--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:43:56 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2597/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -774.75 -778.73
2 -774.79 -779.57
--------------------------------------
TOTAL -774.77 -779.24
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.879773 0.085655 0.364706 1.476927 0.845244 1252.48 1315.97 1.000
r(A<->C){all} 0.215161 0.027339 0.000178 0.549487 0.178947 92.43 117.93 1.000
r(A<->G){all} 0.158514 0.017693 0.000034 0.422680 0.121409 76.54 109.17 1.007
r(A<->T){all} 0.159559 0.018818 0.000184 0.440421 0.121461 120.03 211.53 1.000
r(C<->G){all} 0.147746 0.018187 0.000073 0.433683 0.107325 134.46 171.31 1.000
r(C<->T){all} 0.156657 0.018824 0.000048 0.431481 0.118020 300.04 329.18 1.001
r(G<->T){all} 0.162363 0.018986 0.000091 0.437445 0.123311 158.57 169.16 1.000
pi(A){all} 0.237426 0.000329 0.201026 0.270441 0.237503 1087.71 1253.96 1.000
pi(C){all} 0.270127 0.000351 0.234164 0.305977 0.269659 1360.34 1365.13 1.000
pi(G){all} 0.288938 0.000368 0.252900 0.327061 0.288708 1187.18 1229.39 1.001
pi(T){all} 0.203508 0.000279 0.172473 0.236869 0.203391 1314.10 1335.52 1.000
alpha{1,2} 0.398773 0.210979 0.000265 1.351137 0.238669 1105.59 1303.29 1.000
alpha{3} 0.410201 0.229376 0.000204 1.357471 0.244667 941.52 1022.18 1.000
pinvar{all} 0.994047 0.000028 0.984409 0.999921 0.995508 1472.70 1486.85 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -750.842868
Model 2: PositiveSelection -744.940674
Model 0: one-ratio -750.398051
Model 7: beta -750.405893
Model 8: beta&w>1 -744.940673
Model 0 vs 1 0.8896339999998872
Model 2 vs 1 11.804388000000017
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634449_1_2779_MLBR_RS13225)
Pr(w>1) post mean +- SE for w
151 S 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634449_1_2779_MLBR_RS13225)
Pr(w>1) post mean +- SE for w
151 S 0.918 6.617 +- 2.947
Model 8 vs 7 10.93044000000009
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634449_1_2779_MLBR_RS13225)
Pr(w>1) post mean +- SE for w
151 S 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634449_1_2779_MLBR_RS13225)
Pr(w>1) post mean +- SE for w
151 S 0.965* 6.516 +- 2.779
>C1
MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
>C2
MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
YPDEKQVLENTNRWTATATREGNQWKISNLLQVI
>C3
MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
>C4
MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
>C5
MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
YPDEKQVLENTNRWTATATREGNQWKISNLLQVI
>C6
MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=184
C1 MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
C2 MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
C3 MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
C4 MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
C5 MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
C6 MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
**************************************************
C1 ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
C2 ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
C3 ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
C4 ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
C5 ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
C6 ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
**************************************************
C1 AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
C2 AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
C3 AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
C4 AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
C5 AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
C6 AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
**************************************************
C1 SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
C2 YPDEKQVLENTNRWTATATREGNQWKISNLLQVI
C3 SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
C4 SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
C5 YPDEKQVLENTNRWTATATREGNQWKISNLLQVI
C6 SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
*********************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5520]--->[5520]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.476 Mb, Max= 30.724 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
C2 MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
C3 MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
C4 MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
C5 MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
C6 MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
**************************************************
C1 ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
C2 ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
C3 ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
C4 ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
C5 ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
C6 ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
**************************************************
C1 AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
C2 AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
C3 AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
C4 AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
C5 AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
C6 AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
**************************************************
C1 SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
C2 YPDEKQVLENTNRWTATATREGNQWKISNLLQVI
C3 SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
C4 SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
C5 YPDEKQVLENTNRWTATATREGNQWKISNLLQVI
C6 SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
*********************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 99.46 C1 C2 99.46
TOP 1 0 99.46 C2 C1 99.46
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 99.46 C1 C5 99.46
TOP 4 0 99.46 C5 C1 99.46
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 99.46 C2 C3 99.46
TOP 2 1 99.46 C3 C2 99.46
BOT 1 3 99.46 C2 C4 99.46
TOP 3 1 99.46 C4 C2 99.46
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 99.46 C2 C6 99.46
TOP 5 1 99.46 C6 C2 99.46
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 99.46 C3 C5 99.46
TOP 4 2 99.46 C5 C3 99.46
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 99.46 C4 C5 99.46
TOP 4 3 99.46 C5 C4 99.46
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 99.46 C5 C6 99.46
TOP 5 4 99.46 C6 C5 99.46
AVG 0 C1 * 99.78
AVG 1 C2 * 99.57
AVG 2 C3 * 99.78
AVG 3 C4 * 99.78
AVG 4 C5 * 99.57
AVG 5 C6 * 99.78
TOT TOT * 99.71
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC
C2 ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC
C3 ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC
C4 ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC
C5 ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC
C6 ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC
**************************************************
C1 GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT
C2 GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT
C3 GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT
C4 GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT
C5 GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT
C6 GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT
**************************************************
C1 TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG
C2 TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG
C3 TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG
C4 TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG
C5 TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG
C6 TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG
**************************************************
C1 ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT
C2 ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT
C3 ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT
C4 ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT
C5 ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT
C6 ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT
**************************************************
C1 CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC
C2 CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC
C3 CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC
C4 CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC
C5 CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC
C6 CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC
**************************************************
C1 ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC
C2 ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC
C3 ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC
C4 ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC
C5 ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC
C6 ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC
**************************************************
C1 GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA
C2 GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA
C3 GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA
C4 GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA
C5 GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA
C6 GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA
**************************************************
C1 AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA
C2 AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA
C3 AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA
C4 AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA
C5 AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA
C6 AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA
**************************************************
C1 ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG
C2 ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG
C3 ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG
C4 ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG
C5 ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG
C6 ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG
**************************************************
C1 TCTCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC
C2 TATCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC
C3 TCTCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC
C4 TCTCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC
C5 TATCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC
C6 TCTCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC
*.************************************************
C1 CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA
C2 CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA
C3 CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA
C4 CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA
C5 CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA
C6 CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA
**************************************************
C1 TC
C2 TC
C3 TC
C4 TC
C5 TC
C6 TC
**
>C1
ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC
GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT
TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG
ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT
CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC
ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC
GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA
AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA
ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG
TCTCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC
CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA
TC
>C2
ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC
GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT
TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG
ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT
CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC
ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC
GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA
AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA
ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG
TATCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC
CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA
TC
>C3
ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC
GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT
TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG
ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT
CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC
ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC
GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA
AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA
ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG
TCTCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC
CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA
TC
>C4
ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC
GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT
TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG
ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT
CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC
ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC
GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA
AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA
ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG
TCTCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC
CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA
TC
>C5
ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC
GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT
TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG
ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT
CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC
ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC
GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA
AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA
ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG
TATCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC
CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA
TC
>C6
ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC
GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT
TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG
ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT
CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC
ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC
GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA
AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA
ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG
TCTCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC
CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA
TC
>C1
MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
>C2
MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
YPDEKQVLENTNRWTATATREGNQWKISNLLQVI
>C3
MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
>C4
MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
>C5
MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
YPDEKQVLENTNRWTATATREGNQWKISNLLQVI
>C6
MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 552 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579858930
Setting output file names to "/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 2133842622
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5286680284
Seed = 762963646
Swapseed = 1579858930
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 5 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1238.768122 -- -24.965149
Chain 2 -- -1238.769747 -- -24.965149
Chain 3 -- -1238.769676 -- -24.965149
Chain 4 -- -1242.072960 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1242.072960 -- -24.965149
Chain 2 -- -1241.436114 -- -24.965149
Chain 3 -- -1242.072889 -- -24.965149
Chain 4 -- -1238.768122 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1238.768] (-1238.770) (-1238.770) (-1242.073) * [-1242.073] (-1241.436) (-1242.073) (-1238.768)
500 -- (-787.880) (-779.887) (-786.505) [-777.411] * (-780.300) [-776.995] (-781.522) (-779.199) -- 0:00:00
1000 -- (-782.232) [-775.321] (-782.742) (-781.723) * (-782.722) [-775.774] (-780.654) (-775.602) -- 0:00:00
1500 -- (-778.993) [-775.316] (-792.847) (-779.837) * [-780.924] (-782.678) (-779.934) (-777.694) -- 0:00:00
2000 -- [-775.057] (-787.021) (-778.565) (-780.339) * [-777.565] (-789.441) (-776.263) (-782.134) -- 0:00:00
2500 -- (-779.957) (-777.946) [-775.081] (-776.992) * [-776.323] (-783.298) (-782.851) (-779.114) -- 0:00:00
3000 -- [-778.290] (-778.957) (-777.857) (-789.246) * [-778.928] (-778.960) (-778.275) (-774.319) -- 0:00:00
3500 -- (-783.377) (-779.440) (-785.003) [-773.592] * (-779.807) [-773.080] (-786.220) (-779.817) -- 0:00:00
4000 -- (-775.746) (-787.729) [-783.066] (-780.897) * [-784.554] (-779.964) (-776.409) (-782.559) -- 0:00:00
4500 -- (-781.730) [-783.528] (-777.882) (-786.932) * (-787.574) (-792.100) [-783.756] (-776.343) -- 0:00:00
5000 -- (-780.564) [-781.878] (-781.289) (-781.264) * (-775.136) [-786.178] (-783.440) (-777.586) -- 0:00:00
Average standard deviation of split frequencies: 0.125708
5500 -- [-778.782] (-785.686) (-793.107) (-779.626) * [-780.496] (-779.857) (-805.993) (-781.335) -- 0:00:00
6000 -- (-774.266) [-779.538] (-777.581) (-778.337) * (-782.712) [-782.583] (-793.561) (-783.360) -- 0:00:00
6500 -- (-775.695) (-789.534) (-779.391) [-776.408] * (-774.082) (-782.062) (-782.511) [-777.248] -- 0:00:00
7000 -- (-775.299) [-778.482] (-792.103) (-781.643) * (-780.443) [-774.673] (-781.253) (-784.162) -- 0:00:00
7500 -- (-782.296) [-779.174] (-787.620) (-787.807) * [-779.467] (-778.365) (-789.080) (-778.762) -- 0:00:00
8000 -- (-778.060) [-777.488] (-774.839) (-782.566) * [-781.132] (-783.178) (-778.396) (-778.248) -- 0:02:04
8500 -- (-778.641) (-776.930) [-776.772] (-782.420) * (-776.316) [-777.976] (-776.002) (-782.061) -- 0:01:56
9000 -- (-784.704) [-776.301] (-774.648) (-784.039) * [-781.156] (-781.538) (-777.982) (-775.887) -- 0:01:50
9500 -- (-778.865) (-774.837) [-775.772] (-776.007) * [-779.719] (-782.212) (-778.013) (-786.155) -- 0:01:44
10000 -- (-781.678) (-778.038) [-776.797] (-775.683) * [-778.256] (-776.358) (-775.781) (-782.629) -- 0:01:39
Average standard deviation of split frequencies: 0.110485
10500 -- (-773.930) [-778.019] (-771.995) (-775.582) * (-779.824) (-786.162) (-777.381) [-777.286] -- 0:01:34
11000 -- (-774.342) (-776.934) (-771.426) [-775.673] * (-783.048) (-782.581) [-773.789] (-785.095) -- 0:01:29
11500 -- [-776.706] (-778.502) (-776.134) (-776.236) * (-776.743) (-780.907) (-775.831) [-778.763] -- 0:01:25
12000 -- (-773.808) (-784.355) [-774.313] (-772.630) * [-780.439] (-775.567) (-780.739) (-781.066) -- 0:01:22
12500 -- [-780.922] (-777.563) (-772.081) (-778.657) * (-783.273) [-776.005] (-775.871) (-791.173) -- 0:01:19
13000 -- (-779.297) [-776.418] (-776.566) (-777.492) * (-780.541) [-778.177] (-779.932) (-791.951) -- 0:01:15
13500 -- [-777.640] (-778.302) (-775.162) (-775.172) * (-780.947) (-778.626) [-775.049] (-774.483) -- 0:01:13
14000 -- (-779.265) (-777.494) (-775.183) [-775.878] * (-777.248) [-780.097] (-776.411) (-777.087) -- 0:01:10
14500 -- (-782.150) (-775.592) (-780.379) [-772.477] * (-784.733) [-779.984] (-775.667) (-773.138) -- 0:01:07
15000 -- (-781.826) (-776.313) (-778.994) [-776.713] * (-781.614) [-778.963] (-774.518) (-774.648) -- 0:01:05
Average standard deviation of split frequencies: 0.074996
15500 -- [-773.732] (-777.047) (-784.370) (-775.786) * [-776.348] (-779.604) (-775.267) (-775.695) -- 0:01:03
16000 -- [-783.609] (-776.441) (-777.709) (-774.168) * (-787.687) [-780.553] (-777.583) (-774.946) -- 0:01:01
16500 -- (-779.755) (-778.560) [-777.865] (-779.503) * (-776.660) (-790.078) [-780.010] (-774.262) -- 0:00:59
17000 -- (-787.398) (-775.947) (-778.273) [-775.146] * (-778.311) (-786.324) (-777.687) [-774.788] -- 0:00:57
17500 -- [-780.625] (-781.750) (-776.454) (-776.743) * (-775.989) [-778.580] (-774.854) (-778.327) -- 0:00:56
18000 -- (-777.654) (-778.243) (-776.944) [-778.161] * (-778.467) (-775.961) (-775.022) [-776.440] -- 0:00:54
18500 -- (-782.589) (-775.967) (-774.859) [-778.827] * (-780.820) (-783.368) (-777.259) [-775.354] -- 0:00:53
19000 -- [-788.240] (-776.514) (-776.445) (-776.669) * (-779.891) [-796.630] (-776.849) (-775.929) -- 0:00:51
19500 -- (-773.043) [-777.081] (-774.717) (-777.978) * (-779.963) (-789.900) (-776.094) [-775.135] -- 0:00:50
20000 -- (-779.270) [-777.642] (-775.586) (-776.878) * [-787.077] (-775.123) (-776.445) (-775.451) -- 0:00:49
Average standard deviation of split frequencies: 0.060826
20500 -- (-780.617) (-780.611) [-779.756] (-779.197) * (-778.564) (-776.394) (-775.870) [-777.140] -- 0:01:35
21000 -- [-774.783] (-775.703) (-776.697) (-775.566) * (-784.517) (-776.152) (-773.939) [-774.432] -- 0:01:33
21500 -- (-781.079) [-777.896] (-776.647) (-776.378) * [-778.888] (-776.549) (-781.955) (-775.913) -- 0:01:31
22000 -- (-781.100) [-776.450] (-776.599) (-775.360) * [-784.741] (-776.393) (-775.321) (-776.932) -- 0:01:28
22500 -- (-776.926) (-779.009) [-775.795] (-778.501) * [-778.805] (-775.305) (-775.668) (-775.306) -- 0:01:26
23000 -- (-781.908) (-776.702) (-778.683) [-777.054] * (-776.700) (-776.451) [-776.286] (-775.720) -- 0:01:24
23500 -- [-777.401] (-776.391) (-775.333) (-778.425) * [-779.755] (-775.610) (-775.751) (-775.911) -- 0:01:23
24000 -- (-779.662) (-775.119) (-775.754) [-777.116] * (-780.285) [-773.959] (-779.450) (-774.021) -- 0:01:21
24500 -- (-778.394) [-778.877] (-774.187) (-778.421) * (-788.711) (-776.701) (-773.382) [-775.594] -- 0:01:19
25000 -- (-777.658) (-776.614) (-780.745) [-778.716] * [-782.797] (-773.717) (-777.952) (-776.059) -- 0:01:18
Average standard deviation of split frequencies: 0.054393
25500 -- (-777.523) [-775.921] (-775.751) (-775.064) * (-784.099) (-776.551) (-776.270) [-775.060] -- 0:01:16
26000 -- [-775.389] (-776.578) (-775.640) (-775.438) * (-785.925) (-775.393) [-777.692] (-780.187) -- 0:01:14
26500 -- (-782.424) (-774.718) (-778.251) [-777.079] * (-782.827) [-775.657] (-777.434) (-775.872) -- 0:01:13
27000 -- (-778.286) [-774.594] (-773.678) (-777.871) * (-776.626) (-776.251) (-775.519) [-777.461] -- 0:01:12
27500 -- (-781.629) [-776.984] (-777.726) (-775.298) * (-776.701) [-776.397] (-775.931) (-780.696) -- 0:01:10
28000 -- (-781.972) (-776.229) (-775.561) [-776.639] * [-780.570] (-778.436) (-775.148) (-777.606) -- 0:01:09
28500 -- [-785.902] (-774.324) (-777.874) (-778.894) * [-775.939] (-779.611) (-775.264) (-778.046) -- 0:01:08
29000 -- [-790.130] (-776.480) (-779.056) (-777.454) * (-779.473) [-781.009] (-773.500) (-777.634) -- 0:01:06
29500 -- [-780.391] (-778.967) (-773.715) (-777.222) * (-779.205) [-777.286] (-775.055) (-775.380) -- 0:01:05
30000 -- (-780.700) (-778.103) (-774.807) [-778.743] * (-773.694) (-776.687) [-774.525] (-773.035) -- 0:01:04
Average standard deviation of split frequencies: 0.044307
30500 -- (-786.205) (-776.502) [-773.137] (-775.950) * (-781.753) [-776.411] (-775.224) (-776.352) -- 0:01:03
31000 -- [-781.549] (-773.756) (-772.623) (-777.367) * (-778.862) (-777.823) [-773.323] (-779.934) -- 0:01:02
31500 -- (-777.469) [-775.561] (-775.232) (-779.983) * (-786.561) (-778.405) (-775.741) [-774.376] -- 0:01:01
32000 -- (-779.539) (-775.690) (-774.862) [-776.770] * (-778.276) (-774.981) [-777.161] (-774.704) -- 0:01:00
32500 -- (-784.524) [-776.471] (-775.404) (-776.069) * (-776.538) (-775.048) (-775.648) [-775.376] -- 0:00:59
33000 -- (-779.827) (-776.498) (-774.769) [-773.682] * (-779.716) [-774.493] (-778.532) (-774.994) -- 0:00:58
33500 -- [-786.385] (-778.375) (-776.277) (-778.585) * [-781.248] (-777.063) (-776.816) (-775.922) -- 0:00:57
34000 -- [-779.675] (-776.615) (-776.276) (-778.058) * (-782.349) (-775.197) (-775.374) [-773.057] -- 0:00:56
34500 -- (-777.900) (-775.885) (-775.592) [-774.226] * (-780.136) [-775.281] (-774.814) (-775.329) -- 0:00:55
35000 -- [-778.631] (-775.487) (-773.950) (-774.926) * (-777.316) (-775.221) (-776.691) [-775.951] -- 0:00:55
Average standard deviation of split frequencies: 0.041154
35500 -- (-777.533) (-774.517) [-777.381] (-776.335) * [-776.183] (-780.795) (-775.696) (-777.868) -- 0:00:54
36000 -- (-773.965) (-773.440) (-774.002) [-775.832] * (-779.937) [-778.320] (-775.850) (-777.641) -- 0:01:20
36500 -- [-783.878] (-775.803) (-777.219) (-780.877) * [-773.963] (-775.047) (-775.416) (-775.142) -- 0:01:19
37000 -- (-787.460) (-775.092) (-776.375) [-776.505] * (-780.326) (-776.314) (-775.279) [-775.434] -- 0:01:18
37500 -- (-778.622) (-776.531) [-777.356] (-777.204) * [-780.761] (-775.734) (-775.208) (-776.426) -- 0:01:17
38000 -- (-788.013) (-778.382) [-776.805] (-775.643) * [-781.434] (-776.873) (-776.744) (-772.100) -- 0:01:15
38500 -- (-780.725) (-778.294) (-777.752) [-774.589] * (-779.060) (-776.570) [-774.976] (-776.557) -- 0:01:14
39000 -- (-784.703) (-775.134) (-773.707) [-773.403] * [-777.136] (-777.641) (-776.474) (-777.821) -- 0:01:13
39500 -- [-777.779] (-775.731) (-776.070) (-775.727) * [-781.774] (-776.575) (-774.821) (-775.320) -- 0:01:12
40000 -- (-786.382) (-775.137) [-773.724] (-779.241) * [-782.428] (-777.498) (-777.609) (-774.952) -- 0:01:12
Average standard deviation of split frequencies: 0.039744
40500 -- [-777.262] (-775.573) (-775.149) (-777.244) * [-781.892] (-775.350) (-776.808) (-777.260) -- 0:01:11
41000 -- [-779.376] (-774.206) (-776.150) (-777.429) * (-779.089) (-776.838) [-777.937] (-773.535) -- 0:01:10
