation of split frequencies: 0.012528

      405500 -- (-776.185) (-775.329) [-776.816] (-774.345) * (-775.909) (-777.538) [-777.058] (-775.153) -- 0:00:41
      406000 -- (-774.255) (-776.174) (-783.543) [-778.348] * [-771.899] (-776.438) (-775.703) (-775.219) -- 0:00:40
      406500 -- (-775.299) (-776.470) [-775.591] (-777.379) * (-776.163) (-777.678) (-774.526) [-776.381] -- 0:00:40
      407000 -- (-774.591) (-778.195) (-779.136) [-775.535] * (-774.209) (-773.537) (-775.803) [-777.404] -- 0:00:40
      407500 -- (-775.717) (-778.394) (-778.867) [-778.023] * [-777.066] (-774.999) (-775.567) (-776.156) -- 0:00:40
      408000 -- (-773.744) (-774.707) (-775.623) [-776.229] * (-775.071) (-776.363) (-777.127) [-776.249] -- 0:00:40
      408500 -- (-774.625) (-775.216) [-776.263] (-777.011) * (-775.249) (-777.095) [-775.437] (-776.695) -- 0:00:40
      409000 -- (-779.163) [-779.320] (-775.658) (-776.572) * [-773.584] (-778.210) (-774.654) (-776.554) -- 0:00:40
      409500 -- (-776.085) (-777.477) (-776.315) [-775.600] * (-773.688) (-779.623) [-776.504] (-782.322) -- 0:00:40
      410000 -- [-775.718] (-777.893) (-775.358) (-776.928) * [-775.387] (-774.674) (-777.381) (-775.513) -- 0:00:40

      Average standard deviation of split frequencies: 0.012563

      410500 -- (-774.248) [-779.674] (-778.272) (-775.613) * (-777.353) [-777.182] (-775.214) (-775.465) -- 0:00:40
      411000 -- (-780.323) (-778.486) [-777.877] (-772.463) * (-775.309) [-778.125] (-774.705) (-775.655) -- 0:00:40
      411500 -- [-772.848] (-778.213) (-775.375) (-775.158) * [-776.005] (-774.931) (-778.830) (-775.280) -- 0:00:40
      412000 -- (-776.230) [-775.680] (-776.363) (-775.637) * (-779.509) [-776.158] (-775.168) (-782.299) -- 0:00:39
      412500 -- (-778.221) [-777.143] (-775.756) (-775.971) * (-776.335) (-785.068) [-775.298] (-778.098) -- 0:00:39
      413000 -- [-773.208] (-774.666) (-776.537) (-775.443) * (-774.963) (-779.226) [-779.311] (-775.009) -- 0:00:39
      413500 -- (-776.062) [-775.735] (-777.472) (-774.427) * [-776.027] (-780.718) (-775.902) (-776.188) -- 0:00:39
      414000 -- (-774.863) (-776.168) (-775.412) [-776.222] * (-776.623) [-776.307] (-773.372) (-777.783) -- 0:00:39
      414500 -- [-776.691] (-775.626) (-776.283) (-776.269) * (-774.514) (-777.422) [-776.487] (-777.034) -- 0:00:39
      415000 -- (-775.947) (-777.840) [-775.877] (-777.098) * [-772.680] (-778.922) (-777.798) (-774.719) -- 0:00:39

      Average standard deviation of split frequencies: 0.011961

      415500 -- (-777.521) (-776.406) [-778.942] (-784.036) * (-775.531) [-776.575] (-780.091) (-775.682) -- 0:00:39
      416000 -- (-774.341) (-776.029) [-775.301] (-776.477) * [-776.799] (-778.538) (-779.117) (-774.049) -- 0:00:39
      416500 -- [-777.924] (-774.887) (-775.716) (-775.636) * (-777.469) [-778.317] (-779.182) (-773.503) -- 0:00:39
      417000 -- (-780.340) (-776.576) [-776.627] (-776.739) * (-777.060) [-774.179] (-776.517) (-775.172) -- 0:00:39
      417500 -- [-778.805] (-773.434) (-776.282) (-776.072) * (-776.603) (-780.304) [-773.158] (-775.191) -- 0:00:39
      418000 -- (-774.743) (-775.387) [-777.398] (-775.756) * (-772.547) (-775.561) [-777.935] (-775.773) -- 0:00:38
      418500 -- (-775.477) (-777.432) [-776.507] (-774.968) * (-773.790) [-775.855] (-776.079) (-776.763) -- 0:00:38
      419000 -- (-775.286) (-776.691) (-780.485) [-775.547] * (-776.041) [-776.055] (-775.589) (-777.054) -- 0:00:38
      419500 -- (-775.889) [-785.002] (-776.960) (-775.728) * [-777.854] (-776.005) (-776.038) (-779.458) -- 0:00:38
      420000 -- (-778.699) (-775.500) [-774.336] (-779.558) * (-774.401) (-774.910) (-779.433) [-772.085] -- 0:00:40

      Average standard deviation of split frequencies: 0.012514

      420500 -- (-776.515) (-775.182) (-776.352) [-777.466] * (-777.340) [-774.820] (-775.133) (-775.578) -- 0:00:39
      421000 -- (-776.757) (-779.657) [-774.459] (-774.634) * (-776.328) (-775.917) [-778.239] (-774.529) -- 0:00:39
      421500 -- (-778.163) (-776.958) [-775.037] (-777.575) * (-776.068) (-773.404) (-778.994) [-774.110] -- 0:00:39
      422000 -- (-777.766) (-776.102) (-775.466) [-775.324] * (-777.983) [-777.614] (-776.178) (-775.770) -- 0:00:39
      422500 -- [-776.285] (-776.290) (-773.678) (-777.051) * (-778.916) (-778.203) (-777.115) [-774.008] -- 0:00:39
      423000 -- (-773.064) (-775.211) [-774.851] (-773.782) * [-775.095] (-775.255) (-775.027) (-776.737) -- 0:00:39
      423500 -- [-776.360] (-776.495) (-775.988) (-777.141) * (-774.016) (-775.138) (-774.036) [-773.894] -- 0:00:39
      424000 -- (-783.224) (-774.776) (-780.775) [-777.013] * (-773.926) (-775.435) (-774.154) [-776.063] -- 0:00:39
      424500 -- [-777.314] (-777.436) (-773.611) (-776.704) * (-775.881) (-777.333) (-775.507) [-774.869] -- 0:00:39
      425000 -- (-777.958) [-775.153] (-776.169) (-776.756) * (-775.225) (-778.104) (-775.976) [-773.096] -- 0:00:39

      Average standard deviation of split frequencies: 0.012541

      425500 -- (-777.261) (-777.953) [-778.563] (-773.647) * (-776.839) (-777.586) (-778.911) [-775.626] -- 0:00:39
      426000 -- [-776.074] (-779.408) (-776.960) (-776.378) * [-776.731] (-777.676) (-775.090) (-774.876) -- 0:00:39
      426500 -- (-776.223) (-776.491) [-777.519] (-776.677) * (-777.691) (-777.899) [-775.274] (-775.288) -- 0:00:38
      427000 -- (-776.373) (-775.769) [-774.268] (-772.811) * (-778.510) (-782.236) (-774.048) [-774.623] -- 0:00:38
      427500 -- (-779.655) [-777.133] (-776.903) (-777.995) * (-774.844) (-781.220) [-774.764] (-779.146) -- 0:00:38
      428000 -- (-780.823) [-774.528] (-775.142) (-777.930) * (-773.954) (-777.883) [-774.207] (-775.387) -- 0:00:38
      428500 -- (-777.887) [-777.969] (-774.882) (-778.500) * (-777.659) [-776.213] (-776.704) (-775.008) -- 0:00:38
      429000 -- [-775.770] (-776.890) (-772.314) (-774.187) * [-776.981] (-775.108) (-772.751) (-775.514) -- 0:00:38
      429500 -- [-777.244] (-775.607) (-779.275) (-777.756) * [-777.520] (-774.083) (-776.888) (-774.948) -- 0:00:38
      430000 -- [-776.052] (-777.787) (-775.158) (-775.317) * (-778.521) (-776.649) (-775.328) [-774.512] -- 0:00:38

      Average standard deviation of split frequencies: 0.012588

      430500 -- (-779.778) (-775.282) (-775.267) [-775.259] * [-777.334] (-775.305) (-774.221) (-777.496) -- 0:00:38
      431000 -- (-779.119) (-775.056) [-777.776] (-773.761) * (-777.689) (-777.529) (-774.217) [-775.727] -- 0:00:38
      431500 -- (-774.555) [-771.343] (-774.730) (-775.466) * (-775.747) (-776.874) (-775.894) [-773.920] -- 0:00:38
      432000 -- (-775.884) (-775.404) (-775.298) [-773.088] * [-776.395] (-773.944) (-774.975) (-776.945) -- 0:00:38
      432500 -- [-777.541] (-774.629) (-776.591) (-775.972) * [-774.149] (-776.560) (-776.427) (-775.251) -- 0:00:38
      433000 -- (-778.100) (-777.513) [-776.060] (-775.390) * (-775.616) (-777.421) (-774.613) [-777.372] -- 0:00:37
      433500 -- [-777.603] (-775.963) (-774.003) (-774.722) * (-775.759) [-776.989] (-774.641) (-778.874) -- 0:00:37
      434000 -- (-773.458) (-773.982) [-773.231] (-774.786) * (-783.137) (-776.422) (-776.979) [-776.791] -- 0:00:37
      434500 -- [-775.197] (-777.191) (-775.867) (-777.072) * (-776.404) (-774.464) (-780.276) [-773.449] -- 0:00:37
      435000 -- [-776.535] (-774.593) (-779.631) (-775.072) * [-779.309] (-775.954) (-778.159) (-776.129) -- 0:00:37

      Average standard deviation of split frequencies: 0.012134

      435500 -- (-776.919) [-775.147] (-780.028) (-784.657) * (-777.907) [-774.659] (-777.420) (-776.701) -- 0:00:38
      436000 -- (-775.329) [-774.350] (-777.264) (-777.283) * (-775.426) [-775.953] (-778.317) (-776.163) -- 0:00:38
      436500 -- (-776.518) (-773.662) (-777.564) [-776.782] * (-777.249) (-775.568) [-776.789] (-779.736) -- 0:00:38
      437000 -- [-775.145] (-777.254) (-776.061) (-774.239) * (-778.159) (-779.369) (-775.768) [-778.866] -- 0:00:38
      437500 -- (-779.261) [-776.345] (-783.582) (-775.453) * (-779.871) (-776.281) (-775.753) [-779.910] -- 0:00:38
      438000 -- [-776.860] (-776.068) (-779.912) (-774.530) * (-776.323) (-775.156) (-773.281) [-775.869] -- 0:00:38
      438500 -- (-779.020) (-775.998) (-779.548) [-773.161] * (-776.658) (-774.685) [-772.158] (-774.453) -- 0:00:38
      439000 -- [-772.664] (-775.256) (-779.022) (-778.708) * (-779.434) [-775.510] (-774.155) (-778.441) -- 0:00:38
      439500 -- [-776.910] (-774.907) (-777.919) (-777.082) * (-775.583) [-777.319] (-774.964) (-777.597) -- 0:00:38
      440000 -- (-778.264) (-778.607) (-775.599) [-776.942] * (-777.166) (-776.657) [-774.175] (-777.823) -- 0:00:38

      Average standard deviation of split frequencies: 0.012362

      440500 -- (-777.898) (-776.680) (-776.153) [-775.985] * (-776.489) (-777.808) (-780.370) [-777.657] -- 0:00:38
      441000 -- (-774.196) (-775.223) (-774.553) [-775.649] * [-775.274] (-781.297) (-780.652) (-778.721) -- 0:00:38
      441500 -- (-773.603) [-777.021] (-775.581) (-777.042) * (-776.449) [-774.918] (-775.236) (-778.547) -- 0:00:37
      442000 -- (-774.418) (-777.898) (-777.422) [-774.487] * [-776.999] (-775.223) (-775.859) (-779.674) -- 0:00:37
      442500 -- (-774.415) (-775.552) [-778.095] (-775.130) * [-776.796] (-775.656) (-776.372) (-777.803) -- 0:00:37
      443000 -- [-774.061] (-774.763) (-778.938) (-776.169) * [-778.998] (-774.705) (-775.461) (-776.556) -- 0:00:37
      443500 -- [-774.905] (-776.682) (-778.772) (-776.755) * [-776.970] (-774.908) (-776.435) (-774.820) -- 0:00:37
      444000 -- [-775.649] (-776.068) (-777.559) (-774.855) * (-777.222) (-776.940) [-775.882] (-776.282) -- 0:00:37
      444500 -- [-778.789] (-776.125) (-777.755) (-774.583) * [-777.383] (-777.653) (-775.487) (-777.445) -- 0:00:37
      445000 -- [-776.357] (-776.051) (-776.429) (-776.838) * (-779.931) [-773.937] (-780.271) (-777.251) -- 0:00:37

      Average standard deviation of split frequencies: 0.012801

      445500 -- [-775.027] (-777.987) (-783.009) (-776.280) * (-775.614) (-780.876) (-780.174) [-779.036] -- 0:00:37
      446000 -- (-780.659) [-776.248] (-778.522) (-776.117) * (-774.474) (-776.269) (-775.949) [-777.014] -- 0:00:37
      446500 -- (-775.563) (-778.239) (-777.439) [-775.503] * [-775.824] (-775.978) (-775.711) (-778.313) -- 0:00:37
      447000 -- (-779.113) [-781.238] (-775.190) (-776.071) * [-776.792] (-775.838) (-775.668) (-776.600) -- 0:00:37
      447500 -- (-776.168) (-776.362) (-775.272) [-776.545] * (-776.265) (-776.246) (-776.413) [-775.378] -- 0:00:37
      448000 -- (-773.843) (-775.112) [-773.980] (-774.915) * (-780.402) [-776.179] (-777.403) (-778.823) -- 0:00:36
      448500 -- [-774.907] (-775.421) (-775.400) (-776.401) * (-781.334) (-774.812) [-777.157] (-776.618) -- 0:00:36
      449000 -- (-772.765) (-774.788) (-775.177) [-773.350] * (-772.519) (-773.762) (-771.143) [-775.674] -- 0:00:36
      449500 -- (-775.282) (-776.154) (-775.244) [-773.219] * (-777.665) [-772.986] (-775.039) (-776.416) -- 0:00:36
      450000 -- (-774.450) (-775.793) [-774.990] (-779.448) * (-775.350) [-777.132] (-774.707) (-776.115) -- 0:00:36

      Average standard deviation of split frequencies: 0.012727

      450500 -- [-776.631] (-778.299) (-777.439) (-775.711) * (-778.069) (-785.070) [-774.725] (-774.231) -- 0:00:36
      451000 -- [-776.470] (-775.503) (-775.031) (-773.710) * (-782.367) (-775.626) (-775.064) [-775.406] -- 0:00:37
      451500 -- (-775.051) (-774.804) [-776.917] (-776.283) * (-776.690) (-779.466) [-776.938] (-779.123) -- 0:00:37
      452000 -- (-776.475) (-775.994) [-775.857] (-777.117) * (-779.198) (-775.048) (-778.346) [-776.909] -- 0:00:37
      452500 -- (-775.443) [-775.482] (-774.765) (-773.558) * [-777.933] (-775.982) (-782.623) (-777.931) -- 0:00:37
      453000 -- (-778.007) (-777.525) [-773.136] (-782.011) * (-779.881) (-777.029) (-775.055) [-776.660] -- 0:00:37
      453500 -- (-778.441) (-774.410) (-775.845) [-776.380] * [-775.980] (-775.588) (-775.486) (-778.414) -- 0:00:37
      454000 -- (-774.000) [-775.080] (-773.985) (-778.303) * (-775.786) [-777.590] (-777.457) (-775.487) -- 0:00:37
      454500 -- (-775.642) (-778.976) (-776.780) [-775.318] * [-773.099] (-779.453) (-776.427) (-779.167) -- 0:00:37
      455000 -- [-774.535] (-775.749) (-783.057) (-774.635) * (-778.285) (-781.788) (-774.164) [-779.688] -- 0:00:37

      Average standard deviation of split frequencies: 0.012980

      455500 -- (-777.409) (-775.317) (-776.710) [-775.136] * [-772.598] (-775.252) (-775.457) (-781.434) -- 0:00:37
      456000 -- (-781.997) (-776.965) (-772.784) [-774.805] * (-775.222) [-777.479] (-774.320) (-778.174) -- 0:00:36
      456500 -- (-775.200) (-774.982) (-772.533) [-774.975] * (-775.020) [-773.128] (-777.469) (-775.694) -- 0:00:36
      457000 -- [-781.713] (-775.798) (-776.355) (-774.151) * (-776.463) (-774.678) (-782.684) [-774.877] -- 0:00:36
      457500 -- [-774.885] (-775.984) (-774.448) (-776.335) * (-775.404) [-777.678] (-782.125) (-782.102) -- 0:00:36
      458000 -- (-774.932) (-774.849) [-775.585] (-777.393) * [-776.221] (-775.948) (-778.377) (-776.813) -- 0:00:36
      458500 -- (-775.871) [-774.878] (-776.215) (-777.068) * (-778.697) [-777.992] (-774.398) (-777.213) -- 0:00:36
      459000 -- (-774.772) [-776.171] (-777.321) (-777.171) * [-778.525] (-775.381) (-775.418) (-774.854) -- 0:00:36
      459500 -- (-775.958) [-776.572] (-778.117) (-780.500) * (-780.572) [-774.598] (-773.934) (-775.027) -- 0:00:36
      460000 -- (-776.130) (-775.782) (-776.365) [-772.289] * (-776.796) (-776.216) [-774.636] (-776.209) -- 0:00:36

      Average standard deviation of split frequencies: 0.012441

      460500 -- (-777.202) [-774.866] (-780.365) (-776.343) * (-778.814) (-779.300) [-777.571] (-775.992) -- 0:00:36
      461000 -- (-772.972) (-774.896) (-779.550) [-777.268] * [-775.392] (-774.485) (-774.396) (-774.266) -- 0:00:36
      461500 -- [-776.471] (-776.361) (-778.011) (-775.998) * [-775.923] (-776.312) (-774.543) (-776.696) -- 0:00:36
      462000 -- (-775.839) (-775.839) (-777.727) [-774.907] * [-778.141] (-776.719) (-776.754) (-774.148) -- 0:00:36
      462500 -- [-774.660] (-775.418) (-775.732) (-776.120) * (-773.182) (-776.725) [-777.840] (-775.488) -- 0:00:36
      463000 -- [-776.777] (-777.969) (-777.202) (-775.309) * (-781.673) (-774.424) (-776.822) [-777.074] -- 0:00:35
      463500 -- [-776.695] (-776.150) (-775.314) (-774.594) * (-777.904) [-774.626] (-775.061) (-776.198) -- 0:00:35
      464000 -- (-777.112) (-775.693) (-776.841) [-776.685] * (-775.268) [-779.044] (-773.509) (-775.823) -- 0:00:35
      464500 -- (-777.418) (-777.703) (-775.400) [-774.595] * (-773.673) (-772.339) (-775.280) [-775.604] -- 0:00:35
      465000 -- (-773.044) (-775.947) (-779.590) [-777.059] * (-776.548) [-772.047] (-776.599) (-774.180) -- 0:00:35