41500 -- [-775.946] (-777.207) (-774.451) (-780.597) * (-782.861) [-777.005] (-776.440) (-775.531) -- 0:01:09
42000 -- [-780.044] (-779.100) (-777.139) (-775.183) * (-785.829) [-774.632] (-777.040) (-775.273) -- 0:01:08
42500 -- [-777.580] (-774.623) (-776.049) (-775.201) * (-782.176) (-775.845) [-772.178] (-781.242) -- 0:01:07
43000 -- (-777.775) [-778.206] (-781.884) (-774.854) * [-782.195] (-777.708) (-775.936) (-776.860) -- 0:01:06
43500 -- (-779.255) (-778.065) (-774.888) [-775.847] * (-784.387) (-782.981) (-775.228) [-774.573] -- 0:01:05
44000 -- [-778.090] (-774.927) (-777.029) (-774.652) * [-776.508] (-775.626) (-777.265) (-776.191) -- 0:01:05
44500 -- (-787.519) (-774.469) (-774.424) [-771.853] * [-777.771] (-779.742) (-776.272) (-776.059) -- 0:01:04
45000 -- [-779.234] (-776.884) (-775.206) (-772.757) * [-778.887] (-779.397) (-776.484) (-781.904) -- 0:01:03
Average standard deviation of split frequencies: 0.030744
45500 -- (-778.315) (-775.165) (-780.463) [-777.669] * (-775.941) (-776.543) (-775.029) [-777.337] -- 0:01:02
46000 -- [-778.947] (-775.685) (-774.631) (-776.456) * [-785.510] (-775.228) (-777.549) (-776.515) -- 0:01:02
46500 -- [-782.658] (-775.913) (-776.605) (-776.836) * (-780.831) [-774.746] (-776.372) (-776.132) -- 0:01:01
47000 -- [-774.702] (-775.875) (-780.279) (-778.794) * (-778.071) (-777.153) (-776.742) [-778.455] -- 0:01:00
47500 -- (-778.469) (-774.950) (-785.858) [-775.706] * (-783.258) (-773.710) (-777.459) [-775.010] -- 0:01:00
48000 -- (-774.045) [-774.990] (-775.238) (-780.453) * (-779.240) [-773.592] (-778.696) (-776.387) -- 0:00:59
48500 -- [-774.939] (-776.286) (-776.230) (-778.557) * [-781.511] (-774.432) (-779.203) (-777.943) -- 0:00:58
49000 -- (-772.708) (-776.184) (-776.083) [-777.272] * (-778.860) [-773.228] (-777.889) (-777.465) -- 0:00:58
49500 -- (-780.087) (-776.209) [-775.179] (-777.218) * (-794.567) (-773.927) (-775.895) [-780.758] -- 0:00:57
50000 -- (-788.287) (-779.926) [-776.114] (-777.331) * (-782.592) [-774.802] (-777.957) (-776.676) -- 0:00:57
Average standard deviation of split frequencies: 0.029344
50500 -- (-782.718) (-773.790) (-777.402) [-777.766] * (-782.008) (-774.808) [-775.690] (-776.306) -- 0:00:56
51000 -- (-781.692) (-774.731) [-774.747] (-774.449) * (-781.849) (-773.946) [-775.718] (-775.369) -- 0:01:14
51500 -- [-777.208] (-774.813) (-777.859) (-777.216) * (-785.558) (-777.799) (-774.790) [-774.968] -- 0:01:13
52000 -- (-778.759) [-775.292] (-778.737) (-775.464) * [-778.995] (-776.604) (-775.227) (-776.415) -- 0:01:12
52500 -- [-779.051] (-776.441) (-776.446) (-775.943) * (-786.472) [-773.380] (-775.304) (-775.007) -- 0:01:12
53000 -- (-776.729) (-777.244) (-776.602) [-780.192] * [-783.216] (-774.906) (-778.237) (-776.713) -- 0:01:11
53500 -- (-788.120) [-780.399] (-775.468) (-777.705) * (-783.652) (-775.910) (-777.128) [-776.433] -- 0:01:10
54000 -- [-782.427] (-776.857) (-775.846) (-776.529) * (-779.577) (-777.027) [-778.494] (-775.042) -- 0:01:10
54500 -- (-788.700) [-775.150] (-774.857) (-778.528) * (-776.215) [-776.464] (-774.478) (-776.822) -- 0:01:09
55000 -- [-778.260] (-775.316) (-777.669) (-773.566) * (-776.898) [-778.696] (-776.703) (-776.417) -- 0:01:08
Average standard deviation of split frequencies: 0.018239
55500 -- (-778.876) (-774.064) (-776.692) [-773.039] * [-776.505] (-779.447) (-775.121) (-775.088) -- 0:01:08
56000 -- [-780.416] (-773.686) (-778.842) (-776.527) * [-781.766] (-777.712) (-775.179) (-776.693) -- 0:01:07
56500 -- [-776.888] (-777.581) (-775.701) (-776.465) * [-775.694] (-779.185) (-772.978) (-778.121) -- 0:01:06
57000 -- [-776.666] (-775.880) (-776.143) (-775.105) * [-782.026] (-776.325) (-776.172) (-775.591) -- 0:01:06
57500 -- [-775.223] (-773.831) (-779.940) (-776.582) * [-777.371] (-775.383) (-774.693) (-776.548) -- 0:01:05
58000 -- (-785.781) (-775.272) (-774.119) [-777.653] * (-778.109) (-775.143) (-774.082) [-773.594] -- 0:01:04
58500 -- (-776.949) [-772.638] (-779.798) (-776.100) * [-773.012] (-775.068) (-778.022) (-775.378) -- 0:01:04
59000 -- (-782.652) [-774.093] (-776.785) (-773.394) * (-776.526) (-777.253) (-774.617) [-773.919] -- 0:01:03
59500 -- [-780.149] (-775.991) (-775.791) (-773.360) * [-776.046] (-776.507) (-776.983) (-776.206) -- 0:01:03
60000 -- [-778.912] (-775.718) (-775.585) (-775.852) * (-774.674) [-777.798] (-778.662) (-774.415) -- 0:01:02
Average standard deviation of split frequencies: 0.027196
60500 -- (-782.777) [-775.729] (-774.445) (-775.146) * (-774.777) [-777.862] (-775.690) (-775.426) -- 0:01:02
61000 -- (-778.271) [-775.323] (-777.315) (-776.906) * (-774.571) (-777.208) [-776.302] (-774.613) -- 0:01:01
61500 -- [-778.457] (-777.009) (-774.698) (-775.676) * (-779.294) [-775.979] (-775.893) (-776.624) -- 0:01:01
62000 -- (-774.219) [-774.400] (-776.905) (-777.310) * (-777.100) (-775.484) (-776.739) [-776.037] -- 0:01:00
62500 -- (-777.653) [-775.743] (-778.045) (-777.254) * (-783.650) (-777.883) [-775.051] (-774.956) -- 0:01:00
63000 -- (-774.851) (-773.902) (-776.645) [-776.356] * (-779.044) [-775.828] (-776.657) (-779.137) -- 0:00:59
63500 -- [-776.304] (-777.966) (-776.818) (-776.451) * (-778.968) (-775.865) (-777.087) [-775.109] -- 0:00:58
64000 -- [-776.556] (-776.359) (-777.392) (-775.764) * (-778.084) [-775.299] (-776.296) (-777.337) -- 0:00:58
64500 -- (-778.946) [-775.932] (-777.331) (-776.866) * (-777.302) (-774.868) [-773.652] (-776.039) -- 0:00:58
65000 -- [-776.592] (-775.417) (-776.952) (-777.868) * (-777.979) (-776.065) (-777.818) [-776.401] -- 0:00:57
Average standard deviation of split frequencies: 0.019047
65500 -- [-775.809] (-775.202) (-775.137) (-782.699) * (-777.052) (-773.566) (-777.542) [-776.688] -- 0:00:57
66000 -- [-774.202] (-776.730) (-775.691) (-779.222) * [-775.762] (-774.958) (-778.594) (-777.026) -- 0:01:10
66500 -- (-779.743) (-772.568) (-777.706) [-775.323] * [-775.688] (-774.845) (-779.448) (-775.757) -- 0:01:10
67000 -- (-777.657) (-774.309) [-775.488] (-774.578) * (-777.817) (-774.863) [-775.001] (-776.106) -- 0:01:09
67500 -- [-774.998] (-772.517) (-778.223) (-774.838) * (-777.782) (-776.276) (-778.445) [-775.709] -- 0:01:09
68000 -- [-774.978] (-774.278) (-779.575) (-778.243) * [-776.667] (-774.435) (-778.490) (-777.182) -- 0:01:08
68500 -- (-779.525) (-775.975) (-779.000) [-773.984] * [-777.141] (-778.457) (-783.487) (-775.260) -- 0:01:07
69000 -- [-776.144] (-775.038) (-779.783) (-773.703) * [-777.246] (-778.911) (-782.431) (-779.885) -- 0:01:07
69500 -- (-774.924) [-775.418] (-775.745) (-773.079) * (-778.895) (-775.994) (-775.702) [-777.431] -- 0:01:06
70000 -- (-775.860) (-776.299) [-773.710] (-776.944) * (-775.501) (-775.942) (-775.685) [-776.187] -- 0:01:06
Average standard deviation of split frequencies: 0.021918
70500 -- (-778.599) (-775.353) [-776.451] (-775.123) * [-775.857] (-776.376) (-774.886) (-780.158) -- 0:01:05
71000 -- (-776.012) (-777.716) (-776.804) [-776.221] * (-780.163) (-777.897) [-777.495] (-777.454) -- 0:01:05
71500 -- (-773.272) (-774.905) (-777.946) [-772.922] * [-775.341] (-779.273) (-779.056) (-776.791) -- 0:01:04
72000 -- (-775.581) (-776.052) (-778.457) [-776.905] * (-780.054) [-776.604] (-780.055) (-778.926) -- 0:01:04
72500 -- [-776.805] (-777.272) (-778.806) (-774.823) * (-775.195) [-775.425] (-779.039) (-772.970) -- 0:01:03
73000 -- (-775.111) [-774.002] (-779.267) (-773.390) * (-778.089) [-777.873] (-775.371) (-773.001) -- 0:01:03
73500 -- (-778.766) (-776.151) (-774.519) [-775.887] * (-778.569) (-777.689) [-777.543] (-774.089) -- 0:01:03
74000 -- [-778.582] (-779.854) (-777.447) (-778.186) * [-775.510] (-776.848) (-777.747) (-775.129) -- 0:01:02
74500 -- (-779.517) (-777.926) [-775.433] (-774.975) * (-774.429) [-775.897] (-775.232) (-774.986) -- 0:01:02
75000 -- [-776.944] (-778.239) (-775.913) (-776.271) * (-779.163) [-775.228] (-775.580) (-776.350) -- 0:01:01
Average standard deviation of split frequencies: 0.024811
75500 -- (-775.704) [-777.718] (-776.574) (-776.210) * (-778.088) (-778.064) (-775.376) [-775.938] -- 0:01:01
76000 -- [-774.839] (-773.405) (-775.253) (-775.911) * (-775.250) (-776.086) (-774.924) [-778.450] -- 0:01:00
76500 -- [-778.778] (-773.841) (-776.102) (-773.897) * [-781.008] (-776.379) (-775.399) (-776.176) -- 0:01:00
77000 -- (-778.323) (-774.379) [-775.678] (-776.846) * (-776.669) (-780.687) [-774.543] (-776.607) -- 0:00:59
77500 -- (-776.681) (-776.395) (-777.355) [-773.670] * (-777.007) (-778.528) [-775.363] (-775.181) -- 0:00:59
78000 -- (-775.764) (-778.075) [-778.708] (-778.529) * (-783.181) (-776.606) (-772.207) [-774.022] -- 0:00:59
78500 -- (-775.987) (-782.512) (-775.279) [-776.769] * (-780.112) [-772.748] (-773.623) (-774.738) -- 0:00:58
79000 -- [-774.714] (-777.068) (-771.674) (-778.810) * [-780.247] (-776.673) (-779.852) (-775.064) -- 0:00:58
79500 -- (-778.886) (-777.247) [-775.991] (-776.938) * (-778.981) (-775.580) [-776.500] (-776.180) -- 0:00:57
80000 -- (-775.632) (-775.444) [-774.701] (-774.258) * (-775.262) (-774.091) (-777.770) [-774.989] -- 0:00:57
Average standard deviation of split frequencies: 0.027661
80500 -- (-775.581) (-776.580) (-779.964) [-774.225] * (-777.064) (-774.710) (-775.396) [-776.336] -- 0:00:57
81000 -- (-777.289) [-776.258] (-773.355) (-777.538) * (-777.074) (-777.408) [-775.351] (-774.756) -- 0:01:08
81500 -- (-774.458) [-778.475] (-776.579) (-778.261) * (-778.837) (-777.260) (-775.946) [-776.440] -- 0:01:07
82000 -- (-774.486) (-776.975) [-776.787] (-776.817) * [-777.337] (-778.075) (-774.556) (-777.679) -- 0:01:07
82500 -- (-774.514) [-774.044] (-777.110) (-777.178) * (-776.767) (-776.451) [-774.705] (-778.024) -- 0:01:06
83000 -- (-776.212) (-775.461) [-775.035] (-774.125) * [-777.626] (-776.603) (-780.050) (-776.668) -- 0:01:06
83500 -- (-776.711) (-780.371) (-776.402) [-775.455] * (-776.070) (-776.248) [-777.457] (-776.526) -- 0:01:05
84000 -- (-777.305) (-778.398) (-778.963) [-774.860] * (-777.134) (-775.108) [-775.579] (-772.909) -- 0:01:05
84500 -- (-776.199) (-775.527) [-778.762] (-777.367) * [-776.876] (-777.849) (-774.509) (-777.406) -- 0:01:05
85000 -- (-775.968) (-777.930) [-777.860] (-777.517) * (-781.034) (-774.463) (-775.250) [-776.025] -- 0:01:04
Average standard deviation of split frequencies: 0.031599
85500 -- (-776.475) (-777.000) [-775.149] (-775.447) * (-775.194) (-773.635) (-775.949) [-776.055] -- 0:01:04
86000 -- [-776.862] (-777.628) (-775.451) (-776.154) * (-777.428) (-771.803) (-778.525) [-774.831] -- 0:01:03
86500 -- (-773.042) [-774.994] (-775.910) (-777.741) * (-775.858) [-772.488] (-776.935) (-777.023) -- 0:01:03
87000 -- (-776.786) [-774.734] (-775.264) (-774.244) * (-779.681) (-773.966) [-774.899] (-773.683) -- 0:01:02
87500 -- (-776.382) (-776.987) [-774.948] (-776.314) * (-779.902) [-777.728] (-776.802) (-774.934) -- 0:01:02
88000 -- (-775.465) (-773.132) [-773.749] (-777.958) * (-780.375) (-778.800) [-775.109] (-779.733) -- 0:01:02
88500 -- (-776.799) (-776.254) [-776.462] (-776.660) * (-778.678) (-774.030) [-776.021] (-775.070) -- 0:01:01
89000 -- (-780.291) (-774.091) (-775.671) [-776.224] * (-776.135) (-772.119) [-776.097] (-781.319) -- 0:01:01
89500 -- (-780.123) (-779.167) (-778.868) [-779.162] * (-777.803) [-775.158] (-775.160) (-777.596) -- 0:01:01
90000 -- (-774.835) [-777.933] (-781.957) (-777.863) * (-777.366) [-774.617] (-777.759) (-773.572) -- 0:01:00
Average standard deviation of split frequencies: 0.036720
90500 -- (-775.297) [-774.795] (-777.161) (-775.024) * (-785.746) [-775.913] (-778.106) (-779.374) -- 0:01:00
91000 -- (-777.866) (-777.589) [-773.696] (-774.764) * (-778.354) [-774.953] (-784.353) (-777.797) -- 0:00:59
91500 -- (-780.355) (-777.932) [-776.621] (-773.779) * (-778.542) (-777.509) (-775.338) [-775.542] -- 0:00:59
92000 -- [-777.057] (-772.612) (-777.053) (-777.580) * (-780.509) (-775.245) (-774.435) [-777.607] -- 0:00:59
92500 -- [-774.916] (-782.477) (-776.606) (-777.747) * (-777.680) [-772.924] (-778.106) (-775.797) -- 0:00:58
93000 -- (-776.243) [-777.782] (-776.247) (-776.495) * (-775.466) [-775.357] (-775.444) (-778.041) -- 0:00:58
93500 -- (-775.399) [-778.363] (-775.563) (-779.038) * (-775.204) (-773.376) [-776.484] (-774.357) -- 0:00:58
94000 -- (-776.322) (-776.516) [-777.459] (-775.840) * (-774.970) (-775.258) [-775.093] (-775.946) -- 0:00:57
94500 -- [-776.439] (-775.363) (-777.468) (-777.164) * (-775.612) [-775.869] (-778.988) (-775.581) -- 0:00:57
95000 -- (-775.635) [-781.360] (-776.523) (-775.898) * (-776.177) (-776.901) [-774.901] (-775.445) -- 0:00:57
Average standard deviation of split frequencies: 0.035908
95500 -- (-776.618) (-774.343) [-775.258] (-776.964) * [-774.114] (-777.392) (-775.026) (-777.411) -- 0:01:06
96000 -- (-775.524) (-775.099) (-776.406) [-779.683] * [-774.679] (-778.810) (-774.918) (-776.228) -- 0:01:05
96500 -- [-776.855] (-774.892) (-780.735) (-775.069) * [-775.134] (-779.202) (-778.548) (-776.676) -- 0:01:05