      Average standard deviation of split frequencies: 0.011554

      465500 -- (-779.076) (-777.313) [-776.236] (-775.443) * [-776.587] (-774.899) (-776.737) (-772.422) -- 0:00:35
      466000 -- (-774.965) (-776.234) (-774.113) [-776.033] * (-777.183) (-779.315) (-776.249) [-775.341] -- 0:00:35
      466500 -- [-775.972] (-777.635) (-778.076) (-776.834) * (-774.471) [-772.713] (-774.936) (-774.273) -- 0:00:36
      467000 -- (-774.369) (-777.819) (-780.610) [-777.575] * (-774.161) (-781.779) [-775.696] (-771.867) -- 0:00:36
      467500 -- (-778.602) (-776.316) (-774.941) [-773.739] * (-777.301) (-778.436) [-777.846] (-775.076) -- 0:00:36
      468000 -- (-773.771) (-776.999) [-778.720] (-777.207) * (-778.667) (-776.193) (-777.236) [-775.290] -- 0:00:36
      468500 -- (-772.028) (-776.745) [-778.138] (-776.654) * (-776.832) (-777.843) [-777.741] (-776.044) -- 0:00:36
      469000 -- (-778.447) [-776.508] (-777.455) (-775.682) * (-776.885) [-776.992] (-778.892) (-775.259) -- 0:00:36
      469500 -- [-772.232] (-776.605) (-776.633) (-777.180) * (-774.991) (-778.064) [-774.757] (-777.439) -- 0:00:36
      470000 -- (-775.583) [-776.225] (-776.654) (-777.618) * [-775.001] (-777.290) (-776.313) (-776.481) -- 0:00:36

      Average standard deviation of split frequencies: 0.011597

      470500 -- [-772.478] (-774.079) (-778.215) (-785.769) * (-774.938) (-777.934) [-777.648] (-775.473) -- 0:00:36
      471000 -- (-778.424) [-772.608] (-776.404) (-776.985) * (-777.163) (-779.584) [-777.233] (-780.641) -- 0:00:35
      471500 -- (-773.668) [-775.041] (-775.565) (-775.659) * (-776.956) [-776.245] (-776.209) (-775.151) -- 0:00:35
      472000 -- (-775.824) [-774.981] (-776.638) (-779.414) * (-774.704) (-774.284) [-773.868] (-777.651) -- 0:00:35
      472500 -- (-775.883) (-775.585) [-774.938] (-776.702) * (-775.024) (-775.764) [-780.181] (-774.031) -- 0:00:35
      473000 -- (-775.281) [-772.557] (-777.502) (-777.235) * (-774.628) [-774.902] (-778.083) (-775.062) -- 0:00:35
      473500 -- (-775.039) [-773.837] (-778.624) (-776.436) * (-774.615) [-776.837] (-777.383) (-776.757) -- 0:00:35
      474000 -- (-778.715) [-772.495] (-773.914) (-776.078) * (-777.071) (-777.048) (-775.325) [-775.319] -- 0:00:35
      474500 -- (-778.136) (-774.423) [-775.274] (-775.074) * [-777.140] (-776.320) (-775.940) (-774.869) -- 0:00:35
      475000 -- (-777.899) (-778.138) (-775.523) [-776.891] * (-778.392) (-779.201) (-774.704) [-776.135] -- 0:00:35

      Average standard deviation of split frequencies: 0.011832

      475500 -- (-775.952) (-776.553) (-779.404) [-774.773] * [-773.847] (-778.610) (-775.657) (-773.850) -- 0:00:35
      476000 -- (-775.717) (-775.033) [-779.083] (-774.934) * [-774.102] (-776.920) (-775.877) (-775.800) -- 0:00:35
      476500 -- [-775.266] (-775.305) (-776.228) (-775.780) * [-775.136] (-775.870) (-775.012) (-774.234) -- 0:00:35
      477000 -- [-771.998] (-776.756) (-775.088) (-776.002) * (-774.235) (-777.440) (-776.926) [-776.210] -- 0:00:35
      477500 -- (-777.324) (-779.407) [-773.660] (-778.210) * (-778.632) (-778.739) [-776.961] (-777.058) -- 0:00:35
      478000 -- [-774.631] (-779.788) (-775.716) (-779.204) * [-777.609] (-776.730) (-775.231) (-775.271) -- 0:00:34
      478500 -- (-774.771) (-776.160) [-774.782] (-774.839) * (-776.498) (-775.633) [-780.406] (-775.080) -- 0:00:34
      479000 -- (-778.043) [-775.199] (-772.980) (-776.665) * (-774.687) (-774.758) [-775.288] (-775.080) -- 0:00:34
      479500 -- (-775.899) (-776.978) [-775.363] (-777.018) * (-774.648) [-772.789] (-774.589) (-775.461) -- 0:00:34
      480000 -- (-774.954) (-777.643) [-774.411] (-774.003) * (-775.772) [-773.883] (-774.363) (-776.524) -- 0:00:34

      Average standard deviation of split frequencies: 0.010788

      480500 -- [-775.206] (-774.094) (-774.358) (-779.343) * (-777.183) [-774.379] (-775.887) (-777.248) -- 0:00:34
      481000 -- (-775.567) (-775.986) (-780.626) [-776.530] * (-775.200) [-775.136] (-776.059) (-776.372) -- 0:00:34
      481500 -- (-777.171) (-776.111) (-777.696) [-777.962] * (-775.766) (-775.618) [-775.622] (-778.044) -- 0:00:34
      482000 -- (-775.196) (-776.406) [-775.484] (-776.632) * (-774.993) [-776.887] (-775.034) (-777.542) -- 0:00:34
      482500 -- (-778.080) (-775.715) (-775.625) [-777.048] * (-773.890) [-774.943] (-778.141) (-776.768) -- 0:00:35
      483000 -- [-776.631] (-776.559) (-778.136) (-780.979) * (-774.945) [-773.238] (-774.270) (-774.686) -- 0:00:35
      483500 -- [-775.485] (-775.565) (-778.205) (-775.237) * (-775.181) (-776.189) [-775.717] (-774.847) -- 0:00:35
      484000 -- [-775.378] (-776.974) (-772.121) (-775.908) * (-773.226) (-779.312) (-775.706) [-772.971] -- 0:00:35
      484500 -- (-775.549) [-778.049] (-777.857) (-775.069) * [-772.549] (-775.874) (-776.829) (-782.245) -- 0:00:35
      485000 -- (-775.088) (-776.248) [-776.718] (-776.404) * (-776.086) (-775.484) [-776.953] (-774.444) -- 0:00:35

      Average standard deviation of split frequencies: 0.010508

      485500 -- (-773.629) [-774.229] (-774.768) (-777.210) * (-776.692) (-778.831) (-776.298) [-774.763] -- 0:00:34
      486000 -- (-774.687) [-775.889] (-775.013) (-776.993) * (-775.775) (-774.169) [-776.222] (-775.582) -- 0:00:34
      486500 -- (-774.484) (-774.204) (-776.012) [-776.384] * [-776.937] (-775.643) (-775.894) (-778.264) -- 0:00:34
      487000 -- [-774.153] (-776.061) (-774.374) (-776.361) * (-773.395) [-777.910] (-776.657) (-776.453) -- 0:00:34
      487500 -- (-775.618) [-774.838] (-774.849) (-773.154) * [-776.085] (-773.186) (-775.662) (-778.971) -- 0:00:34
      488000 -- (-775.416) (-778.107) (-773.741) [-776.218] * (-777.172) (-775.858) (-775.513) [-774.947] -- 0:00:34
      488500 -- (-776.290) (-776.527) [-778.142] (-777.087) * (-777.521) (-776.601) [-781.054] (-775.245) -- 0:00:34
      489000 -- (-774.521) [-775.902] (-775.998) (-778.159) * (-776.706) (-774.381) (-776.734) [-774.082] -- 0:00:34
      489500 -- [-775.609] (-777.074) (-777.843) (-775.430) * [-776.201] (-772.644) (-776.511) (-779.354) -- 0:00:34
      490000 -- (-776.472) (-778.490) [-778.375] (-777.985) * [-775.425] (-776.224) (-775.440) (-774.187) -- 0:00:34

      Average standard deviation of split frequencies: 0.009928

      490500 -- [-777.882] (-779.913) (-778.648) (-778.451) * (-775.412) [-775.286] (-774.969) (-773.724) -- 0:00:34
      491000 -- (-775.704) (-778.068) (-774.914) [-774.536] * (-775.631) [-775.719] (-776.466) (-774.435) -- 0:00:34
      491500 -- (-775.247) (-777.221) (-779.216) [-780.574] * (-780.265) (-776.866) (-776.477) [-774.524] -- 0:00:34
      492000 -- (-776.086) (-780.810) (-774.747) [-774.588] * [-776.172] (-776.255) (-776.069) (-774.299) -- 0:00:34
      492500 -- [-776.325] (-778.252) (-773.302) (-775.078) * (-776.159) (-774.974) (-777.185) [-774.093] -- 0:00:34
      493000 -- (-774.901) (-777.532) (-776.842) [-777.109] * (-775.507) (-777.753) [-776.760] (-775.054) -- 0:00:33
      493500 -- (-774.981) [-774.281] (-777.807) (-780.974) * (-776.971) [-779.035] (-775.409) (-782.636) -- 0:00:33
      494000 -- (-774.255) [-779.022] (-776.815) (-776.213) * (-774.022) (-774.544) [-775.507] (-775.751) -- 0:00:33
      494500 -- (-776.116) (-780.171) (-776.136) [-774.767] * (-778.618) (-772.767) (-775.671) [-774.691] -- 0:00:33
      495000 -- (-773.197) (-781.715) [-773.364] (-774.882) * (-776.293) (-775.311) [-775.634] (-773.184) -- 0:00:33