97000 -- (-777.555) (-775.860) [-775.114] (-774.030) * [-775.672] (-776.478) (-778.110) (-776.387) -- 0:01:05
97500 -- (-782.358) [-774.676] (-777.202) (-773.963) * (-774.219) [-780.152] (-777.837) (-772.721) -- 0:01:04
98000 -- (-774.602) (-778.598) (-778.347) [-775.072] * [-776.801] (-777.637) (-774.476) (-773.547) -- 0:01:04
98500 -- (-774.892) (-778.625) [-776.316] (-777.669) * (-775.823) [-775.198] (-775.240) (-775.385) -- 0:01:04
99000 -- [-776.851] (-775.212) (-776.747) (-774.295) * (-775.127) (-775.627) [-777.178] (-775.106) -- 0:01:03
99500 -- (-776.136) (-775.619) [-777.116] (-776.110) * (-776.971) (-775.268) [-777.234] (-775.572) -- 0:01:03
100000 -- (-778.333) [-775.187] (-778.157) (-776.784) * [-773.834] (-772.842) (-775.384) (-777.129) -- 0:01:02
Average standard deviation of split frequencies: 0.038048
100500 -- [-775.105] (-777.535) (-777.720) (-775.126) * (-777.034) (-772.002) (-775.711) [-774.647] -- 0:01:02
101000 -- [-777.451] (-775.143) (-777.053) (-775.458) * (-774.010) (-781.758) (-776.012) [-778.838] -- 0:01:02
101500 -- (-775.393) (-777.238) (-781.319) [-773.474] * (-777.936) [-777.442] (-776.493) (-777.365) -- 0:01:01
102000 -- (-775.953) [-776.123] (-775.271) (-778.884) * (-778.167) (-772.089) [-776.134] (-776.054) -- 0:01:01
102500 -- (-776.357) [-774.516] (-778.078) (-781.889) * (-776.317) [-773.725] (-775.278) (-776.371) -- 0:01:01
103000 -- [-775.662] (-775.381) (-776.186) (-784.057) * (-774.607) (-777.481) (-776.708) [-774.439] -- 0:01:00
103500 -- [-772.545] (-776.802) (-781.231) (-776.143) * (-775.346) (-774.830) (-775.931) [-774.907] -- 0:01:00
104000 -- (-778.518) (-773.846) [-776.018] (-776.685) * (-776.241) (-773.753) (-776.999) [-775.578] -- 0:01:00
104500 -- (-775.577) (-777.753) (-776.018) [-778.864] * (-775.110) [-773.990] (-774.866) (-776.541) -- 0:00:59
105000 -- (-775.670) (-776.357) [-775.911] (-777.640) * (-772.728) (-779.603) (-777.555) [-780.096] -- 0:00:59
Average standard deviation of split frequencies: 0.038455
105500 -- [-773.750] (-779.998) (-779.410) (-778.619) * [-774.714] (-778.465) (-775.217) (-776.251) -- 0:00:59
106000 -- (-776.553) (-776.371) (-776.185) [-775.466] * (-771.646) (-779.771) [-775.252] (-777.747) -- 0:00:59
106500 -- (-775.151) (-776.488) (-775.325) [-775.154] * (-783.773) [-779.246] (-778.609) (-779.760) -- 0:00:58
107000 -- (-775.471) [-775.205] (-775.668) (-773.453) * (-776.678) (-776.064) [-776.478] (-772.704) -- 0:00:58
107500 -- (-776.320) (-779.629) [-775.048] (-776.144) * [-773.552] (-782.467) (-776.961) (-775.518) -- 0:00:58
108000 -- (-778.002) (-784.679) [-777.097] (-776.890) * (-775.201) (-781.496) (-779.451) [-773.998] -- 0:00:57
108500 -- (-777.322) (-779.939) [-776.134] (-776.510) * (-777.816) (-779.456) [-775.109] (-775.169) -- 0:00:57
109000 -- [-779.469] (-775.537) (-780.628) (-777.895) * (-776.502) (-775.861) (-778.856) [-775.463] -- 0:00:57
109500 -- (-781.475) [-776.302] (-777.041) (-779.194) * [-778.629] (-774.967) (-776.620) (-774.867) -- 0:00:56
110000 -- (-779.008) (-777.743) [-778.797] (-777.074) * (-775.716) [-776.802] (-778.633) (-777.177) -- 0:00:56
Average standard deviation of split frequencies: 0.040041
110500 -- (-777.078) (-776.586) (-777.359) [-773.714] * (-774.950) [-776.424] (-776.427) (-778.573) -- 0:00:56
111000 -- (-775.302) (-778.763) [-776.796] (-775.051) * [-775.531] (-774.789) (-775.071) (-777.274) -- 0:01:04
111500 -- (-775.442) (-778.897) [-774.655] (-776.540) * (-776.369) (-777.726) (-776.298) [-777.745] -- 0:01:03
112000 -- (-778.213) (-778.932) [-775.417] (-775.999) * (-779.984) (-776.275) (-775.005) [-776.274] -- 0:01:03
112500 -- [-775.631] (-776.661) (-774.678) (-778.247) * (-777.706) (-775.634) [-774.945] (-774.879) -- 0:01:03
113000 -- (-774.616) [-778.388] (-775.685) (-777.662) * (-779.121) (-776.721) (-778.275) [-776.996] -- 0:01:02
113500 -- (-782.061) (-774.851) (-780.027) [-776.112] * (-775.062) (-776.158) [-777.355] (-776.563) -- 0:01:02
114000 -- [-775.859] (-774.406) (-778.568) (-781.517) * (-774.325) (-778.692) [-777.968] (-780.504) -- 0:01:02
114500 -- [-776.158] (-774.400) (-778.309) (-785.188) * (-774.965) [-774.889] (-776.828) (-779.304) -- 0:01:01
115000 -- (-775.109) [-774.043] (-775.689) (-778.951) * (-775.376) (-774.646) [-778.050] (-774.988) -- 0:01:01
Average standard deviation of split frequencies: 0.038742
115500 -- [-775.006] (-774.392) (-775.599) (-775.316) * [-776.804] (-775.664) (-779.602) (-779.088) -- 0:01:01
116000 -- (-777.095) (-776.862) (-776.595) [-776.181] * (-777.200) (-774.378) (-779.288) [-778.345] -- 0:01:00
116500 -- [-775.572] (-775.984) (-778.603) (-775.609) * (-775.938) (-775.894) (-779.711) [-777.695] -- 0:01:00
117000 -- [-775.776] (-775.216) (-777.026) (-777.571) * (-775.213) [-774.716] (-777.933) (-783.046) -- 0:01:00
117500 -- [-775.574] (-775.621) (-775.061) (-780.948) * (-777.331) (-774.840) [-777.949] (-779.802) -- 0:01:00
118000 -- (-775.865) (-773.668) (-776.142) [-778.608] * [-776.018] (-773.507) (-778.389) (-779.156) -- 0:00:59
118500 -- (-781.017) [-773.697] (-774.164) (-778.632) * (-779.043) [-773.291] (-776.028) (-774.945) -- 0:00:59
119000 -- (-775.048) [-777.839] (-774.397) (-777.097) * (-775.610) (-773.780) [-778.237] (-776.230) -- 0:00:59
119500 -- [-775.730] (-782.687) (-777.483) (-783.638) * (-772.940) [-774.260] (-776.638) (-775.950) -- 0:00:58
120000 -- [-776.071] (-775.483) (-777.659) (-776.738) * (-774.697) [-776.893] (-776.682) (-776.312) -- 0:00:58
Average standard deviation of split frequencies: 0.034183
120500 -- (-775.555) [-774.667] (-776.908) (-777.259) * (-778.850) (-776.020) [-775.227] (-777.091) -- 0:00:58
121000 -- [-776.311] (-775.762) (-776.536) (-777.061) * (-775.548) (-779.596) [-777.322] (-784.300) -- 0:00:58
121500 -- [-776.923] (-776.823) (-774.744) (-782.948) * (-776.080) (-776.221) [-777.639] (-778.501) -- 0:00:57
122000 -- (-778.249) [-775.676] (-777.267) (-775.738) * (-774.377) (-779.206) (-773.456) [-776.890] -- 0:00:57
122500 -- (-776.860) [-774.272] (-774.474) (-776.843) * (-775.913) [-777.212] (-775.063) (-776.320) -- 0:00:57
123000 -- (-777.185) (-773.974) [-772.987] (-776.907) * (-781.490) [-773.174] (-776.924) (-775.374) -- 0:00:57
123500 -- [-778.506] (-776.923) (-774.921) (-776.130) * (-777.559) (-775.276) (-774.895) [-774.849] -- 0:00:56
124000 -- (-775.421) (-775.723) (-775.782) [-775.706] * (-776.971) (-775.889) [-775.175] (-775.151) -- 0:00:56
124500 -- (-775.777) (-777.088) (-776.035) [-774.522] * (-777.992) (-776.540) [-776.471] (-774.464) -- 0:00:56
125000 -- (-777.856) (-772.805) (-782.150) [-780.093] * (-777.792) (-777.197) [-777.211] (-776.433) -- 0:00:56
Average standard deviation of split frequencies: 0.031911
125500 -- (-776.121) [-775.212] (-788.518) (-776.471) * (-779.751) (-777.077) (-774.046) [-777.242] -- 0:00:55
126000 -- (-775.798) (-777.999) (-779.092) [-778.652] * (-781.061) (-782.080) [-777.335] (-775.412) -- 0:00:55
126500 -- (-779.066) [-773.884] (-775.900) (-776.840) * (-775.369) (-774.356) (-775.528) [-773.947] -- 0:01:02
127000 -- (-776.251) [-776.828] (-772.746) (-781.699) * (-780.706) (-776.084) [-775.439] (-775.649) -- 0:01:01
127500 -- (-775.894) (-776.599) (-776.319) [-778.084] * (-778.393) (-778.278) (-777.316) [-775.628] -- 0:01:01
128000 -- (-775.673) (-775.755) [-783.615] (-780.506) * (-776.302) (-780.123) (-778.294) [-775.116] -- 0:01:01
128500 -- [-777.954] (-774.336) (-775.736) (-780.254) * (-776.416) [-777.122] (-773.625) (-772.901) -- 0:01:01
129000 -- (-775.507) [-773.542] (-777.032) (-776.187) * (-776.851) [-775.043] (-773.149) (-775.482) -- 0:01:00
129500 -- (-774.679) [-775.557] (-777.382) (-774.573) * (-776.552) [-773.090] (-775.163) (-776.833) -- 0:01:00
130000 -- [-781.563] (-774.845) (-776.180) (-778.159) * (-776.995) (-776.392) [-773.967] (-776.312) -- 0:01:00
Average standard deviation of split frequencies: 0.028649
130500 -- (-778.517) (-771.761) (-779.589) [-776.419] * [-779.237] (-776.176) (-773.031) (-774.659) -- 0:00:59
131000 -- [-774.540] (-772.740) (-775.689) (-781.439) * (-775.117) [-773.998] (-773.570) (-773.788) -- 0:00:59
131500 -- (-778.220) [-775.184] (-776.829) (-775.976) * (-775.866) (-778.143) (-774.573) [-777.818] -- 0:00:59
132000 -- [-775.050] (-776.533) (-776.391) (-775.364) * (-777.334) [-776.766] (-775.428) (-778.379) -- 0:00:59
132500 -- (-776.345) (-772.185) (-774.934) [-775.189] * (-777.764) (-775.761) [-775.337] (-779.528) -- 0:00:58
133000 -- (-780.601) (-772.529) [-776.193] (-774.597) * [-775.742] (-778.484) (-771.431) (-774.756) -- 0:00:58
133500 -- [-777.348] (-780.202) (-775.939) (-776.152) * (-776.213) (-775.115) [-776.004] (-776.935) -- 0:00:58
134000 -- [-777.580] (-775.205) (-776.470) (-775.783) * (-776.984) (-774.761) (-777.010) [-777.996] -- 0:00:58
134500 -- (-775.991) [-773.994] (-775.694) (-777.087) * (-778.642) (-775.306) (-776.034) [-775.131] -- 0:00:57
135000 -- (-776.302) (-776.384) [-776.926] (-776.480) * (-779.644) [-774.109] (-778.392) (-774.927) -- 0:00:57
Average standard deviation of split frequencies: 0.025780
135500 -- (-775.453) [-776.200] (-776.179) (-775.323) * [-779.542] (-773.096) (-775.913) (-777.479) -- 0:00:57
136000 -- [-773.641] (-777.383) (-777.086) (-774.544) * (-778.626) [-773.105] (-779.293) (-779.590) -- 0:00:57
136500 -- [-774.484] (-778.456) (-775.146) (-776.271) * [-774.811] (-772.803) (-775.085) (-778.959) -- 0:00:56
137000 -- (-772.683) [-776.164] (-776.455) (-774.711) * (-775.994) (-777.212) (-776.632) [-777.745] -- 0:00:56
137500 -- (-774.548) (-775.593) [-775.568] (-775.419) * (-773.546) (-775.932) (-773.857) [-775.808] -- 0:00:56
138000 -- (-775.844) [-778.431] (-774.835) (-774.583) * (-775.498) (-780.460) [-774.178] (-778.836) -- 0:00:56
138500 -- (-775.405) (-774.003) [-773.530] (-779.288) * (-775.159) [-774.756] (-774.442) (-785.186) -- 0:00:55
139000 -- (-774.432) (-773.695) (-775.878) [-774.514] * (-774.240) (-777.028) [-777.318] (-778.252) -- 0:00:55
139500 -- (-777.310) [-776.453] (-772.429) (-776.015) * (-774.547) (-773.882) (-780.245) [-771.876] -- 0:00:55
140000 -- [-775.190] (-779.477) (-778.029) (-775.791) * (-776.333) (-773.097) [-777.645] (-774.771) -- 0:00:55
Average standard deviation of split frequencies: 0.026415
140500 -- [-775.195] (-776.088) (-775.493) (-775.976) * (-772.701) [-775.231] (-775.963) (-780.935) -- 0:00:55
141000 -- (-775.883) [-773.478] (-779.775) (-777.196) * (-772.798) [-778.278] (-778.847) (-776.970) -- 0:00:54
141500 -- [-776.523] (-776.933) (-777.375) (-780.609) * (-776.012) (-779.612) [-774.278] (-777.443) -- 0:01:00
142000 -- (-778.946) (-776.240) [-775.783] (-779.990) * (-779.226) (-776.122) [-777.627] (-775.324) -- 0:01:00
142500 -- (-775.047) (-776.947) [-776.146] (-778.576) * (-778.126) [-779.044] (-775.600) (-775.725) -- 0:01:00
143000 -- (-776.069) (-774.596) (-775.976) [-777.827] * (-776.290) (-775.196) [-773.403] (-776.945) -- 0:00:59
143500 -- (-775.776) [-775.474] (-777.246) (-777.193) * (-774.810) [-775.041] (-775.893) (-775.120) -- 0:00:59
144000 -- [-773.944] (-775.763) (-774.290) (-774.751) * (-778.287) (-775.148) (-776.747) [-775.660] -- 0:00:59
144500 -- [-774.290] (-776.459) (-776.170) (-776.482) * (-775.060) (-773.149) [-775.856] (-777.120) -- 0:00:59
145000 -- (-774.156) [-775.171] (-774.504) (-777.493) * [-776.184] (-778.974) (-776.620) (-775.482) -- 0:00:58
Average standard deviation of split frequencies: 0.024811
145500 -- (-777.004) [-774.101] (-778.309) (-774.905) * (-774.146) (-776.460) [-777.971] (-778.330) -- 0:00:58
146000 -- (-778.698) (-775.079) [-774.735] (-776.109) * (-777.012) (-778.584) [-776.415] (-778.362) -- 0:00:58
146500 -- (-776.353) [-776.532] (-778.590) (-773.670) * (-780.535) (-779.883) (-775.161) [-776.306] -- 0:00:58
147000 -- (-773.789) (-775.260) [-775.187] (-773.191) * (-777.018) [-774.394] (-774.749) (-774.069) -- 0:00:58
147500 -- (-776.548) [-777.859] (-775.844) (-775.836) * (-778.799) [-775.414] (-775.778) (-776.087) -- 0:00:57
148000 -- (-775.678) (-778.346) [-776.028] (-777.080) * [-774.782] (-779.154) (-776.999) (-776.350) -- 0:00:57
148500 -- [-775.052] (-777.884) (-773.202) (-777.720) * [-781.051] (-774.720) (-774.815) (-776.346) -- 0:00:57
149000 -- (-773.414) [-777.840] (-775.305) (-779.312) * (-775.214) (-774.903) (-778.796) [-774.657] -- 0:00:57
149500 -- [-776.341] (-775.812) (-773.791) (-778.241) * (-774.886) (-773.984) (-776.087) [-774.564] -- 0:00:56
150000 -- (-775.798) (-776.845) (-774.384) [-774.901] * (-776.689) [-775.385] (-775.180) (-776.682) -- 0:00:56
Average standard deviation of split frequencies: 0.026073
150500 -- (-775.700) (-775.222) [-774.742] (-774.812) * [-776.856] (-776.694) (-774.366) (-778.113) -- 0:00:56
151000 -- (-775.019) (-775.337) (-775.857) [-782.721] * (-775.269) [-778.362] (-777.094) (-778.069) -- 0:00:56
151500 -- [-777.812] (-775.570) (-778.777) (-773.754) * (-781.211) (-778.965) [-775.264] (-774.629) -- 0:00:56