      Average standard deviation of split frequencies: 0.010191

      495500 -- (-775.386) (-775.876) (-777.547) [-774.289] * [-774.625] (-776.453) (-777.091) (-774.972) -- 0:00:33
      496000 -- (-775.329) (-775.599) (-777.297) [-775.443] * (-775.567) [-776.649] (-775.234) (-774.650) -- 0:00:33
      496500 -- (-777.628) (-774.970) [-775.519] (-774.391) * (-779.079) (-777.858) (-780.417) [-774.865] -- 0:00:33
      497000 -- (-781.846) [-773.068] (-774.366) (-775.748) * (-776.420) [-775.697] (-775.562) (-777.392) -- 0:00:34
      497500 -- (-778.295) (-774.727) [-772.413] (-776.589) * (-778.547) [-775.959] (-777.371) (-774.947) -- 0:00:34
      498000 -- (-776.998) [-774.692] (-774.439) (-776.742) * (-775.849) (-776.244) [-776.468] (-774.643) -- 0:00:34
      498500 -- (-777.106) (-774.791) [-775.962] (-778.556) * [-776.028] (-775.312) (-775.360) (-775.108) -- 0:00:34
      499000 -- (-775.064) (-776.484) (-773.850) [-777.739] * [-776.370] (-774.817) (-775.079) (-775.967) -- 0:00:34
      499500 -- (-774.590) [-774.086] (-777.125) (-776.060) * (-777.930) (-774.985) [-774.855] (-781.573) -- 0:00:34
      500000 -- [-776.710] (-775.173) (-773.988) (-777.272) * [-775.525] (-775.276) (-777.575) (-780.433) -- 0:00:34

      Average standard deviation of split frequencies: 0.010252

      500500 -- (-780.272) (-776.937) [-774.989] (-777.041) * (-776.352) [-777.879] (-779.529) (-777.235) -- 0:00:33
      501000 -- (-775.610) (-777.066) [-777.484] (-775.409) * (-776.605) (-774.443) [-774.567] (-777.230) -- 0:00:33
      501500 -- (-777.065) (-778.430) [-775.007] (-777.149) * (-779.332) [-778.256] (-781.247) (-776.456) -- 0:00:33
      502000 -- (-776.401) (-774.802) (-776.678) [-775.047] * (-775.340) [-772.421] (-783.336) (-775.640) -- 0:00:33
      502500 -- (-775.911) (-775.529) (-774.392) [-775.183] * [-775.735] (-775.650) (-775.323) (-776.378) -- 0:00:33
      503000 -- (-776.690) (-776.879) [-774.034] (-775.949) * [-775.894] (-775.384) (-779.668) (-777.889) -- 0:00:33
      503500 -- (-776.133) (-777.844) (-776.592) [-775.254] * [-773.372] (-776.140) (-777.689) (-777.634) -- 0:00:33
      504000 -- (-775.630) (-776.091) [-776.978] (-776.468) * (-779.546) [-776.619] (-779.411) (-778.748) -- 0:00:33
      504500 -- (-776.982) (-778.595) [-775.049] (-776.584) * (-773.579) (-776.254) [-773.971] (-776.289) -- 0:00:33
      505000 -- (-774.657) (-775.312) (-774.478) [-777.215] * (-773.871) (-777.316) (-773.055) [-777.676] -- 0:00:33

      Average standard deviation of split frequencies: 0.009954

      505500 -- (-773.025) (-776.200) (-774.935) [-774.693] * (-774.151) [-778.680] (-777.862) (-772.827) -- 0:00:33
      506000 -- [-774.863] (-775.330) (-776.807) (-777.871) * [-775.867] (-777.786) (-777.985) (-775.660) -- 0:00:33
      506500 -- (-777.560) (-776.491) [-776.775] (-779.818) * [-776.214] (-774.089) (-782.403) (-780.764) -- 0:00:33
      507000 -- [-777.495] (-776.564) (-774.450) (-773.920) * [-779.609] (-778.625) (-778.894) (-775.909) -- 0:00:33
      507500 -- (-776.074) [-775.564] (-774.834) (-778.433) * [-776.680] (-773.314) (-773.039) (-779.905) -- 0:00:32
      508000 -- [-774.861] (-779.189) (-777.995) (-776.708) * [-776.560] (-774.764) (-776.434) (-779.835) -- 0:00:32
      508500 -- [-771.890] (-775.420) (-775.251) (-775.394) * (-775.542) (-775.405) [-776.491] (-775.616) -- 0:00:32
      509000 -- (-776.454) (-775.806) [-778.158] (-775.733) * [-775.824] (-776.740) (-775.116) (-775.884) -- 0:00:32
      509500 -- [-774.965] (-778.044) (-778.974) (-776.940) * (-777.555) [-774.736] (-775.936) (-775.297) -- 0:00:32
      510000 -- [-776.619] (-781.509) (-774.505) (-777.602) * (-777.675) (-775.342) (-776.412) [-774.593] -- 0:00:32

      Average standard deviation of split frequencies: 0.010103

      510500 -- [-775.853] (-778.705) (-783.914) (-777.513) * (-774.649) (-775.302) (-782.470) [-775.358] -- 0:00:32
      511000 -- (-780.080) [-776.209] (-776.596) (-778.136) * (-775.046) (-776.092) [-775.747] (-775.718) -- 0:00:33
      511500 -- (-779.786) (-775.222) (-776.507) [-779.143] * [-775.619] (-774.897) (-777.065) (-775.503) -- 0:00:33
      512000 -- (-774.347) [-775.911] (-775.515) (-775.911) * (-776.902) (-778.029) (-777.251) [-777.806] -- 0:00:33
      512500 -- (-776.912) (-774.208) [-776.638] (-780.806) * (-778.596) (-777.263) (-774.838) [-777.082] -- 0:00:33
      513000 -- [-773.969] (-776.214) (-777.237) (-775.914) * (-778.701) (-776.842) (-775.121) [-777.998] -- 0:00:33
      513500 -- (-775.251) [-773.778] (-775.367) (-779.414) * (-777.833) [-780.754] (-775.815) (-776.931) -- 0:00:33
      514000 -- [-774.006] (-776.674) (-777.477) (-778.606) * (-774.647) (-776.460) [-774.173] (-775.874) -- 0:00:33
      514500 -- (-776.310) (-780.866) [-776.826] (-778.230) * (-774.799) (-777.173) (-775.904) [-775.225] -- 0:00:33
      515000 -- (-774.621) (-777.289) [-777.177] (-777.084) * (-777.177) (-775.415) (-775.988) [-775.071] -- 0:00:32

      Average standard deviation of split frequencies: 0.009846

      515500 -- [-775.107] (-774.968) (-776.926) (-775.298) * (-774.896) [-778.850] (-778.129) (-775.407) -- 0:00:32
      516000 -- (-776.797) (-778.009) (-775.044) [-774.588] * (-773.901) (-776.870) (-774.453) [-777.866] -- 0:00:32
      516500 -- (-774.918) (-774.874) [-776.388] (-774.053) * (-775.551) (-778.327) [-776.190] (-781.087) -- 0:00:32
      517000 -- [-771.537] (-775.893) (-776.612) (-776.070) * (-775.776) (-776.758) (-778.031) [-777.203] -- 0:00:32
      517500 -- (-775.096) (-775.222) (-775.847) [-775.330] * (-774.273) (-776.900) (-778.870) [-775.392] -- 0:00:32
      518000 -- (-778.870) (-773.409) (-778.093) [-775.022] * (-775.108) [-776.858] (-780.982) (-777.483) -- 0:00:32
      518500 -- (-772.704) (-773.506) (-776.627) [-773.572] * [-774.978] (-774.601) (-778.890) (-782.239) -- 0:00:32
      519000 -- [-775.934] (-776.296) (-775.909) (-779.018) * (-774.418) [-777.027] (-778.202) (-775.358) -- 0:00:32
      519500 -- [-779.919] (-775.845) (-776.763) (-777.069) * [-776.309] (-776.676) (-774.259) (-774.569) -- 0:00:32
      520000 -- [-774.244] (-776.077) (-776.537) (-776.722) * (-774.219) [-775.803] (-779.738) (-778.116) -- 0:00:32

      Average standard deviation of split frequencies: 0.009808

      520500 -- [-773.695] (-777.424) (-776.725) (-776.588) * [-774.796] (-779.070) (-776.087) (-777.720) -- 0:00:32
      521000 -- [-775.848] (-775.638) (-775.390) (-776.256) * [-777.171] (-775.980) (-779.107) (-774.454) -- 0:00:32
      521500 -- (-776.758) [-775.701] (-775.184) (-775.170) * (-773.730) (-776.576) (-777.320) [-776.431] -- 0:00:32
      522000 -- (-777.202) (-776.909) [-776.670] (-777.028) * (-776.351) (-777.406) (-777.337) [-776.579] -- 0:00:32
      522500 -- (-776.017) [-775.753] (-777.080) (-775.745) * (-777.789) (-777.309) [-775.493] (-773.508) -- 0:00:31
      523000 -- (-774.308) (-774.601) (-776.468) [-776.251] * (-775.079) [-775.166] (-778.726) (-776.218) -- 0:00:31
      523500 -- (-777.158) (-776.081) [-775.832] (-776.151) * (-776.591) [-776.709] (-777.780) (-775.973) -- 0:00:31
      524000 -- [-775.670] (-774.860) (-777.423) (-780.783) * (-778.991) (-776.451) (-776.283) [-774.649] -- 0:00:31
      524500 -- (-774.951) (-775.739) [-777.664] (-774.709) * [-775.605] (-775.527) (-773.442) (-774.984) -- 0:00:31
      525000 -- [-775.507] (-774.376) (-777.441) (-776.508) * (-772.589) [-777.645] (-777.906) (-775.733) -- 0:00:31