152000 -- (-776.496) (-774.997) [-774.755] (-774.566) * (-775.987) (-778.335) [-776.660] (-775.264) -- 0:00:55
152500 -- (-776.999) (-774.791) [-778.137] (-777.250) * (-775.319) (-780.811) (-776.620) [-774.740] -- 0:00:55
153000 -- [-779.248] (-775.609) (-777.138) (-776.963) * (-777.780) (-776.132) [-776.651] (-773.476) -- 0:00:55
153500 -- (-779.405) (-777.192) [-776.220] (-776.686) * (-776.149) (-777.321) (-776.115) [-776.092] -- 0:00:55
154000 -- (-775.518) (-778.266) (-777.096) [-777.441] * (-775.583) (-774.621) (-776.462) [-775.251] -- 0:00:54
154500 -- (-773.756) [-773.012] (-776.340) (-782.347) * (-775.464) (-775.367) [-776.300] (-775.504) -- 0:00:54
155000 -- (-775.747) (-778.361) [-776.056] (-779.468) * [-775.693] (-775.254) (-777.200) (-775.715) -- 0:00:54
Average standard deviation of split frequencies: 0.027364
155500 -- [-774.863] (-774.003) (-775.316) (-777.974) * [-778.440] (-776.331) (-776.389) (-775.243) -- 0:00:54
156000 -- (-776.145) [-775.393] (-777.849) (-776.071) * (-776.042) (-777.098) (-776.446) [-775.492] -- 0:00:54
156500 -- (-774.175) (-775.064) (-775.038) [-777.415] * (-778.145) (-775.419) (-781.144) [-773.713] -- 0:00:59
157000 -- (-777.498) [-773.984] (-776.853) (-780.607) * [-775.305] (-774.651) (-776.432) (-776.170) -- 0:00:59
157500 -- (-775.868) [-775.342] (-775.415) (-778.387) * (-776.696) (-774.369) [-772.614] (-776.811) -- 0:00:58
158000 -- [-774.233] (-774.878) (-775.423) (-777.313) * (-776.255) (-777.813) (-776.187) [-775.413] -- 0:00:58
158500 -- (-776.713) (-776.775) (-775.417) [-777.303] * (-775.039) (-778.767) [-776.205] (-774.431) -- 0:00:58
159000 -- (-777.731) (-775.162) (-781.976) [-774.866] * [-777.755] (-776.298) (-774.365) (-776.972) -- 0:00:58
159500 -- (-778.137) (-777.011) (-776.618) [-775.570] * (-773.887) (-777.697) [-778.586] (-774.743) -- 0:00:57
160000 -- (-778.597) [-777.592] (-777.138) (-774.827) * (-782.871) (-776.606) [-776.380] (-776.111) -- 0:00:57
Average standard deviation of split frequencies: 0.028478
160500 -- (-774.173) (-777.575) (-777.735) [-777.507] * (-774.337) (-776.127) (-776.135) [-776.694] -- 0:00:57
161000 -- (-773.307) (-775.638) (-780.974) [-778.526] * (-775.691) [-775.028] (-776.597) (-774.966) -- 0:00:57
161500 -- (-774.047) (-774.703) (-780.468) [-774.218] * (-774.762) [-773.186] (-777.346) (-775.842) -- 0:00:57
162000 -- (-775.360) [-777.344] (-779.680) (-774.455) * [-773.882] (-773.688) (-775.322) (-773.859) -- 0:00:56
162500 -- (-781.011) (-778.016) [-776.463] (-774.195) * [-774.345] (-774.541) (-775.948) (-775.951) -- 0:00:56
163000 -- [-778.880] (-777.343) (-777.593) (-778.185) * (-777.565) (-777.294) (-774.435) [-773.536] -- 0:00:56
163500 -- (-775.990) (-776.987) (-777.991) [-778.114] * (-778.841) (-774.847) (-772.928) [-775.811] -- 0:00:56
164000 -- (-776.309) (-776.847) (-774.326) [-775.443] * [-775.935] (-776.398) (-775.422) (-775.603) -- 0:00:56
164500 -- (-775.261) (-776.275) [-777.129] (-778.753) * [-777.598] (-776.603) (-773.337) (-776.636) -- 0:00:55
165000 -- (-779.732) [-775.013] (-775.927) (-778.338) * (-775.146) [-773.077] (-775.299) (-776.939) -- 0:00:55
Average standard deviation of split frequencies: 0.026754
165500 -- (-775.814) (-776.280) [-775.565] (-776.418) * [-775.234] (-777.817) (-774.821) (-774.975) -- 0:00:55
166000 -- [-774.857] (-774.667) (-774.486) (-780.096) * (-775.413) [-774.241] (-782.253) (-774.519) -- 0:00:55
166500 -- (-774.424) [-774.593] (-777.420) (-779.687) * (-778.173) (-776.339) [-777.695] (-774.330) -- 0:00:55
167000 -- (-777.056) (-775.911) [-777.052] (-777.346) * (-777.169) (-777.099) [-774.995] (-774.744) -- 0:00:54
167500 -- (-775.591) (-775.855) [-779.197] (-777.603) * (-779.143) (-775.948) (-777.121) [-777.315] -- 0:00:54
168000 -- [-774.785] (-783.522) (-779.036) (-777.223) * (-778.643) [-777.775] (-775.970) (-775.607) -- 0:00:54
168500 -- (-778.733) (-782.711) [-775.007] (-775.397) * (-776.333) [-774.159] (-777.734) (-774.521) -- 0:00:54
169000 -- (-775.253) (-778.622) (-775.280) [-775.777] * (-776.517) (-778.946) (-777.938) [-775.023] -- 0:00:54
169500 -- (-777.950) (-776.651) (-780.288) [-776.460] * (-775.495) (-777.796) (-775.203) [-774.711] -- 0:00:53
170000 -- (-775.558) (-776.873) [-775.601] (-775.560) * (-775.454) (-777.610) (-777.487) [-777.089] -- 0:00:53
Average standard deviation of split frequencies: 0.023939
170500 -- (-774.398) [-780.847] (-776.436) (-775.484) * (-775.648) (-776.612) [-775.896] (-780.801) -- 0:00:53
171000 -- [-776.305] (-776.333) (-777.526) (-776.511) * [-775.401] (-777.335) (-776.151) (-775.803) -- 0:00:53
171500 -- (-775.543) [-775.085] (-776.227) (-777.236) * (-774.954) (-775.712) (-774.714) [-774.214] -- 0:00:53
172000 -- (-775.275) (-774.779) (-780.458) [-775.433] * (-777.322) (-773.952) (-776.413) [-771.476] -- 0:00:57
172500 -- (-777.876) (-775.955) [-778.179] (-778.701) * (-780.042) (-774.661) (-774.536) [-774.765] -- 0:00:57
173000 -- (-778.244) (-776.987) [-776.653] (-775.373) * (-778.851) [-775.235] (-775.817) (-778.957) -- 0:00:57
173500 -- (-774.531) [-778.154] (-775.842) (-781.027) * (-775.788) [-776.354] (-774.592) (-781.999) -- 0:00:57
174000 -- (-777.631) [-779.317] (-776.972) (-777.369) * (-776.720) [-777.179] (-775.250) (-778.508) -- 0:00:56
174500 -- (-773.791) (-776.429) [-779.187] (-775.456) * (-778.412) (-778.814) (-775.597) [-776.474] -- 0:00:56
175000 -- [-776.191] (-781.282) (-775.690) (-777.148) * (-774.865) [-776.015] (-774.431) (-775.054) -- 0:00:56
Average standard deviation of split frequencies: 0.021991
175500 -- (-776.168) [-775.999] (-775.449) (-775.038) * (-777.591) (-782.325) [-774.784] (-776.200) -- 0:00:56
176000 -- (-775.231) [-776.217] (-774.822) (-775.191) * (-775.145) [-777.367] (-774.183) (-785.955) -- 0:00:56
176500 -- (-776.467) (-780.064) [-774.404] (-776.164) * (-778.963) [-774.647] (-774.651) (-776.973) -- 0:00:55
177000 -- (-776.917) (-775.326) [-777.234] (-775.530) * (-776.992) [-772.672] (-776.488) (-776.408) -- 0:00:55
177500 -- (-780.065) (-775.880) (-776.540) [-776.440] * [-776.410] (-770.929) (-782.982) (-776.048) -- 0:00:55
178000 -- (-774.092) (-777.824) [-773.862] (-778.734) * (-778.841) [-773.549] (-778.401) (-778.011) -- 0:00:55
178500 -- [-773.489] (-775.021) (-777.100) (-778.763) * (-781.300) [-773.167] (-774.900) (-776.794) -- 0:00:55
179000 -- (-777.504) (-775.385) (-776.789) [-777.324] * (-779.524) [-775.011] (-778.342) (-777.171) -- 0:00:55
179500 -- [-776.462] (-776.215) (-776.055) (-774.559) * [-774.227] (-778.429) (-776.414) (-778.651) -- 0:00:54
180000 -- (-775.287) (-774.896) [-780.150] (-778.276) * (-775.999) [-778.124] (-778.145) (-775.472) -- 0:00:54
Average standard deviation of split frequencies: 0.018990
180500 -- [-773.430] (-777.451) (-778.590) (-777.357) * (-776.616) (-782.518) (-777.130) [-775.170] -- 0:00:54
181000 -- [-774.993] (-776.869) (-774.865) (-776.951) * (-772.996) (-777.217) (-777.862) [-775.527] -- 0:00:54
181500 -- [-774.918] (-775.700) (-772.971) (-776.083) * (-774.376) (-779.811) (-780.022) [-777.987] -- 0:00:54
182000 -- [-775.777] (-775.864) (-777.354) (-776.268) * (-775.453) (-776.847) [-774.924] (-781.606) -- 0:00:53
182500 -- (-776.010) (-778.358) [-773.103] (-774.870) * [-775.790] (-776.434) (-777.248) (-778.425) -- 0:00:53
183000 -- (-774.394) (-784.684) [-776.413] (-778.620) * (-776.286) [-776.194] (-774.614) (-776.681) -- 0:00:53
183500 -- (-774.113) (-779.183) [-775.776] (-777.028) * (-778.140) (-776.503) [-774.429] (-774.781) -- 0:00:53
184000 -- (-779.937) [-777.992] (-778.526) (-774.759) * (-776.613) [-774.699] (-775.297) (-774.772) -- 0:00:53
184500 -- (-776.233) (-775.443) [-778.553] (-776.141) * (-775.261) [-775.572] (-774.214) (-775.117) -- 0:00:53
185000 -- (-776.575) (-775.579) [-775.375] (-776.211) * (-775.159) [-774.454] (-774.901) (-775.346) -- 0:00:52
Average standard deviation of split frequencies: 0.018942
185500 -- (-774.957) [-775.957] (-776.839) (-774.748) * (-775.417) (-774.771) [-775.518] (-774.629) -- 0:00:52
186000 -- (-775.602) (-778.656) (-779.115) [-775.376] * [-774.759] (-776.339) (-776.278) (-778.856) -- 0:00:52
186500 -- (-775.758) (-778.272) (-775.258) [-777.844] * (-777.240) (-774.976) (-780.297) [-777.182] -- 0:00:52
187000 -- (-778.491) (-777.262) (-780.715) [-778.561] * (-775.596) (-774.969) (-775.438) [-775.369] -- 0:00:52
187500 -- (-773.598) [-778.680] (-778.370) (-777.570) * (-777.926) [-774.202] (-775.248) (-774.827) -- 0:00:56
188000 -- [-773.706] (-781.210) (-775.502) (-774.825) * (-775.358) [-776.534] (-774.552) (-775.109) -- 0:00:56
188500 -- (-774.449) [-781.048] (-774.375) (-777.585) * (-775.255) (-773.229) [-773.317] (-775.996) -- 0:00:55
189000 -- (-775.014) (-782.280) [-777.186] (-776.183) * (-776.528) (-779.779) (-775.420) [-773.617] -- 0:00:55
189500 -- (-776.785) (-777.040) [-773.452] (-776.852) * [-776.752] (-776.238) (-775.140) (-777.071) -- 0:00:55
190000 -- (-774.080) (-775.395) (-774.704) [-774.027] * (-776.494) [-772.549] (-774.444) (-779.278) -- 0:00:55
Average standard deviation of split frequencies: 0.017444
190500 -- (-774.920) (-775.809) [-779.924] (-775.442) * [-777.066] (-773.931) (-773.655) (-777.073) -- 0:00:55
191000 -- (-779.711) (-777.930) [-776.300] (-778.711) * (-775.256) [-774.257] (-776.107) (-774.709) -- 0:00:55
191500 -- [-775.262] (-776.014) (-777.228) (-780.018) * (-777.206) [-778.195] (-777.842) (-775.510) -- 0:00:54
192000 -- [-774.333] (-774.973) (-777.031) (-773.548) * (-775.802) [-772.497] (-775.423) (-776.256) -- 0:00:54
192500 -- [-776.567] (-783.150) (-780.884) (-772.811) * (-776.063) (-773.305) [-773.662] (-776.577) -- 0:00:54
193000 -- [-775.647] (-775.870) (-775.598) (-773.339) * (-777.434) (-774.182) (-775.485) [-773.103] -- 0:00:54
193500 -- (-775.694) (-777.152) [-777.884] (-777.425) * (-779.451) (-778.624) (-774.400) [-775.222] -- 0:00:54
194000 -- (-775.993) [-774.646] (-776.715) (-780.630) * (-779.440) (-777.670) [-774.220] (-777.259) -- 0:00:54
194500 -- (-774.044) (-778.453) [-773.921] (-775.599) * (-775.990) (-775.152) (-775.757) [-775.907] -- 0:00:53
195000 -- (-774.381) [-777.339] (-775.693) (-776.676) * (-777.932) [-778.892] (-774.729) (-776.570) -- 0:00:53
Average standard deviation of split frequencies: 0.016709
195500 -- (-776.617) [-775.938] (-775.709) (-776.335) * (-775.941) (-778.232) [-777.015] (-774.670) -- 0:00:53
196000 -- (-776.775) (-780.593) (-774.423) [-776.441] * (-775.748) (-773.347) (-777.789) [-775.561] -- 0:00:53
196500 -- (-777.956) (-778.058) [-775.959] (-779.994) * (-775.718) [-774.990] (-776.533) (-779.426) -- 0:00:53
197000 -- (-777.720) (-777.488) [-776.845] (-778.221) * (-776.434) (-776.131) [-777.741] (-780.537) -- 0:00:52
197500 -- (-778.199) [-777.186] (-776.640) (-778.319) * [-775.595] (-776.245) (-778.730) (-776.080) -- 0:00:52
198000 -- (-777.414) [-776.216] (-776.354) (-778.924) * (-778.068) (-775.940) [-778.780] (-779.372) -- 0:00:52
198500 -- (-774.790) [-775.367] (-776.275) (-775.401) * [-777.928] (-775.834) (-776.894) (-778.948) -- 0:00:52
199000 -- (-775.483) (-776.126) (-777.307) [-775.672] * [-776.334] (-777.897) (-780.932) (-777.547) -- 0:00:52
199500 -- (-776.286) (-777.975) (-775.166) [-776.151] * (-778.415) (-776.503) (-784.200) [-775.738] -- 0:00:52
200000 -- (-775.691) [-773.893] (-776.146) (-777.354) * (-777.037) (-775.554) (-780.252) [-773.505] -- 0:00:51
Average standard deviation of split frequencies: 0.017488
200500 -- (-775.661) (-776.530) (-777.258) [-774.533] * [-774.447] (-775.649) (-778.624) (-779.695) -- 0:00:51
201000 -- (-772.883) [-774.692] (-780.286) (-775.271) * (-774.403) (-776.003) (-774.207) [-778.164] -- 0:00:51
201500 -- [-775.484] (-777.222) (-777.430) (-775.859) * (-775.908) (-778.952) (-774.171) [-776.351] -- 0:00:51
202000 -- [-778.049] (-780.077) (-773.881) (-778.540) * (-775.570) [-775.183] (-776.125) (-779.875) -- 0:00:51
202500 -- (-775.363) [-780.068] (-775.471) (-776.815) * (-776.570) (-777.839) [-772.232] (-775.853) -- 0:00:55
203000 -- (-775.228) (-787.794) (-774.421) [-778.491] * (-777.307) [-777.129] (-772.836) (-775.384) -- 0:00:54
203500 -- (-776.552) (-775.716) [-777.975] (-781.072) * (-778.005) [-775.605] (-776.841) (-774.137) -- 0:00:54
204000 -- (-777.300) (-776.397) [-774.923] (-782.179) * (-777.177) [-776.248] (-778.837) (-784.116) -- 0:00:54
204500 -- (-777.540) (-775.947) (-776.993) [-781.113] * (-775.838) (-777.317) [-773.762] (-778.004) -- 0:00:54
205000 -- [-773.871] (-775.602) (-777.330) (-774.958) * (-776.054) (-777.649) [-772.148] (-776.812) -- 0:00:54
Average standard deviation of split frequencies: 0.017343
205500 -- (-774.952) [-775.364] (-777.078) (-775.834) * (-777.451) [-772.705] (-776.297) (-777.072) -- 0:00:54
206000 -- (-773.979) (-774.782) (-773.675) [-776.417] * (-774.588) (-774.493) [-774.655] (-780.774) -- 0:00:53