      Average standard deviation of split frequencies: 0.010306

      525500 -- (-775.485) [-776.262] (-779.736) (-776.146) * (-777.677) (-775.767) (-777.756) [-774.888] -- 0:00:32
      526000 -- [-778.705] (-775.754) (-776.284) (-776.401) * (-776.435) (-776.378) [-775.298] (-776.326) -- 0:00:32
      526500 -- [-775.125] (-776.647) (-775.489) (-779.472) * (-774.841) [-774.862] (-776.118) (-777.124) -- 0:00:32
      527000 -- (-774.639) [-775.024] (-774.945) (-778.879) * (-776.491) (-775.400) [-776.949] (-776.721) -- 0:00:32
      527500 -- [-775.615] (-775.637) (-777.630) (-777.430) * (-774.293) (-775.405) (-777.803) [-778.193] -- 0:00:32
      528000 -- (-777.715) [-775.372] (-780.635) (-776.554) * (-777.616) [-775.321] (-777.582) (-775.767) -- 0:00:32
      528500 -- (-777.445) (-774.887) (-782.196) [-778.261] * (-778.153) (-778.519) (-773.076) [-775.958] -- 0:00:32
      529000 -- (-778.095) [-777.069] (-779.807) (-777.188) * (-773.179) (-774.658) (-776.335) [-776.693] -- 0:00:32
      529500 -- (-775.765) (-776.807) (-773.814) [-777.005] * [-776.702] (-776.918) (-773.650) (-777.632) -- 0:00:31
      530000 -- (-777.560) (-775.964) [-777.130] (-776.801) * (-776.177) [-775.128] (-774.929) (-778.299) -- 0:00:31

      Average standard deviation of split frequencies: 0.010907

      530500 -- [-775.627] (-780.591) (-773.329) (-782.338) * (-774.181) [-774.578] (-772.600) (-779.321) -- 0:00:31
      531000 -- [-777.030] (-777.870) (-778.039) (-781.155) * (-774.242) (-774.613) [-775.823] (-781.614) -- 0:00:31
      531500 -- [-775.908] (-778.734) (-776.810) (-782.064) * (-775.349) [-776.199] (-776.211) (-778.898) -- 0:00:31
      532000 -- (-775.341) [-777.359] (-778.369) (-777.512) * (-775.456) [-775.723] (-775.132) (-776.091) -- 0:00:31
      532500 -- [-777.139] (-776.921) (-779.161) (-776.899) * [-777.547] (-779.948) (-776.560) (-777.265) -- 0:00:31
      533000 -- (-777.155) (-780.747) (-776.781) [-775.039] * (-773.328) [-778.290] (-776.124) (-776.371) -- 0:00:31
      533500 -- (-776.787) (-775.110) [-778.397] (-776.717) * (-776.003) (-776.923) [-776.226] (-777.809) -- 0:00:31
      534000 -- (-774.276) (-776.712) [-775.816] (-776.800) * (-776.325) [-775.457] (-779.371) (-775.434) -- 0:00:31
      534500 -- (-775.732) (-775.508) [-775.058] (-775.847) * (-775.805) [-777.398] (-777.226) (-774.885) -- 0:00:31
      535000 -- [-774.611] (-775.544) (-775.667) (-776.015) * (-780.250) (-777.256) [-775.759] (-775.566) -- 0:00:31

      Average standard deviation of split frequencies: 0.011336

      535500 -- (-776.702) (-776.415) (-777.228) [-776.169] * (-778.874) (-779.911) [-774.934] (-774.884) -- 0:00:31
      536000 -- (-775.116) (-776.329) [-775.515] (-774.313) * (-777.122) (-774.846) [-776.671] (-776.454) -- 0:00:31
      536500 -- (-776.037) [-776.509] (-776.658) (-775.925) * [-786.616] (-777.142) (-775.615) (-772.540) -- 0:00:31
      537000 -- [-777.841] (-775.664) (-778.662) (-773.692) * (-777.481) (-778.440) (-777.463) [-776.604] -- 0:00:31
      537500 -- [-778.410] (-776.761) (-779.008) (-775.018) * [-776.142] (-775.956) (-775.617) (-777.430) -- 0:00:30
      538000 -- [-777.717] (-775.713) (-778.124) (-780.593) * (-778.087) (-778.244) [-776.709] (-777.337) -- 0:00:30
      538500 -- (-774.476) [-777.337] (-776.555) (-776.811) * (-774.545) (-778.947) (-776.869) [-775.730] -- 0:00:30
      539000 -- (-775.124) [-775.945] (-774.975) (-774.040) * (-775.798) (-775.828) [-778.054] (-781.749) -- 0:00:30
      539500 -- (-777.291) [-775.466] (-777.107) (-776.640) * (-775.737) (-775.197) (-774.990) [-774.685] -- 0:00:30
      540000 -- (-775.672) (-775.229) [-776.741] (-777.271) * (-776.187) [-772.468] (-776.500) (-774.585) -- 0:00:30

      Average standard deviation of split frequencies: 0.011238

      540500 -- [-776.139] (-775.010) (-778.964) (-779.727) * (-775.625) [-772.183] (-774.482) (-776.028) -- 0:00:30
      541000 -- (-779.997) (-776.694) (-774.727) [-776.563] * (-773.388) [-772.234] (-778.219) (-776.015) -- 0:00:31
      541500 -- [-775.849] (-775.900) (-777.604) (-775.525) * (-777.910) (-775.349) (-776.837) [-775.675] -- 0:00:31
      542000 -- (-775.370) [-778.265] (-778.375) (-776.462) * (-775.556) [-773.074] (-777.508) (-776.220) -- 0:00:31
      542500 -- (-776.620) [-776.138] (-777.635) (-775.831) * (-776.106) (-775.000) [-775.667] (-772.503) -- 0:00:31
      543000 -- (-775.745) (-773.816) [-774.822] (-780.520) * (-775.589) (-775.456) [-776.427] (-775.784) -- 0:00:31
      543500 -- [-776.479] (-780.198) (-775.271) (-775.036) * (-778.180) [-773.354] (-776.272) (-773.724) -- 0:00:31
      544000 -- (-774.127) (-773.961) [-775.990] (-775.110) * [-776.570] (-775.444) (-777.917) (-773.440) -- 0:00:31
      544500 -- [-774.000] (-778.723) (-783.052) (-774.329) * (-778.913) (-776.103) (-777.333) [-776.902] -- 0:00:30
      545000 -- [-777.279] (-778.385) (-775.605) (-775.983) * (-776.058) (-776.039) [-772.837] (-773.308) -- 0:00:30

      Average standard deviation of split frequencies: 0.010451

      545500 -- (-777.056) [-777.377] (-777.057) (-773.792) * (-775.017) (-779.513) (-776.913) [-775.454] -- 0:00:30
      546000 -- (-776.626) (-777.484) (-776.802) [-774.268] * (-777.334) [-778.819] (-774.599) (-776.969) -- 0:00:30
      546500 -- (-775.417) (-776.371) (-776.082) [-774.571] * [-776.759] (-779.528) (-776.496) (-775.369) -- 0:00:30
      547000 -- (-778.591) (-775.551) [-774.729] (-775.655) * (-780.814) (-776.070) [-776.021] (-772.448) -- 0:00:30
      547500 -- [-773.250] (-780.544) (-775.008) (-776.584) * (-774.545) (-775.632) [-774.845] (-775.075) -- 0:00:30
      548000 -- (-774.376) [-777.261] (-775.961) (-774.106) * (-778.636) (-776.370) [-774.551] (-773.159) -- 0:00:30
      548500 -- (-775.474) (-775.163) [-776.463] (-777.682) * (-777.704) (-778.162) [-773.623] (-779.614) -- 0:00:30
      549000 -- (-775.651) (-775.112) [-779.215] (-779.068) * (-774.665) (-775.530) [-774.486] (-781.177) -- 0:00:30
      549500 -- (-775.679) (-775.136) [-776.195] (-778.089) * [-776.908] (-774.125) (-778.421) (-777.890) -- 0:00:30
      550000 -- [-776.527] (-775.164) (-777.884) (-777.422) * [-774.359] (-774.913) (-778.345) (-776.955) -- 0:00:30

      Average standard deviation of split frequencies: 0.011081

      550500 -- [-777.782] (-774.808) (-774.075) (-779.146) * (-775.131) (-775.277) (-773.851) [-782.550] -- 0:00:30
      551000 -- (-777.076) (-778.342) (-779.570) [-777.498] * [-777.206] (-775.828) (-775.196) (-775.875) -- 0:00:30
      551500 -- [-773.244] (-776.785) (-777.739) (-776.585) * [-774.834] (-779.580) (-777.576) (-774.024) -- 0:00:30
      552000 -- (-776.979) [-776.818] (-778.138) (-777.162) * (-775.294) (-776.556) (-776.536) [-772.838] -- 0:00:30
      552500 -- [-776.087] (-776.517) (-776.651) (-777.433) * [-775.409] (-778.853) (-776.631) (-774.970) -- 0:00:29
      553000 -- [-776.116] (-775.684) (-775.296) (-776.589) * (-774.943) (-777.422) [-777.482] (-777.142) -- 0:00:29
      553500 -- (-775.590) [-776.667] (-775.511) (-775.803) * (-776.183) [-777.240] (-775.492) (-776.317) -- 0:00:29
      554000 -- [-774.981] (-775.807) (-775.391) (-776.931) * [-780.085] (-775.407) (-777.458) (-773.500) -- 0:00:29
      554500 -- (-781.439) (-773.115) [-775.157] (-775.523) * (-776.642) (-776.355) (-776.785) [-774.180] -- 0:00:29
      555000 -- (-776.949) (-774.960) (-775.310) [-775.726] * [-780.934] (-778.661) (-773.856) (-775.919) -- 0:00:29

      Average standard deviation of split frequencies: 0.010504

      555500 -- [-775.159] (-773.476) (-775.845) (-777.383) * (-780.209) (-778.642) [-777.203] (-777.239) -- 0:00:30
      556000 -- (-775.128) (-775.169) (-775.152) [-775.202] * (-775.778) (-776.937) (-776.896) [-776.077] -- 0:00:30
      556500 -- (-777.445) [-773.150] (-775.983) (-776.534) * [-775.261] (-778.577) (-774.797) (-774.668) -- 0:00:30
      557000 -- (-775.259) (-778.065) (-777.442) [-775.034] * [-774.056] (-776.025) (-779.474) (-778.424) -- 0:00:30
      557500 -- (-774.682) (-774.520) (-775.556) [-777.923] * (-775.660) [-776.811] (-777.677) (-774.456) -- 0:00:30
      558000 -- [-775.896] (-781.149) (-775.624) (-778.641) * (-775.361) (-778.968) (-778.800) [-777.527] -- 0:00:30
      558500 -- [-775.928] (-776.978) (-776.528) (-776.769) * (-775.728) (-783.270) (-776.926) [-774.507] -- 0:00:30
      559000 -- (-776.728) (-775.570) [-776.557] (-776.474) * (-777.257) (-780.631) (-776.359) [-775.081] -- 0:00:29
      559500 -- [-776.483] (-776.373) (-777.150) (-775.043) * (-777.773) (-779.532) [-775.906] (-774.022) -- 0:00:29
      560000 -- (-775.050) (-777.920) [-776.277] (-775.215) * (-777.482) [-774.839] (-775.452) (-778.154) -- 0:00:29

      Average standard deviation of split frequencies: 0.011024

      560500 -- [-772.076] (-776.155) (-775.728) (-777.993) * (-776.576) (-777.331) (-776.024) [-778.758] -- 0:00:29
      561000 -- [-775.010] (-775.951) (-777.378) (-773.794) * (-773.981) (-775.587) [-775.226] (-775.510) -- 0:00:29
      561500 -- (-774.726) (-775.490) (-776.428) [-774.570] * (-777.038) [-779.767] (-777.413) (-773.714) -- 0:00:29
      562000 -- (-775.114) (-778.013) (-775.236) [-772.888] * (-779.869) (-775.395) [-775.759] (-778.315) -- 0:00:29
      562500 -- (-775.212) (-775.799) [-775.183] (-776.220) * (-782.082) (-777.180) [-776.991] (-778.055) -- 0:00:29
      563000 -- [-777.421] (-776.132) (-778.373) (-776.288) * (-772.870) (-773.149) (-779.147) [-776.086] -- 0:00:29
      563500 -- [-776.920] (-775.564) (-774.848) (-776.917) * (-775.453) [-777.352] (-778.259) (-773.938) -- 0:00:29
      564000 -- (-774.109) (-777.284) (-774.867) [-774.757] * (-773.732) (-777.070) [-777.744] (-779.459) -- 0:00:29
      564500 -- (-778.999) (-775.207) (-776.412) [-774.967] * (-776.114) (-777.383) [-776.673] (-778.171) -- 0:00:29
      565000 -- (-774.959) [-775.770] (-775.115) (-774.634) * (-779.880) [-777.891] (-779.966) (-778.745) -- 0:00:29

      Average standard deviation of split frequencies: 0.010214

      565500 -- [-773.393] (-775.125) (-778.285) (-775.178) * [-774.694] (-777.079) (-776.231) (-779.687) -- 0:00:29
      566000 -- (-776.809) (-779.239) (-774.451) [-773.319] * (-773.800) [-776.132] (-775.676) (-776.282) -- 0:00:29
      566500 -- (-774.150) [-775.403] (-776.227) (-775.594) * (-775.480) (-776.957) [-774.657] (-775.728) -- 0:00:29
      567000 -- (-774.420) (-775.736) (-775.854) [-775.173] * (-777.808) (-776.108) (-776.078) [-774.412] -- 0:00:29
      567500 -- (-773.828) (-775.718) (-776.254) [-775.858] * [-777.473] (-776.948) (-779.313) (-775.847) -- 0:00:28
      568000 -- (-778.385) (-776.421) (-778.075) [-777.864] * [-773.935] (-777.815) (-775.344) (-782.242) -- 0:00:28
      568500 -- [-775.639] (-775.745) (-779.284) (-777.186) * (-772.338) [-776.679] (-781.208) (-781.405) -- 0:00:28
      569000 -- [-777.000] (-775.981) (-775.815) (-777.247) * (-776.791) (-777.919) [-775.595] (-776.397) -- 0:00:28
      569500 -- [-777.783] (-774.281) (-780.805) (-778.866) * (-778.633) (-775.255) [-776.941] (-776.269) -- 0:00:28
      570000 -- (-775.397) [-774.903] (-779.009) (-779.798) * [-781.098] (-775.904) (-775.698) (-775.631) -- 0:00:29

      Average standard deviation of split frequencies: 0.010087

      570500 -- [-773.980] (-776.180) (-780.228) (-781.737) * (-777.955) (-775.601) (-772.128) [-776.996] -- 0:00:29
      571000 -- (-776.967) (-778.161) [-774.358] (-781.732) * [-773.922] (-777.811) (-777.262) (-775.541) -- 0:00:29
      571500 -- (-776.655) (-775.305) [-776.181] (-778.861) * (-775.903) (-775.001) [-779.536] (-779.776) -- 0:00:29
      572000 -- [-775.615] (-776.713) (-778.458) (-779.597) * (-775.384) (-775.174) [-777.489] (-777.242) -- 0:00:29
      572500 -- (-776.112) [-774.215] (-778.176) (-777.330) * (-777.493) (-777.105) [-774.148] (-775.614) -- 0:00:29
      573000 -- (-774.038) (-775.821) [-775.756] (-777.316) * [-773.821] (-774.337) (-777.210) (-775.429) -- 0:00:29
      573500 -- (-776.546) (-777.245) [-774.526] (-774.549) * [-776.501] (-777.226) (-775.695) (-776.128) -- 0:00:29
      574000 -- [-773.607] (-777.953) (-776.273) (-775.393) * [-776.666] (-776.415) (-777.253) (-778.493) -- 0:00:28
      574500 -- [-773.301] (-778.192) (-774.569) (-774.768) * (-775.883) [-774.599] (-775.532) (-778.631) -- 0:00:28
      575000 -- (-774.456) (-777.393) [-775.553] (-778.804) * [-776.061] (-775.947) (-774.637) (-779.523) -- 0:00:28

      Average standard deviation of split frequencies: 0.010036

      575500 -- (-777.681) [-776.561] (-776.295) (-775.018) * (-777.736) (-775.214) (-775.484) [-777.185] -- 0:00:28
      576000 -- (-772.162) [-775.975] (-774.946) (-776.502) * (-772.557) (-777.415) [-774.937] (-780.166) -- 0:00:28
      576500 -- [-772.915] (-776.291) (-772.517) (-776.949) * [-777.000] (-778.022) (-779.986) (-777.968) -- 0:00:28
      577000 -- (-778.029) (-776.166) (-775.804) [-774.664] * [-776.394] (-776.988) (-777.923) (-781.065) -- 0:00:28
      577500 -- (-779.104) (-775.280) [-774.466] (-776.783) * (-776.122) [-778.567] (-778.357) (-776.544) -- 0:00:28
      578000 -- (-775.537) (-775.105) (-773.913) [-775.806] * [-774.720] (-776.216) (-777.083) (-777.697) -- 0:00:28
      578500 -- (-775.073) [-777.436] (-774.477) (-775.594) * [-776.582] (-775.021) (-778.249) (-780.110) -- 0:00:28
      579000 -- (-776.636) (-779.399) (-774.996) [-777.853] * (-776.908) (-775.614) (-776.976) [-779.101] -- 0:00:28
      579500 -- (-777.038) (-779.736) [-776.007] (-777.948) * (-777.674) (-778.034) (-776.617) [-779.583] -- 0:00:28
      580000 -- (-774.510) (-780.116) (-774.569) [-773.795] * [-774.743] (-776.562) (-775.986) (-775.535) -- 0:00:28

      Average standard deviation of split frequencies: 0.009607

      580500 -- (-776.233) [-775.731] (-774.407) (-774.819) * [-779.034] (-776.525) (-774.741) (-777.868) -- 0:00:28
      581000 -- [-774.776] (-776.711) (-775.078) (-774.957) * (-778.940) (-775.297) [-775.246] (-777.629) -- 0:00:28
      581500 -- [-776.227] (-776.682) (-776.341) (-776.390) * (-775.762) [-776.345] (-775.998) (-775.894) -- 0:00:28
      582000 -- [-776.009] (-777.473) (-779.591) (-774.377) * (-775.121) (-779.207) (-775.906) [-773.655] -- 0:00:28
      582500 -- (-775.836) (-775.223) [-778.135] (-775.171) * (-778.833) (-776.705) [-771.963] (-775.895) -- 0:00:27
      583000 -- (-777.218) (-777.508) (-776.031) [-775.576] * (-778.893) (-776.485) [-776.368] (-778.525) -- 0:00:27
      583500 -- (-776.735) (-779.600) (-775.679) [-776.555] * (-776.274) (-775.543) [-775.649] (-779.814) -- 0:00:27
      584000 -- [-775.673] (-777.562) (-775.082) (-776.094) * (-778.848) (-775.435) (-775.771) [-776.744] -- 0:00:27
      584500 -- (-775.616) (-776.820) [-779.586] (-777.678) * (-774.582) (-779.368) [-776.709] (-778.926) -- 0:00:28
      585000 -- (-775.230) (-775.682) (-776.358) [-774.042] * (-777.236) [-775.474] (-775.788) (-776.632) -- 0:00:28