206500 -- [-782.027] (-774.973) (-776.517) (-774.606) * (-778.782) (-775.852) [-774.393] (-776.800) -- 0:00:53
207000 -- (-780.749) [-775.412] (-777.631) (-776.823) * (-779.394) [-775.632] (-777.110) (-775.704) -- 0:00:53
207500 -- (-780.330) (-776.059) [-776.223] (-775.672) * (-778.369) (-780.322) (-778.361) [-777.207] -- 0:00:53
208000 -- [-776.212] (-776.590) (-774.974) (-775.360) * [-775.492] (-777.339) (-775.491) (-776.061) -- 0:00:53
208500 -- (-775.762) (-775.208) (-775.376) [-778.301] * [-777.923] (-776.927) (-774.423) (-775.752) -- 0:00:53
209000 -- (-776.091) (-774.847) (-776.543) [-775.539] * (-776.115) [-774.808] (-773.969) (-775.178) -- 0:00:52
209500 -- (-776.023) (-775.729) (-775.296) [-773.792] * (-776.648) (-774.738) (-776.708) [-776.075] -- 0:00:52
210000 -- (-776.291) (-773.814) (-775.119) [-776.218] * (-774.619) (-781.653) (-776.280) [-776.630] -- 0:00:52
Average standard deviation of split frequencies: 0.016253
210500 -- (-775.985) [-780.173] (-775.297) (-776.893) * (-776.295) [-780.135] (-773.518) (-776.933) -- 0:00:52
211000 -- (-773.319) (-775.508) (-775.783) [-775.183] * (-775.757) (-777.033) (-775.315) [-776.129] -- 0:00:52
211500 -- [-775.611] (-775.835) (-773.853) (-779.504) * (-774.144) (-775.993) (-775.192) [-776.284] -- 0:00:52
212000 -- (-777.483) [-775.239] (-775.849) (-774.554) * (-781.233) (-778.254) [-775.379] (-775.832) -- 0:00:52
212500 -- (-776.637) [-775.045] (-776.120) (-777.515) * [-775.082] (-775.971) (-776.766) (-776.486) -- 0:00:51
213000 -- (-776.792) [-776.682] (-775.216) (-777.623) * [-778.560] (-778.044) (-777.834) (-776.161) -- 0:00:51
213500 -- (-780.327) [-777.773] (-775.864) (-777.724) * [-775.771] (-773.916) (-773.736) (-777.923) -- 0:00:51
214000 -- (-775.298) (-778.308) (-775.998) [-776.481] * (-775.177) (-779.049) (-778.683) [-778.027] -- 0:00:51
214500 -- [-775.861] (-777.057) (-772.983) (-777.061) * (-775.190) (-777.280) (-776.894) [-775.425] -- 0:00:51
215000 -- [-778.007] (-775.643) (-774.292) (-777.543) * (-774.850) (-774.214) [-776.308] (-776.262) -- 0:00:51
Average standard deviation of split frequencies: 0.015622
215500 -- (-775.230) [-776.307] (-775.801) (-777.612) * (-775.618) [-774.996] (-773.274) (-775.053) -- 0:00:50
216000 -- (-774.296) (-778.442) (-777.380) [-775.260] * (-778.481) [-774.551] (-774.573) (-779.267) -- 0:00:50
216500 -- [-775.596] (-777.565) (-777.195) (-775.062) * [-773.565] (-775.670) (-776.157) (-776.319) -- 0:00:50
217000 -- (-773.961) (-777.527) (-777.738) [-773.828] * (-773.310) (-776.009) (-775.986) [-777.445] -- 0:00:50
217500 -- (-776.674) [-776.299] (-777.375) (-774.486) * (-776.001) [-776.262] (-773.399) (-778.918) -- 0:00:50
218000 -- (-772.860) [-779.198] (-776.871) (-773.851) * (-776.787) [-775.810] (-778.119) (-775.277) -- 0:00:53
218500 -- [-775.090] (-776.518) (-777.146) (-774.226) * (-776.041) (-775.766) (-774.316) [-776.068] -- 0:00:53
219000 -- (-779.157) (-778.484) (-774.224) [-777.733] * (-776.459) (-776.782) (-774.602) [-776.559] -- 0:00:53
219500 -- (-776.334) (-775.919) [-778.786] (-774.934) * (-774.541) (-776.909) (-777.338) [-777.666] -- 0:00:53
220000 -- (-774.150) [-776.834] (-777.269) (-775.174) * [-776.092] (-780.862) (-777.562) (-775.880) -- 0:00:53
Average standard deviation of split frequencies: 0.012930
220500 -- (-775.103) (-776.147) [-776.230] (-777.290) * (-774.990) (-775.248) (-778.271) [-776.509] -- 0:00:53
221000 -- (-776.091) (-777.274) [-774.897] (-775.784) * (-777.134) (-775.982) [-774.091] (-777.595) -- 0:00:52
221500 -- (-775.042) [-775.157] (-774.970) (-775.700) * (-778.576) (-775.917) [-774.096] (-775.993) -- 0:00:52
222000 -- (-778.169) (-775.113) (-775.075) [-779.536] * [-774.769] (-775.552) (-774.916) (-776.591) -- 0:00:52
222500 -- (-775.054) [-774.672] (-779.771) (-779.366) * [-775.302] (-777.625) (-773.662) (-780.164) -- 0:00:52
223000 -- [-774.599] (-776.007) (-781.097) (-778.342) * (-775.887) (-777.886) [-776.093] (-776.625) -- 0:00:52
223500 -- [-773.878] (-778.257) (-776.700) (-777.196) * [-774.750] (-776.068) (-777.417) (-777.113) -- 0:00:52
224000 -- (-772.147) (-775.151) (-776.273) [-778.472] * (-775.122) (-775.462) [-776.658] (-774.870) -- 0:00:51
224500 -- (-776.099) [-775.494] (-775.570) (-775.843) * (-778.412) (-778.686) (-777.494) [-778.342] -- 0:00:51
225000 -- (-774.665) (-775.626) (-774.736) [-775.855] * (-777.572) (-779.636) [-775.214] (-774.937) -- 0:00:51
Average standard deviation of split frequencies: 0.011308
225500 -- (-775.807) (-776.976) [-775.720] (-776.702) * (-777.016) (-776.360) (-775.106) [-774.979] -- 0:00:51
226000 -- (-776.653) (-775.893) (-776.834) [-774.250] * (-777.343) [-775.287] (-775.086) (-775.524) -- 0:00:51
226500 -- (-775.071) (-778.554) (-776.745) [-773.260] * (-776.074) (-774.727) [-775.082] (-777.255) -- 0:00:51
227000 -- [-775.567] (-775.170) (-775.651) (-772.644) * (-776.003) (-776.519) (-777.042) [-776.230] -- 0:00:51
227500 -- (-773.863) (-774.992) [-774.940] (-773.729) * (-775.906) (-776.037) (-779.044) [-776.568] -- 0:00:50
228000 -- [-775.245] (-774.886) (-773.310) (-775.999) * (-776.691) [-775.396] (-776.271) (-775.393) -- 0:00:50
228500 -- (-774.233) [-779.775] (-775.390) (-778.088) * (-773.050) (-777.222) [-775.526] (-775.398) -- 0:00:50
229000 -- (-775.115) [-775.744] (-776.823) (-773.790) * (-776.157) (-776.195) [-775.592] (-776.501) -- 0:00:50
229500 -- (-774.500) (-775.357) [-773.748] (-779.884) * [-783.139] (-774.105) (-774.861) (-775.788) -- 0:00:50
230000 -- [-772.365] (-776.774) (-775.302) (-775.397) * (-774.507) [-775.138] (-775.562) (-774.903) -- 0:00:50
Average standard deviation of split frequencies: 0.012943
230500 -- (-773.864) [-776.492] (-775.595) (-773.737) * [-774.280] (-777.053) (-775.219) (-775.103) -- 0:00:50
231000 -- [-774.513] (-775.309) (-775.781) (-774.344) * (-773.533) (-778.115) [-777.770] (-774.989) -- 0:00:49
231500 -- (-773.795) (-776.885) (-775.876) [-776.660] * [-774.544] (-772.463) (-775.912) (-779.471) -- 0:00:49
232000 -- (-772.914) [-778.873] (-778.754) (-776.716) * (-775.575) [-775.802] (-775.177) (-775.495) -- 0:00:49
232500 -- (-777.143) (-779.861) [-774.663] (-775.620) * (-774.747) [-776.765] (-776.694) (-775.839) -- 0:00:49
233000 -- [-773.487] (-776.315) (-777.339) (-776.335) * (-775.472) (-772.814) [-776.686] (-777.475) -- 0:00:49
233500 -- (-776.526) (-775.779) (-777.276) [-776.346] * [-776.912] (-781.240) (-775.632) (-775.711) -- 0:00:52
234000 -- (-776.885) (-776.187) [-776.299] (-774.871) * [-774.562] (-781.944) (-775.057) (-777.897) -- 0:00:52
234500 -- [-774.788] (-777.479) (-777.662) (-776.084) * [-779.475] (-776.539) (-774.940) (-776.999) -- 0:00:52
235000 -- (-773.310) (-776.043) [-777.440] (-775.280) * [-777.509] (-777.185) (-775.973) (-774.532) -- 0:00:52
Average standard deviation of split frequencies: 0.012931
235500 -- [-775.551] (-775.922) (-775.477) (-778.280) * (-776.661) [-776.297] (-776.949) (-775.462) -- 0:00:51
236000 -- (-776.684) [-775.722] (-775.712) (-774.910) * (-775.849) [-774.356] (-776.235) (-778.345) -- 0:00:51
236500 -- [-773.530] (-775.463) (-773.906) (-776.473) * [-775.180] (-775.305) (-774.341) (-778.740) -- 0:00:51
237000 -- (-776.912) [-775.434] (-778.280) (-777.113) * (-774.900) (-774.621) (-774.128) [-774.887] -- 0:00:51
237500 -- (-775.755) [-774.301] (-776.293) (-775.121) * (-776.996) (-775.321) [-773.094] (-775.019) -- 0:00:51
238000 -- (-773.867) (-776.059) [-773.957] (-775.626) * [-773.814] (-776.138) (-774.469) (-779.331) -- 0:00:51
238500 -- (-776.064) (-773.742) [-776.224] (-776.127) * (-775.502) (-775.224) (-775.930) [-776.401] -- 0:00:51
239000 -- [-777.660] (-776.851) (-777.689) (-773.725) * (-774.365) (-776.388) [-774.252] (-776.534) -- 0:00:50
239500 -- (-776.920) [-773.541] (-778.417) (-774.307) * (-775.804) [-777.663] (-774.569) (-775.775) -- 0:00:50
240000 -- (-775.442) (-777.525) [-774.193] (-775.144) * (-778.061) [-775.134] (-778.095) (-776.865) -- 0:00:50
Average standard deviation of split frequencies: 0.012577
240500 -- (-775.522) (-776.386) (-779.721) [-776.300] * (-778.518) (-776.825) (-781.358) [-775.454] -- 0:00:50
241000 -- (-775.019) (-775.289) (-778.065) [-774.859] * (-777.495) (-773.611) (-775.117) [-775.668] -- 0:00:50
241500 -- (-775.376) (-775.234) (-774.632) [-772.733] * (-775.580) [-776.309] (-776.843) (-776.404) -- 0:00:50
242000 -- (-775.425) [-774.256] (-780.891) (-774.895) * (-778.380) (-780.343) [-775.929] (-774.854) -- 0:00:50
242500 -- (-774.116) [-774.926] (-776.185) (-776.303) * (-774.077) (-780.178) [-772.371] (-778.693) -- 0:00:49
243000 -- [-776.950] (-775.425) (-777.307) (-777.237) * (-776.652) (-775.486) [-776.926] (-777.787) -- 0:00:49
243500 -- (-775.724) (-775.515) [-776.184] (-777.723) * (-775.434) [-775.465] (-778.638) (-779.242) -- 0:00:49
244000 -- (-777.721) (-778.613) (-776.087) [-776.446] * (-775.090) [-776.680] (-775.518) (-780.058) -- 0:00:49
244500 -- (-775.713) (-777.126) (-775.140) [-778.570] * [-777.569] (-775.607) (-775.971) (-775.555) -- 0:00:49
245000 -- (-776.617) (-778.432) (-776.453) [-775.819] * [-775.416] (-776.223) (-774.875) (-774.277) -- 0:00:49
Average standard deviation of split frequencies: 0.011195
245500 -- (-776.004) (-775.504) [-773.761] (-775.037) * [-776.897] (-774.919) (-779.013) (-781.248) -- 0:00:49
246000 -- (-775.201) [-774.498] (-776.862) (-780.553) * (-776.043) (-777.864) (-778.050) [-778.004] -- 0:00:49
246500 -- (-776.655) (-776.387) [-773.930] (-775.507) * [-773.960] (-775.551) (-775.003) (-774.791) -- 0:00:48
247000 -- (-778.499) [-775.716] (-777.571) (-777.958) * (-775.149) (-776.158) [-777.374] (-776.597) -- 0:00:48
247500 -- (-777.287) (-778.425) (-778.548) [-777.344] * (-776.001) (-777.655) (-777.056) [-775.988] -- 0:00:48
248000 -- (-775.322) (-777.450) (-778.686) [-778.818] * (-779.263) (-780.072) [-774.875] (-775.652) -- 0:00:48
248500 -- (-776.428) (-780.620) (-776.107) [-777.434] * (-773.669) (-781.188) (-778.091) [-775.813] -- 0:00:48
249000 -- (-776.218) (-779.139) [-776.086] (-777.564) * (-772.740) (-774.501) (-773.744) [-778.648] -- 0:00:51
249500 -- (-777.338) (-777.805) (-777.943) [-778.767] * [-778.132] (-775.911) (-777.111) (-777.282) -- 0:00:51
250000 -- [-777.514] (-778.916) (-777.820) (-777.654) * (-776.983) (-774.536) (-778.196) [-775.846] -- 0:00:51
Average standard deviation of split frequencies: 0.010888
250500 -- (-780.894) (-775.023) [-778.465] (-776.290) * (-778.459) [-774.774] (-778.302) (-775.096) -- 0:00:50
251000 -- (-780.749) [-775.155] (-775.641) (-777.044) * (-774.389) (-777.448) (-781.340) [-775.330] -- 0:00:50
251500 -- (-780.333) [-777.031] (-776.794) (-777.122) * (-775.261) [-776.829] (-778.916) (-778.144) -- 0:00:50
252000 -- (-776.105) [-776.864] (-780.585) (-775.468) * [-774.078] (-775.191) (-776.133) (-776.808) -- 0:00:50
252500 -- (-778.883) (-778.398) (-778.295) [-774.934] * (-775.772) [-775.595] (-775.741) (-776.761) -- 0:00:50
253000 -- (-777.671) [-775.860] (-779.230) (-775.656) * (-776.534) [-773.750] (-776.279) (-777.616) -- 0:00:50
253500 -- (-776.098) [-775.963] (-777.661) (-775.100) * (-779.221) (-777.591) (-776.647) [-777.176] -- 0:00:50
254000 -- [-777.573] (-776.558) (-775.041) (-776.584) * (-779.544) [-773.907] (-776.767) (-775.561) -- 0:00:49
254500 -- [-773.442] (-775.369) (-776.779) (-780.367) * (-779.838) [-775.189] (-775.233) (-779.979) -- 0:00:49
255000 -- (-777.960) (-776.158) (-776.698) [-775.572] * (-775.157) (-780.698) [-774.695] (-777.651) -- 0:00:49
Average standard deviation of split frequencies: 0.011049
255500 -- [-777.023] (-777.956) (-778.116) (-780.274) * [-775.293] (-776.696) (-774.991) (-775.868) -- 0:00:49
256000 -- (-777.292) (-779.593) [-772.834] (-776.443) * [-772.907] (-775.362) (-774.789) (-776.197) -- 0:00:49
256500 -- (-778.273) [-774.430] (-776.300) (-777.405) * (-775.605) (-780.919) [-776.981] (-775.434) -- 0:00:49
257000 -- (-775.504) (-775.677) (-780.567) [-778.219] * (-776.800) (-777.354) (-775.545) [-775.978] -- 0:00:49
257500 -- [-776.755] (-778.893) (-780.283) (-777.303) * (-775.054) (-776.081) [-776.312] (-774.900) -- 0:00:49
258000 -- (-776.158) (-778.506) [-775.735] (-775.493) * (-775.332) (-776.465) [-777.474] (-776.242) -- 0:00:48
258500 -- (-778.835) (-776.717) [-777.616] (-777.823) * (-775.096) (-773.231) (-776.715) [-775.490] -- 0:00:48
259000 -- (-779.845) (-776.179) [-775.267] (-778.339) * [-776.195] (-774.972) (-774.099) (-776.531) -- 0:00:48
259500 -- (-773.198) [-776.579] (-777.844) (-778.671) * (-776.224) (-776.511) (-775.971) [-774.527] -- 0:00:48
260000 -- (-776.114) [-776.014] (-774.944) (-775.070) * (-774.887) (-778.270) [-776.632] (-775.250) -- 0:00:48
Average standard deviation of split frequencies: 0.011612
260500 -- (-775.762) (-775.190) (-775.052) [-776.981] * [-775.632] (-776.556) (-779.652) (-779.795) -- 0:00:48
261000 -- (-774.683) (-780.606) (-775.500) [-777.729] * [-776.922] (-777.682) (-775.049) (-777.598) -- 0:00:48
261500 -- (-774.545) [-776.282] (-775.422) (-775.021) * (-776.540) [-774.947] (-778.643) (-774.429) -- 0:00:48
262000 -- (-776.176) (-777.631) [-774.848] (-775.935) * (-775.550) (-774.827) (-777.964) [-779.143] -- 0:00:47
262500 -- (-775.881) [-779.564] (-775.500) (-778.411) * (-775.807) [-776.130] (-779.809) (-774.755) -- 0:00:50
263000 -- (-776.087) (-775.302) [-776.428] (-774.316) * (-775.733) [-773.728] (-778.941) (-779.295) -- 0:00:50
263500 -- [-777.045] (-777.159) (-775.722) (-776.314) * (-774.946) [-775.516] (-773.921) (-781.299) -- 0:00:50
264000 -- [-776.780] (-778.721) (-778.315) (-777.227) * (-775.027) (-775.556) [-775.561] (-778.212) -- 0:00:50
264500 -- (-777.977) [-778.292] (-777.323) (-775.699) * (-774.470) (-775.476) (-776.384) [-778.571] -- 0:00:50
265000 -- (-774.922) [-774.614] (-777.763) (-774.460) * (-776.871) (-777.534) [-777.355] (-780.979) -- 0:00:49
Average standard deviation of split frequencies: 0.012219
265500 -- (-776.119) [-772.656] (-772.548) (-773.866) * (-774.774) [-777.328] (-780.028) (-775.057) -- 0:00:49
266000 -- (-776.062) [-774.814] (-775.315) (-777.745) * (-776.043) (-776.581) (-776.683) [-779.095] -- 0:00:49
266500 -- (-776.677) (-775.193) [-774.839] (-779.021) * (-775.989) (-774.919) (-774.699) [-779.763] -- 0:00:49
267000 -- (-777.257) (-775.923) [-777.442] (-776.893) * [-775.938] (-776.840) (-777.922) (-775.018) -- 0:00:49
267500 -- (-776.695) (-778.383) (-777.532) [-776.620] * (-775.239) (-778.180) [-773.010] (-774.808) -- 0:00:49
268000 -- (-774.658) (-778.554) (-775.311) [-773.299] * (-776.100) (-780.687) (-775.671) [-783.262] -- 0:00:49
268500 -- (-777.306) (-778.748) [-780.880] (-774.841) * (-775.575) (-778.615) (-777.401) [-777.014] -- 0:00:49
269000 -- (-777.153) [-777.031] (-776.331) (-776.098) * [-774.824] (-779.992) (-774.447) (-776.713) -- 0:00:48
269500 -- [-777.833] (-781.534) (-777.489) (-775.716) * (-775.081) [-774.279] (-779.567) (-776.013) -- 0:00:48
270000 -- (-776.359) [-774.315] (-776.048) (-775.615) * (-776.113) (-776.317) (-776.441) [-774.541] -- 0:00:48
Average standard deviation of split frequencies: 0.011092
270500 -- (-777.062) (-772.391) [-778.316] (-777.177) * (-777.659) (-776.422) (-775.289) [-774.226] -- 0:00:48
271000 -- [-774.766] (-778.323) (-776.982) (-774.785) * [-775.681] (-776.082) (-774.615) (-775.307) -- 0:00:48
271500 -- (-773.828) (-775.775) (-778.617) [-778.846] * (-778.566) (-779.737) [-775.925] (-776.395) -- 0:00:48
272000 -- (-774.390) (-776.817) (-777.483) [-775.595] * (-777.287) [-775.573] (-776.403) (-776.941) -- 0:00:48
272500 -- (-778.627) (-780.404) (-776.253) [-775.415] * (-777.251) [-777.198] (-775.134) (-780.311) -- 0:00:48
273000 -- [-772.541] (-779.797) (-776.765) (-774.748) * (-778.978) (-777.558) (-776.151) [-776.833] -- 0:00:47
273500 -- [-772.458] (-774.741) (-776.046) (-776.510) * (-779.758) (-776.154) [-777.028] (-779.264) -- 0:00:47
274000 -- (-773.218) (-776.374) [-775.080] (-776.499) * [-779.110] (-775.954) (-776.804) (-776.476) -- 0:00:50
274500 -- (-782.589) (-777.669) [-775.337] (-779.319) * (-775.559) [-776.342] (-781.494) (-774.668) -- 0:00:50
275000 -- (-776.289) (-775.888) [-774.570] (-777.158) * (-776.519) [-775.424] (-776.987) (-775.558) -- 0:00:50
Average standard deviation of split frequencies: 0.011686
275500 -- (-775.758) [-774.950] (-774.210) (-775.515) * [-775.638] (-775.527) (-777.475) (-775.523) -- 0:00:49
276000 -- (-775.386) (-776.604) (-777.094) [-775.276] * [-775.894] (-775.605) (-774.270) (-777.938) -- 0:00:49
276500 -- (-778.149) [-774.766] (-776.910) (-777.157) * (-776.175) [-775.807] (-777.151) (-781.045) -- 0:00:49
277000 -- (-777.984) (-774.875) (-776.787) [-775.076] * (-777.246) (-777.421) [-776.232] (-779.611) -- 0:00:49
277500 -- [-775.968] (-772.331) (-773.819) (-775.656) * (-776.122) (-777.909) [-774.393] (-775.459) -- 0:00:49
278000 -- [-775.990] (-776.149) (-774.189) (-774.942) * (-775.459) (-774.799) [-778.490] (-776.195) -- 0:00:49
278500 -- [-772.343] (-774.428) (-780.063) (-775.537) * (-778.311) (-777.363) [-776.118] (-775.262) -- 0:00:49
279000 -- (-773.584) (-775.375) [-779.499] (-774.855) * (-775.046) (-777.111) [-776.329] (-775.286) -- 0:00:49
279500 -- (-772.810) (-776.086) (-778.979) [-776.249] * [-776.969] (-778.018) (-776.131) (-775.389) -- 0:00:48
280000 -- (-779.531) (-776.903) [-775.607] (-776.189) * (-778.831) (-780.271) (-778.382) [-775.725] -- 0:00:48
Average standard deviation of split frequencies: 0.012553
280500 -- (-774.204) (-776.626) [-776.219] (-777.202) * (-775.440) (-779.178) (-776.339) [-776.003] -- 0:00:48
281000 -- (-775.322) (-774.167) (-772.658) [-775.178] * [-777.604] (-776.797) (-776.530) (-776.855) -- 0:00:48
281500 -- (-775.788) (-775.980) (-774.882) [-776.891] * (-774.868) [-777.389] (-775.338) (-776.806) -- 0:00:48
282000 -- (-775.469) (-774.974) (-776.212) [-774.193] * (-778.214) (-777.664) (-774.927) [-776.818] -- 0:00:48
282500 -- (-781.283) (-776.257) [-773.634] (-775.264) * [-777.651] (-775.430) (-777.297) (-776.373) -- 0:00:48
283000 -- (-779.804) (-779.514) [-773.593] (-777.349) * (-773.220) [-775.617] (-777.404) (-776.289) -- 0:00:48
283500 -- (-778.386) (-775.363) (-775.599) [-777.958] * (-779.050) (-778.900) [-775.258] (-775.107) -- 0:00:48
284000 -- (-775.708) (-776.372) (-777.451) [-776.943] * (-778.424) (-778.677) [-775.721] (-775.698) -- 0:00:47
284500 -- [-774.993] (-774.918) (-774.583) (-775.801) * [-774.472] (-780.039) (-775.175) (-780.506) -- 0:00:47
285000 -- (-775.665) [-774.749] (-775.225) (-776.838) * (-776.447) (-775.138) [-779.854] (-777.409) -- 0:00:47
Average standard deviation of split frequencies: 0.013620
285500 -- (-776.331) (-779.052) [-776.127] (-776.478) * (-778.241) (-777.741) (-777.762) [-777.911] -- 0:00:47
286000 -- (-777.049) [-780.286] (-776.884) (-776.897) * (-775.603) [-775.992] (-775.747) (-776.418) -- 0:00:47
286500 -- (-774.044) [-780.434] (-773.953) (-779.158) * (-776.098) (-777.746) (-775.089) [-778.105] -- 0:00:47
287000 -- [-775.674] (-774.603) (-775.149) (-776.089) * (-778.096) (-776.410) [-775.222] (-777.543) -- 0:00:47
287500 -- (-776.657) (-776.296) [-774.676] (-777.812) * [-775.527] (-779.287) (-775.020) (-777.861) -- 0:00:49
288000 -- (-776.276) [-773.627] (-775.400) (-781.562) * [-778.527] (-775.707) (-774.921) (-777.495) -- 0:00:49
288500 -- [-774.251] (-775.134) (-776.586) (-777.745) * (-776.990) (-775.607) (-775.660) [-777.670] -- 0:00:49
289000 -- (-775.608) [-777.453] (-773.052) (-775.857) * (-776.412) (-780.014) (-778.280) [-775.148] -- 0:00:49
289500 -- (-774.888) (-773.129) (-774.629) [-777.170] * (-775.543) (-777.855) (-775.506) [-775.118] -- 0:00:49
290000 -- (-775.921) (-773.582) [-775.057] (-777.864) * (-777.178) (-778.381) (-780.379) [-777.720] -- 0:00:48
Average standard deviation of split frequencies: 0.013231
290500 -- (-776.633) (-776.316) [-774.618] (-776.302) * (-774.947) [-775.545] (-777.813) (-776.152) -- 0:00:48
291000 -- (-780.052) [-774.912] (-775.069) (-776.204) * (-775.460) (-776.266) (-779.122) [-778.106] -- 0:00:48
291500 -- (-777.756) (-778.369) (-776.149) [-777.389] * (-776.718) [-777.136] (-775.464) (-777.399) -- 0:00:48
292000 -- (-778.025) (-777.479) [-773.686] (-776.464) * (-777.545) (-776.867) (-775.395) [-776.896] -- 0:00:48
292500 -- (-780.238) (-774.840) [-776.014] (-777.153) * (-777.609) [-773.714] (-775.160) (-775.416) -- 0:00:48
293000 -- (-779.775) [-775.279] (-779.251) (-779.880) * (-776.215) [-777.361] (-775.686) (-776.817) -- 0:00:48
293500 -- (-776.416) (-774.998) (-776.266) [-775.873] * (-776.210) (-778.863) [-773.906] (-775.358) -- 0:00:48
294000 -- (-776.719) (-774.774) [-775.386] (-776.050) * (-776.164) (-780.363) (-776.175) [-775.810] -- 0:00:48
294500 -- (-779.592) (-775.225) (-777.773) [-776.028] * [-775.580] (-777.329) (-777.054) (-775.669) -- 0:00:47
295000 -- (-776.850) (-772.726) [-777.665] (-775.259) * (-778.143) (-777.573) [-775.403] (-776.222) -- 0:00:47
Average standard deviation of split frequencies: 0.014156
295500 -- [-773.974] (-773.598) (-775.089) (-776.905) * [-778.747] (-775.976) (-774.857) (-775.792) -- 0:00:47
296000 -- (-774.318) [-775.221] (-777.632) (-776.271) * [-775.659] (-774.891) (-778.965) (-779.479) -- 0:00:47
296500 -- [-778.919] (-778.713) (-775.542) (-775.805) * (-779.390) (-776.486) (-777.151) [-776.618] -- 0:00:47
297000 -- (-780.078) (-776.973) [-777.372] (-774.954) * [-776.070] (-780.409) (-776.539) (-774.882) -- 0:00:47
297500 -- (-776.212) (-776.039) [-776.135] (-777.918) * (-776.167) (-779.439) (-775.973) [-776.194] -- 0:00:47
298000 -- (-776.753) [-775.946] (-778.159) (-775.078) * (-779.501) (-778.174) (-776.238) [-776.145] -- 0:00:47
298500 -- (-777.399) (-774.446) [-775.214] (-774.981) * [-777.288] (-775.184) (-780.576) (-774.251) -- 0:00:47
299000 -- (-778.782) (-777.937) (-779.542) [-776.404] * (-778.230) (-774.848) (-780.193) [-776.065] -- 0:00:46
299500 -- (-774.032) [-773.356] (-777.032) (-776.536) * (-780.563) [-776.389] (-778.052) (-777.148) -- 0:00:46
300000 -- (-776.128) (-775.606) (-777.430) [-777.062] * (-775.537) [-777.268] (-779.708) (-776.950) -- 0:00:46
Average standard deviation of split frequencies: 0.014111
300500 -- (-775.832) (-777.206) (-780.737) [-776.408] * (-776.007) [-775.497] (-775.671) (-780.230) -- 0:00:46
301000 -- (-777.410) (-772.091) (-778.302) [-774.324] * (-776.874) (-777.626) (-775.036) [-775.776] -- 0:00:46
301500 -- (-775.531) (-775.781) (-778.855) [-777.740] * (-775.846) [-774.115] (-774.822) (-775.659) -- 0:00:46
302000 -- (-776.164) (-773.663) [-775.986] (-776.787) * (-776.271) (-775.540) (-774.997) [-773.433] -- 0:00:46
302500 -- (-778.154) (-773.851) [-775.490] (-774.054) * (-776.325) (-777.038) (-776.499) [-777.304] -- 0:00:48
303000 -- (-776.901) (-775.067) (-775.029) [-774.117] * (-776.603) (-776.077) [-775.648] (-776.600) -- 0:00:48
303500 -- (-778.505) [-777.367] (-775.483) (-775.468) * (-776.426) (-777.185) [-775.016] (-775.164) -- 0:00:48
304000 -- [-777.261] (-777.561) (-778.012) (-775.993) * (-775.682) (-776.865) [-776.369] (-775.281) -- 0:00:48
304500 -- [-774.589] (-773.363) (-776.708) (-776.596) * (-775.127) (-777.594) (-775.893) [-775.278] -- 0:00:47
305000 -- (-776.063) [-773.482] (-777.190) (-776.095) * [-776.920] (-776.341) (-783.991) (-773.921) -- 0:00:47
Average standard deviation of split frequencies: 0.012162
305500 -- (-777.376) (-778.078) (-774.758) [-775.370] * (-775.244) (-774.437) (-783.627) [-778.903] -- 0:00:47
306000 -- (-772.451) (-777.987) [-775.916] (-778.099) * (-775.513) [-776.919] (-783.561) (-774.756) -- 0:00:47
306500 -- [-775.705] (-775.958) (-777.786) (-776.053) * (-777.451) (-776.600) (-779.615) [-776.287] -- 0:00:47
307000 -- (-776.315) [-774.653] (-778.338) (-777.083) * (-776.733) (-775.099) [-776.501] (-777.208) -- 0:00:47
307500 -- (-777.560) [-779.465] (-776.635) (-785.636) * (-774.722) (-776.739) [-777.219] (-778.308) -- 0:00:47
308000 -- (-776.255) [-775.140] (-778.150) (-777.022) * [-775.516] (-780.168) (-773.535) (-779.426) -- 0:00:47
308500 -- [-778.013] (-776.268) (-778.140) (-776.773) * (-776.574) (-779.881) (-775.458) [-774.951] -- 0:00:47
309000 -- (-776.583) (-776.023) (-775.676) [-775.005] * [-775.023] (-778.139) (-779.464) (-776.632) -- 0:00:46
309500 -- (-774.795) (-775.641) (-773.853) [-775.979] * [-776.572] (-776.787) (-775.859) (-781.138) -- 0:00:46
310000 -- (-777.641) [-775.986] (-775.898) (-776.132) * (-777.286) (-775.804) [-776.728] (-776.315) -- 0:00:46
Average standard deviation of split frequencies: 0.013657
310500 -- (-776.416) [-774.372] (-779.139) (-780.058) * (-776.864) (-776.633) [-772.520] (-776.630) -- 0:00:46
311000 -- (-774.263) (-774.915) [-775.604] (-775.882) * (-774.051) (-773.980) (-776.200) [-776.252] -- 0:00:46
311500 -- (-776.743) (-776.696) (-779.382) [-775.228] * (-775.127) [-776.783] (-775.300) (-776.425) -- 0:00:46
312000 -- (-783.767) (-774.638) (-776.823) [-774.066] * (-776.794) [-775.067] (-775.152) (-774.944) -- 0:00:46
312500 -- (-777.547) (-774.053) [-776.552] (-776.995) * (-779.516) [-776.408] (-776.793) (-773.059) -- 0:00:46
313000 -- (-779.338) [-775.965] (-776.202) (-777.365) * [-776.333] (-774.681) (-777.799) (-773.260) -- 0:00:46
313500 -- (-779.644) (-778.512) [-775.948] (-774.941) * [-775.170] (-775.638) (-778.099) (-774.976) -- 0:00:45
314000 -- (-780.428) (-776.205) [-776.040] (-776.534) * (-780.306) (-775.711) (-777.242) [-777.177] -- 0:00:45
314500 -- (-776.540) [-773.659] (-777.015) (-774.006) * (-780.517) (-774.948) [-773.896] (-779.121) -- 0:00:45
315000 -- (-776.250) (-774.800) [-779.025] (-775.438) * (-777.186) (-775.133) [-776.133] (-780.828) -- 0:00:45
Average standard deviation of split frequencies: 0.013675
315500 -- (-775.891) [-775.747] (-783.607) (-775.692) * (-773.985) [-774.418] (-778.271) (-774.536) -- 0:00:45
316000 -- (-778.245) (-777.802) (-780.588) [-776.047] * (-781.026) [-776.039] (-776.304) (-780.442) -- 0:00:45