      Average standard deviation of split frequencies: 0.009206

      585500 -- (-775.182) (-780.633) (-774.826) [-777.145] * (-774.973) (-774.806) [-776.415] (-776.908) -- 0:00:28
      586000 -- (-779.436) (-779.190) [-774.583] (-777.384) * (-774.546) (-772.664) [-778.075] (-779.651) -- 0:00:28
      586500 -- (-773.829) (-775.118) (-776.882) [-775.991] * (-776.313) (-774.198) [-775.958] (-780.620) -- 0:00:28
      587000 -- [-774.691] (-776.042) (-775.659) (-773.059) * (-775.812) (-776.072) (-772.825) [-774.695] -- 0:00:28
      587500 -- (-776.479) (-778.829) [-780.078] (-775.715) * (-776.787) (-775.474) [-777.276] (-775.617) -- 0:00:28
      588000 -- [-776.592] (-775.354) (-778.728) (-777.861) * (-774.538) [-779.251] (-779.035) (-777.515) -- 0:00:28
      588500 -- [-776.064] (-776.043) (-776.098) (-775.500) * (-774.745) (-783.600) (-773.773) [-775.565] -- 0:00:27
      589000 -- [-777.112] (-774.922) (-775.057) (-775.862) * [-775.498] (-776.279) (-776.654) (-775.665) -- 0:00:27
      589500 -- [-782.896] (-781.687) (-774.959) (-776.364) * [-782.178] (-776.664) (-775.382) (-777.400) -- 0:00:27
      590000 -- (-777.807) (-776.473) (-776.755) [-779.627] * (-775.788) [-774.582] (-775.807) (-776.895) -- 0:00:27

      Average standard deviation of split frequencies: 0.009400

      590500 -- (-780.292) (-773.735) [-775.463] (-775.917) * (-780.480) [-775.762] (-776.058) (-778.673) -- 0:00:27
      591000 -- (-774.861) [-774.480] (-781.220) (-774.698) * (-778.220) (-775.728) (-776.901) [-775.863] -- 0:00:27
      591500 -- (-778.086) (-775.335) (-776.791) [-774.594] * (-775.763) (-776.094) [-776.035] (-775.989) -- 0:00:27
      592000 -- (-775.506) [-777.034] (-778.235) (-780.005) * [-776.864] (-776.735) (-776.257) (-776.276) -- 0:00:27
      592500 -- (-779.240) (-775.411) [-776.426] (-775.373) * (-781.741) (-777.596) (-777.355) [-774.786] -- 0:00:27
      593000 -- (-777.291) (-775.093) (-777.229) [-776.143] * (-777.987) (-776.197) (-775.674) [-775.062] -- 0:00:27
      593500 -- (-774.424) [-777.113] (-775.419) (-776.101) * (-774.685) (-776.476) [-775.335] (-781.972) -- 0:00:27
      594000 -- (-777.035) (-780.008) [-777.936] (-776.111) * (-775.202) [-778.642] (-775.834) (-772.923) -- 0:00:27
      594500 -- (-775.123) (-777.311) [-774.286] (-778.522) * [-778.655] (-777.174) (-775.722) (-776.336) -- 0:00:27
      595000 -- (-775.332) [-776.354] (-777.534) (-780.478) * (-779.268) (-778.366) [-776.380] (-776.578) -- 0:00:27

      Average standard deviation of split frequencies: 0.009184

      595500 -- (-778.419) (-777.674) [-778.421] (-776.495) * [-774.447] (-777.280) (-775.496) (-778.634) -- 0:00:27
      596000 -- (-775.289) [-774.112] (-776.199) (-774.402) * (-775.812) [-774.499] (-776.676) (-777.729) -- 0:00:27
      596500 -- (-776.295) (-780.925) [-776.678] (-775.733) * [-775.670] (-774.054) (-777.855) (-779.505) -- 0:00:27
      597000 -- (-777.541) (-778.201) [-775.646] (-775.346) * (-774.689) (-781.874) [-772.258] (-777.306) -- 0:00:27
      597500 -- (-778.460) (-773.567) (-777.473) [-775.693] * (-776.829) (-780.221) [-773.885] (-776.527) -- 0:00:26
      598000 -- (-775.429) [-775.198] (-776.097) (-776.481) * (-775.626) (-783.585) [-774.683] (-778.160) -- 0:00:26
      598500 -- [-780.914] (-775.014) (-776.450) (-776.783) * (-776.893) [-774.696] (-776.250) (-777.662) -- 0:00:26
      599000 -- (-780.907) (-781.316) [-779.627] (-777.241) * (-776.176) (-774.277) (-775.757) [-775.968] -- 0:00:26
      599500 -- (-778.138) [-776.732] (-776.384) (-780.377) * (-775.872) [-777.062] (-775.928) (-775.317) -- 0:00:26
      600000 -- [-776.174] (-776.190) (-777.500) (-780.100) * [-776.707] (-777.235) (-778.555) (-775.430) -- 0:00:26

      Average standard deviation of split frequencies: 0.008764

      600500 -- (-778.396) [-773.479] (-775.431) (-776.259) * [-776.096] (-776.548) (-775.580) (-777.642) -- 0:00:27
      601000 -- (-776.199) (-776.485) (-775.903) [-778.303] * (-779.499) (-776.485) (-775.282) [-775.594] -- 0:00:27
      601500 -- (-775.817) [-775.872] (-778.503) (-777.655) * (-778.317) [-776.742] (-776.655) (-774.632) -- 0:00:27
      602000 -- (-775.877) [-777.086] (-776.858) (-778.811) * [-777.840] (-775.631) (-774.620) (-777.394) -- 0:00:27
      602500 -- [-773.264] (-773.955) (-774.545) (-778.864) * (-777.561) (-775.094) [-776.501] (-777.165) -- 0:00:27
      603000 -- (-776.498) (-774.913) (-775.534) [-777.836] * (-777.123) [-775.693] (-775.604) (-774.442) -- 0:00:26
      603500 -- (-776.416) [-776.556] (-775.100) (-774.157) * (-774.949) (-778.587) [-775.273] (-778.559) -- 0:00:26
      604000 -- (-776.008) [-773.889] (-772.200) (-775.776) * (-776.556) [-775.352] (-774.673) (-778.850) -- 0:00:26
      604500 -- (-778.793) (-776.448) [-778.044] (-778.193) * (-779.551) (-773.611) (-774.998) [-776.977] -- 0:00:26
      605000 -- [-775.372] (-774.780) (-776.801) (-775.781) * [-774.373] (-775.539) (-779.386) (-777.378) -- 0:00:26

      Average standard deviation of split frequencies: 0.008859

      605500 -- (-777.823) (-775.190) (-777.228) [-777.129] * (-779.000) [-774.798] (-781.233) (-778.638) -- 0:00:26
      606000 -- [-776.140] (-775.281) (-777.332) (-776.306) * [-774.563] (-779.090) (-776.881) (-775.492) -- 0:00:26
      606500 -- (-776.008) [-775.461] (-779.405) (-776.623) * (-774.995) [-774.745] (-776.939) (-780.245) -- 0:00:26
      607000 -- (-774.831) (-776.074) [-775.905] (-776.130) * [-773.976] (-779.573) (-775.214) (-777.036) -- 0:00:26
      607500 -- [-774.939] (-776.742) (-778.270) (-775.662) * (-776.664) (-775.198) (-777.491) [-775.391] -- 0:00:26
      608000 -- (-775.838) (-782.909) [-775.335] (-774.885) * (-778.254) (-776.736) [-777.657] (-782.993) -- 0:00:26
      608500 -- (-775.787) (-775.143) (-777.158) [-775.309] * (-774.972) (-774.713) [-773.806] (-779.883) -- 0:00:26
      609000 -- (-776.189) [-776.242] (-779.130) (-776.316) * (-775.686) [-776.423] (-774.558) (-777.241) -- 0:00:26
      609500 -- (-776.221) (-774.399) [-778.912] (-775.815) * [-775.988] (-776.112) (-775.011) (-775.701) -- 0:00:26
      610000 -- (-776.795) (-775.174) [-775.372] (-776.218) * (-776.824) (-775.868) (-775.333) [-773.073] -- 0:00:26

      Average standard deviation of split frequencies: 0.007679

      610500 -- (-776.161) (-776.817) [-774.948] (-781.368) * (-777.437) (-778.516) (-774.684) [-777.947] -- 0:00:26
      611000 -- (-775.578) [-777.200] (-775.401) (-775.109) * (-778.134) [-777.266] (-775.997) (-776.341) -- 0:00:26
      611500 -- (-775.620) [-776.439] (-776.079) (-774.449) * (-774.982) (-773.370) [-777.081] (-780.085) -- 0:00:26
      612000 -- [-777.546] (-775.754) (-777.321) (-774.862) * (-775.190) [-777.465] (-779.460) (-776.942) -- 0:00:25
      612500 -- (-775.428) [-774.258] (-779.457) (-776.516) * (-778.329) (-781.290) (-776.717) [-773.911] -- 0:00:25
      613000 -- [-775.440] (-777.090) (-779.924) (-778.794) * (-775.852) (-774.804) [-780.815] (-775.984) -- 0:00:25
      613500 -- (-773.679) (-776.092) (-778.356) [-776.314] * (-773.617) [-777.294] (-774.867) (-775.243) -- 0:00:25
      614000 -- (-777.224) (-774.479) (-777.124) [-778.843] * (-774.441) (-777.040) [-776.250] (-775.340) -- 0:00:25
      614500 -- (-778.003) (-774.859) [-779.235] (-775.211) * (-776.902) [-777.938] (-775.396) (-774.157) -- 0:00:25
      615000 -- (-777.302) (-775.903) [-780.244] (-776.781) * [-772.750] (-778.312) (-777.176) (-775.874) -- 0:00:25