316500 -- (-775.986) (-778.304) [-775.583] (-776.192) * (-772.829) [-774.935] (-778.364) (-776.866) -- 0:00:45
317000 -- [-776.124] (-775.219) (-776.140) (-787.088) * [-778.148] (-773.399) (-777.416) (-780.387) -- 0:00:45
317500 -- (-776.334) [-776.476] (-776.851) (-774.660) * (-779.889) [-776.848] (-779.000) (-777.614) -- 0:00:45
318000 -- (-776.510) [-775.682] (-776.217) (-779.158) * (-774.817) (-780.110) (-775.115) [-772.692] -- 0:00:45
318500 -- (-775.984) [-776.810] (-777.617) (-783.137) * (-774.951) (-778.666) [-777.689] (-773.246) -- 0:00:47
319000 -- (-775.771) [-775.175] (-776.941) (-777.906) * [-775.622] (-784.219) (-777.140) (-773.771) -- 0:00:46
319500 -- (-776.619) [-776.429] (-776.936) (-777.194) * (-773.799) (-783.648) (-775.914) [-775.662] -- 0:00:46
320000 -- (-776.379) [-776.175] (-775.412) (-780.839) * (-776.093) (-783.479) (-776.575) [-776.453] -- 0:00:46
Average standard deviation of split frequencies: 0.013639
320500 -- (-777.065) [-778.694] (-776.154) (-777.590) * (-775.552) (-785.455) (-775.747) [-773.296] -- 0:00:46
321000 -- [-775.638] (-775.554) (-775.635) (-779.461) * (-776.223) [-775.539] (-771.574) (-775.944) -- 0:00:46
321500 -- [-776.127] (-775.208) (-777.857) (-778.699) * [-775.219] (-775.369) (-776.568) (-776.204) -- 0:00:46
322000 -- [-773.125] (-776.139) (-775.848) (-773.917) * (-775.269) (-775.508) (-775.649) [-773.718] -- 0:00:46
322500 -- (-775.335) [-777.287] (-778.025) (-776.799) * [-775.573] (-777.316) (-776.730) (-774.379) -- 0:00:46
323000 -- (-774.815) (-777.036) (-775.895) [-775.625] * [-777.216] (-776.897) (-775.378) (-773.020) -- 0:00:46
323500 -- (-775.902) (-776.601) (-775.173) [-774.004] * (-777.057) (-774.349) (-775.263) [-774.768] -- 0:00:46
324000 -- (-777.524) [-775.076] (-775.326) (-774.547) * [-778.968] (-775.141) (-776.233) (-774.471) -- 0:00:45
324500 -- (-777.191) [-775.325] (-777.699) (-776.884) * (-776.260) [-776.523] (-776.199) (-773.571) -- 0:00:45
325000 -- (-775.853) [-775.871] (-779.224) (-778.473) * (-774.844) (-777.664) (-777.281) [-776.067] -- 0:00:45
Average standard deviation of split frequencies: 0.014219
325500 -- (-776.750) [-778.800] (-775.735) (-776.022) * (-776.530) [-775.970] (-772.759) (-775.712) -- 0:00:45
326000 -- (-775.489) [-776.159] (-778.152) (-779.365) * [-779.978] (-774.560) (-773.899) (-774.026) -- 0:00:45
326500 -- (-777.235) (-778.079) [-776.786] (-775.700) * (-779.506) [-775.958] (-778.162) (-776.518) -- 0:00:45
327000 -- (-779.604) (-778.360) (-780.381) [-776.090] * (-774.861) [-777.357] (-776.466) (-776.052) -- 0:00:45
327500 -- (-775.083) (-775.241) [-776.247] (-777.094) * (-778.951) [-776.585] (-775.097) (-772.972) -- 0:00:45
328000 -- (-777.803) (-776.018) (-776.201) [-775.893] * (-775.205) (-776.605) [-774.444] (-773.404) -- 0:00:45
328500 -- (-775.555) [-775.316] (-776.863) (-775.825) * [-775.739] (-776.239) (-773.889) (-774.232) -- 0:00:44
329000 -- (-775.282) [-777.941] (-777.038) (-778.116) * [-777.168] (-774.147) (-774.183) (-775.877) -- 0:00:44
329500 -- (-775.863) (-776.566) (-775.989) [-777.248] * (-773.728) [-776.852] (-774.004) (-776.775) -- 0:00:44
330000 -- [-774.255] (-775.549) (-777.774) (-776.145) * [-777.076] (-775.900) (-775.618) (-774.347) -- 0:00:44
Average standard deviation of split frequencies: 0.014177
330500 -- [-778.768] (-777.916) (-775.213) (-775.473) * (-775.080) [-779.936] (-775.029) (-775.218) -- 0:00:44
331000 -- [-775.349] (-777.128) (-774.955) (-775.374) * (-779.946) (-776.994) [-774.628] (-774.659) -- 0:00:44
331500 -- (-777.656) [-775.502] (-775.399) (-775.316) * (-774.678) (-777.256) [-774.849] (-775.560) -- 0:00:46
332000 -- (-779.006) [-775.016] (-774.947) (-777.432) * [-775.152] (-778.219) (-772.216) (-785.069) -- 0:00:46
332500 -- (-777.695) (-774.686) (-778.231) [-776.857] * (-775.093) [-775.863] (-773.272) (-782.088) -- 0:00:46
333000 -- (-774.080) (-775.044) [-776.773] (-779.812) * [-773.876] (-776.967) (-773.137) (-777.726) -- 0:00:46
333500 -- [-776.172] (-774.926) (-774.395) (-776.474) * (-776.374) (-774.703) [-775.891] (-778.222) -- 0:00:45
334000 -- [-777.036] (-775.623) (-777.154) (-780.154) * [-774.768] (-775.402) (-776.425) (-777.082) -- 0:00:45
334500 -- [-776.341] (-774.535) (-775.776) (-776.394) * (-773.730) [-773.371] (-777.235) (-776.621) -- 0:00:45
335000 -- (-777.525) (-776.595) (-775.554) [-777.913] * (-776.557) (-775.181) [-777.303] (-775.652) -- 0:00:45
Average standard deviation of split frequencies: 0.014965
335500 -- (-775.534) (-775.626) (-778.649) [-774.022] * (-778.245) [-775.328] (-774.736) (-775.257) -- 0:00:45
336000 -- (-775.979) (-776.017) (-777.089) [-775.414] * [-775.411] (-781.392) (-775.664) (-774.490) -- 0:00:45
336500 -- (-781.820) [-774.784] (-780.464) (-776.466) * (-776.913) (-775.929) [-775.751] (-780.484) -- 0:00:45
337000 -- (-775.564) (-778.934) (-776.352) [-776.477] * (-776.434) (-778.579) [-772.912] (-775.413) -- 0:00:45
337500 -- (-775.172) [-775.954] (-775.260) (-776.157) * [-778.629] (-778.028) (-775.167) (-774.248) -- 0:00:45
338000 -- (-776.894) [-775.194] (-775.771) (-772.541) * (-781.460) [-778.173] (-775.655) (-777.264) -- 0:00:45
338500 -- (-779.366) [-775.227] (-777.282) (-777.115) * (-779.230) (-777.688) (-773.853) [-778.364] -- 0:00:44
339000 -- (-775.856) (-775.249) (-780.883) [-775.351] * (-775.518) (-777.678) [-774.280] (-777.959) -- 0:00:44
339500 -- (-777.236) (-776.883) [-774.119] (-778.212) * (-773.166) (-777.721) (-777.633) [-776.336] -- 0:00:44
340000 -- (-772.880) (-775.418) [-773.210] (-775.081) * (-774.339) [-775.332] (-777.810) (-775.471) -- 0:00:44
Average standard deviation of split frequencies: 0.015452
340500 -- [-774.083] (-774.846) (-774.376) (-774.997) * (-775.056) [-776.012] (-776.167) (-775.705) -- 0:00:44
341000 -- [-780.825] (-775.280) (-775.866) (-776.325) * (-776.377) (-775.207) [-776.529] (-780.692) -- 0:00:44
341500 -- (-776.561) (-777.298) (-778.512) [-773.977] * (-775.771) (-779.802) (-773.485) [-774.926] -- 0:00:44
342000 -- (-776.219) (-778.902) [-774.737] (-775.762) * (-775.928) (-776.189) [-775.855] (-772.810) -- 0:00:44
342500 -- (-775.804) (-776.758) [-774.377] (-777.429) * [-773.645] (-777.783) (-776.344) (-776.476) -- 0:00:44
343000 -- (-775.221) (-777.901) [-778.090] (-777.591) * [-775.683] (-780.969) (-780.720) (-775.633) -- 0:00:44
343500 -- (-779.338) (-777.149) [-776.594] (-777.561) * (-774.253) (-777.615) (-778.899) [-774.307] -- 0:00:43
344000 -- (-775.950) [-774.823] (-776.415) (-779.112) * [-774.001] (-776.336) (-776.385) (-775.023) -- 0:00:43
344500 -- (-776.198) [-777.348] (-779.286) (-776.172) * (-775.994) [-776.434] (-775.423) (-779.504) -- 0:00:43
345000 -- (-775.512) (-775.916) [-775.279] (-779.861) * (-778.904) (-777.775) [-775.857] (-775.688) -- 0:00:43
Average standard deviation of split frequencies: 0.014987
345500 -- (-778.737) (-775.137) [-775.403] (-776.251) * (-774.743) (-776.696) (-775.718) [-776.122] -- 0:00:43
346000 -- (-777.170) [-775.848] (-775.281) (-774.569) * (-775.689) (-774.189) [-776.270] (-776.013) -- 0:00:43
346500 -- (-776.513) (-775.107) (-779.741) [-772.360] * (-772.753) [-776.476] (-775.238) (-780.772) -- 0:00:43
347000 -- (-776.487) (-775.959) (-775.951) [-774.610] * (-775.007) (-779.212) [-777.668] (-778.804) -- 0:00:43
347500 -- (-777.042) (-778.956) [-774.609] (-775.422) * [-775.997] (-776.890) (-778.337) (-778.823) -- 0:00:45
348000 -- (-776.255) [-775.308] (-775.470) (-777.834) * (-779.508) [-774.732] (-775.941) (-774.582) -- 0:00:44
348500 -- (-778.512) (-774.337) (-775.323) [-774.337] * [-773.830] (-775.978) (-777.156) (-774.660) -- 0:00:44
349000 -- (-778.840) [-774.311] (-775.368) (-777.076) * (-772.360) (-779.572) (-774.951) [-775.160] -- 0:00:44
349500 -- [-776.951] (-778.309) (-774.671) (-775.218) * (-772.412) (-776.719) [-775.577] (-774.334) -- 0:00:44
350000 -- [-774.949] (-777.908) (-776.623) (-777.502) * (-776.298) [-776.445] (-775.090) (-776.513) -- 0:00:44
Average standard deviation of split frequencies: 0.014787
350500 -- (-776.930) [-775.141] (-775.055) (-774.855) * (-776.527) (-775.583) [-775.445] (-776.185) -- 0:00:44
351000 -- (-775.385) [-774.769] (-773.846) (-779.285) * (-774.995) (-774.232) (-775.837) [-775.599] -- 0:00:44
351500 -- (-776.213) (-776.147) [-772.979] (-777.208) * (-773.595) [-775.592] (-775.154) (-776.617) -- 0:00:44
352000 -- (-783.650) [-776.237] (-774.848) (-774.452) * [-773.449] (-774.576) (-776.172) (-775.240) -- 0:00:44
352500 -- (-777.317) (-777.714) [-775.885] (-775.424) * (-778.885) (-774.369) (-775.901) [-775.877] -- 0:00:44
353000 -- (-778.867) [-776.464] (-774.901) (-775.040) * (-778.063) (-772.752) [-775.764] (-775.718) -- 0:00:43
353500 -- (-775.830) [-774.617] (-777.206) (-775.218) * [-775.773] (-777.992) (-776.116) (-779.657) -- 0:00:43
354000 -- (-782.420) (-775.132) [-775.088] (-780.424) * (-776.561) (-773.554) [-780.560] (-772.411) -- 0:00:43
354500 -- (-779.217) (-775.970) [-773.771] (-774.878) * (-775.531) (-775.188) (-771.364) [-779.756] -- 0:00:43
355000 -- (-777.354) (-777.017) [-775.522] (-776.872) * [-775.146] (-775.609) (-773.890) (-776.004) -- 0:00:43
Average standard deviation of split frequencies: 0.015007
355500 -- (-778.242) (-775.574) (-778.175) [-774.470] * (-776.449) (-779.700) (-776.062) [-775.168] -- 0:00:43
356000 -- (-776.434) (-778.761) [-774.779] (-775.892) * (-778.608) (-774.014) (-782.793) [-772.744] -- 0:00:43
356500 -- (-775.925) (-777.666) [-774.211] (-779.909) * (-778.034) (-776.374) [-779.548] (-777.421) -- 0:00:43
357000 -- [-777.742] (-775.447) (-778.545) (-781.205) * [-775.784] (-774.647) (-774.341) (-775.584) -- 0:00:43
357500 -- [-775.635] (-779.553) (-775.284) (-776.552) * [-772.948] (-775.912) (-776.157) (-777.286) -- 0:00:43
358000 -- (-776.531) (-774.095) [-778.020] (-776.496) * (-775.560) (-773.624) (-778.128) [-777.129] -- 0:00:43
358500 -- (-774.977) (-777.377) [-775.555] (-775.657) * (-776.311) (-776.602) [-776.009] (-775.842) -- 0:00:42
359000 -- (-775.108) (-778.225) (-776.047) [-775.176] * (-776.212) [-779.174] (-778.761) (-773.199) -- 0:00:42
359500 -- (-774.670) (-777.529) [-777.123] (-776.498) * [-775.133] (-775.197) (-779.124) (-775.057) -- 0:00:42
360000 -- (-774.383) (-775.493) [-775.330] (-776.199) * (-773.697) (-775.054) [-775.672] (-775.333) -- 0:00:42
Average standard deviation of split frequencies: 0.014958
360500 -- (-776.566) [-775.414] (-774.089) (-775.731) * (-778.673) (-772.668) [-775.415] (-778.443) -- 0:00:42
361000 -- (-779.198) (-777.140) [-775.097] (-775.418) * [-778.338] (-773.759) (-776.219) (-777.258) -- 0:00:42
361500 -- (-781.086) [-778.458] (-777.371) (-777.671) * (-784.695) [-771.862] (-776.416) (-779.984) -- 0:00:42
362000 -- (-779.186) (-776.875) (-774.508) [-775.995] * (-778.352) [-775.293] (-779.394) (-777.330) -- 0:00:42
362500 -- (-776.853) [-777.376] (-773.244) (-775.406) * (-775.949) [-777.400] (-777.525) (-777.290) -- 0:00:42
363000 -- [-775.574] (-775.534) (-777.489) (-774.687) * (-778.972) [-774.220] (-774.516) (-776.715) -- 0:00:43
363500 -- (-777.198) (-776.564) [-775.732] (-776.070) * (-776.593) (-780.294) [-775.346] (-780.854) -- 0:00:43
364000 -- (-775.956) (-777.671) [-779.472] (-779.548) * [-775.966] (-775.101) (-777.063) (-780.361) -- 0:00:43
364500 -- (-777.657) (-780.933) (-779.235) [-773.656] * (-776.249) (-778.261) [-776.464] (-776.123) -- 0:00:43
365000 -- (-774.797) (-777.184) [-777.639] (-776.789) * (-774.364) [-774.553] (-773.443) (-777.236) -- 0:00:43
Average standard deviation of split frequencies: 0.014740
365500 -- (-775.649) (-778.146) (-780.150) [-773.593] * [-773.639] (-775.805) (-776.885) (-776.455) -- 0:00:43
366000 -- (-776.477) [-776.735] (-773.896) (-781.612) * [-774.023] (-776.620) (-778.109) (-777.493) -- 0:00:43
366500 -- (-780.366) (-777.194) (-777.946) [-780.708] * (-774.608) (-777.408) [-777.371] (-776.079) -- 0:00:43
367000 -- (-780.429) (-777.376) [-775.429] (-776.575) * (-775.550) (-778.305) (-774.574) [-777.767] -- 0:00:43
367500 -- (-778.136) (-774.465) [-775.554] (-780.059) * (-775.465) (-777.191) (-777.406) [-778.210] -- 0:00:43
368000 -- (-778.134) [-774.218] (-774.398) (-778.531) * (-775.855) (-777.689) (-776.020) [-776.138] -- 0:00:42
368500 -- (-775.281) (-776.671) (-776.742) [-777.435] * (-774.862) (-776.271) (-777.514) [-775.277] -- 0:00:42
369000 -- (-777.247) (-780.091) [-777.816] (-778.152) * (-775.541) (-776.136) (-776.408) [-774.808] -- 0:00:42
369500 -- (-777.746) (-782.583) [-775.545] (-774.045) * [-778.449] (-776.235) (-775.804) (-774.791) -- 0:00:42
370000 -- [-773.944] (-774.991) (-775.139) (-778.210) * (-776.619) (-778.721) (-776.325) [-774.812] -- 0:00:42
Average standard deviation of split frequencies: 0.014696
370500 -- [-773.797] (-774.853) (-774.663) (-776.901) * (-774.975) (-778.204) (-775.083) [-773.915] -- 0:00:42
371000 -- [-774.845] (-775.814) (-775.729) (-775.111) * (-776.