      Average standard deviation of split frequencies: 0.007693

      615500 -- (-774.858) (-774.731) [-781.731] (-779.217) * (-779.053) (-778.505) (-776.806) [-774.845] -- 0:00:25
      616000 -- (-776.620) [-774.764] (-775.915) (-778.848) * (-782.001) (-775.818) (-780.478) [-775.473] -- 0:00:26
      616500 -- (-774.109) [-775.234] (-776.374) (-779.835) * (-782.172) (-775.680) [-774.748] (-775.338) -- 0:00:26
      617000 -- (-778.003) (-777.577) [-777.329] (-777.872) * (-778.133) (-783.281) (-777.036) [-774.946] -- 0:00:26
      617500 -- (-775.960) (-775.169) [-776.156] (-775.200) * (-774.609) (-776.536) [-773.801] (-776.585) -- 0:00:26
      618000 -- [-774.066] (-778.003) (-775.452) (-780.140) * (-774.797) (-772.611) (-777.028) [-775.269] -- 0:00:25
      618500 -- [-775.480] (-776.700) (-776.438) (-777.402) * (-776.021) (-777.715) [-776.590] (-778.763) -- 0:00:25
      619000 -- (-778.335) (-775.154) (-775.731) [-779.018] * (-773.605) (-775.440) [-776.256] (-776.882) -- 0:00:25
      619500 -- (-777.811) [-775.840] (-774.685) (-781.773) * (-778.591) (-778.438) (-775.219) [-778.097] -- 0:00:25
      620000 -- (-780.101) [-777.272] (-774.711) (-780.131) * (-776.835) (-774.599) [-773.302] (-775.096) -- 0:00:25

      Average standard deviation of split frequencies: 0.007435

      620500 -- (-775.614) [-775.871] (-775.857) (-780.435) * [-774.936] (-779.725) (-775.448) (-774.615) -- 0:00:25
      621000 -- (-776.491) (-774.956) [-775.975] (-777.460) * (-777.441) (-774.918) (-774.375) [-774.452] -- 0:00:25
      621500 -- (-778.167) (-775.503) (-779.968) [-777.215] * [-775.169] (-780.871) (-778.389) (-774.122) -- 0:00:25
      622000 -- [-776.773] (-779.631) (-779.210) (-775.408) * (-778.971) (-777.406) [-777.148] (-775.281) -- 0:00:25
      622500 -- [-776.529] (-781.527) (-776.432) (-773.731) * [-772.322] (-776.766) (-775.950) (-776.984) -- 0:00:25
      623000 -- (-774.808) [-775.646] (-775.345) (-776.598) * (-775.003) (-773.239) (-777.210) [-777.060] -- 0:00:25
      623500 -- (-775.691) [-776.137] (-783.285) (-777.179) * [-776.562] (-779.442) (-777.211) (-775.989) -- 0:00:25
      624000 -- (-777.270) (-775.262) [-778.838] (-780.139) * (-775.178) [-776.536] (-774.454) (-781.466) -- 0:00:25
      624500 -- (-783.272) (-773.815) (-776.847) [-774.735] * [-772.933] (-774.461) (-774.807) (-775.056) -- 0:00:25
      625000 -- (-776.755) [-772.833] (-775.580) (-776.421) * (-775.788) [-779.215] (-775.284) (-775.885) -- 0:00:25

      Average standard deviation of split frequencies: 0.007570

      625500 -- [-783.745] (-776.253) (-774.148) (-775.405) * (-774.318) (-779.312) (-777.896) [-777.752] -- 0:00:25
      626000 -- (-779.990) (-774.858) [-775.965] (-776.312) * [-775.535] (-775.688) (-777.621) (-784.065) -- 0:00:25
      626500 -- (-774.927) [-775.697] (-783.981) (-775.933) * [-772.411] (-780.016) (-775.646) (-776.944) -- 0:00:25
      627000 -- (-778.370) (-776.827) (-776.307) [-775.267] * (-778.186) (-778.061) (-775.495) [-776.278] -- 0:00:24
      627500 -- (-779.039) [-779.722] (-773.304) (-775.842) * (-777.350) [-775.565] (-777.272) (-776.473) -- 0:00:24
      628000 -- (-775.495) [-775.204] (-775.910) (-775.941) * (-780.624) [-776.065] (-779.898) (-777.309) -- 0:00:24
      628500 -- (-774.935) [-775.188] (-775.564) (-776.953) * [-776.679] (-777.327) (-774.400) (-784.754) -- 0:00:24
      629000 -- (-774.881) (-777.178) [-773.258] (-777.075) * (-776.036) (-778.953) (-774.247) [-774.853] -- 0:00:24
      629500 -- (-777.385) (-773.050) [-774.259] (-776.929) * (-776.586) (-774.629) [-773.378] (-778.231) -- 0:00:24
      630000 -- (-775.655) (-778.696) [-776.197] (-779.126) * [-774.446] (-775.696) (-774.429) (-777.023) -- 0:00:24

      Average standard deviation of split frequencies: 0.007003

      630500 -- [-779.210] (-777.240) (-776.594) (-776.588) * (-772.215) [-778.562] (-774.093) (-777.435) -- 0:00:24
      631000 -- (-777.291) (-778.346) (-777.164) [-777.679] * (-775.135) [-776.333] (-773.011) (-774.870) -- 0:00:25
      631500 -- [-777.665] (-777.568) (-776.137) (-776.828) * (-775.545) (-775.518) (-772.969) [-777.956] -- 0:00:25
      632000 -- (-780.803) [-775.384] (-776.025) (-775.027) * (-775.298) (-776.349) [-776.542] (-776.278) -- 0:00:25
      632500 -- (-777.333) (-777.074) [-774.329] (-776.019) * (-776.823) (-775.918) [-774.477] (-777.872) -- 0:00:24
      633000 -- (-779.688) [-774.626] (-779.768) (-776.491) * (-776.637) (-777.286) [-777.385] (-779.856) -- 0:00:24
      633500 -- [-776.798] (-777.616) (-778.908) (-779.148) * (-775.608) (-774.029) [-774.642] (-780.696) -- 0:00:24
      634000 -- (-775.321) (-775.482) (-777.096) [-773.673] * (-777.524) (-775.562) (-776.963) [-779.621] -- 0:00:24
      634500 -- (-776.171) [-775.895] (-778.112) (-775.614) * (-776.255) [-778.286] (-774.656) (-777.141) -- 0:00:24
      635000 -- (-777.201) [-779.131] (-778.061) (-774.839) * [-775.777] (-778.304) (-771.295) (-779.308) -- 0:00:24

      Average standard deviation of split frequencies: 0.007295

      635500 -- (-775.964) [-776.601] (-776.940) (-774.676) * (-778.958) (-775.810) [-774.535] (-775.999) -- 0:00:24
      636000 -- [-776.769] (-776.343) (-775.923) (-774.784) * (-775.568) [-774.688] (-772.370) (-776.527) -- 0:00:24
      636500 -- (-775.976) (-776.229) (-775.370) [-775.563] * [-774.562] (-774.576) (-775.479) (-776.088) -- 0:00:24
      637000 -- [-775.087] (-777.625) (-773.862) (-779.778) * (-775.599) (-776.174) [-771.779] (-777.750) -- 0:00:24
      637500 -- (-775.493) (-779.951) [-773.788] (-773.874) * (-775.301) (-776.603) [-773.742] (-775.221) -- 0:00:24
      638000 -- (-780.012) (-779.410) (-775.534) [-775.380] * [-775.525] (-773.877) (-776.062) (-778.736) -- 0:00:24
      638500 -- (-779.115) [-775.410] (-776.670) (-776.385) * (-775.119) [-774.990] (-776.716) (-776.914) -- 0:00:24
      639000 -- (-778.463) (-778.297) [-775.873] (-773.877) * [-776.192] (-775.658) (-774.924) (-775.736) -- 0:00:24
      639500 -- (-775.733) (-775.284) (-779.337) [-773.820] * (-775.523) (-775.505) [-776.579] (-776.578) -- 0:00:24
      640000 -- (-774.941) (-776.611) [-776.441] (-779.198) * [-778.096] (-772.359) (-776.396) (-778.591) -- 0:00:24

      Average standard deviation of split frequencies: 0.006971

      640500 -- (-776.373) [-775.361] (-776.374) (-775.783) * [-773.305] (-775.977) (-777.693) (-778.623) -- 0:00:24
      641000 -- [-776.351] (-778.056) (-778.664) (-775.782) * [-774.321] (-774.659) (-777.823) (-777.711) -- 0:00:24
      641500 -- (-777.296) (-775.732) [-777.073] (-777.054) * (-775.416) [-774.823] (-773.301) (-776.368) -- 0:00:24
      642000 -- (-775.985) [-777.229] (-774.755) (-774.151) * (-777.633) (-777.645) [-775.464] (-776.937) -- 0:00:23
      642500 -- (-778.304) (-775.903) (-777.081) [-773.943] * (-778.988) [-777.076] (-775.537) (-776.439) -- 0:00:23
      643000 -- (-777.423) (-774.408) [-776.520] (-775.824) * [-775.352] (-775.618) (-775.509) (-780.134) -- 0:00:23
      643500 -- (-776.966) [-776.500] (-776.155) (-776.837) * [-775.150] (-778.242) (-775.807) (-776.066) -- 0:00:23
      644000 -- [-781.053] (-777.808) (-777.128) (-775.213) * (-775.516) (-772.847) (-776.949) [-772.511] -- 0:00:23
      644500 -- (-776.155) [-775.806] (-774.474) (-774.831) * (-774.878) (-775.090) [-779.418] (-777.308) -- 0:00:23
      645000 -- (-775.006) (-775.174) (-774.551) [-774.589] * (-774.965) [-774.483] (-779.091) (-775.076) -- 0:00:23

      Average standard deviation of split frequencies: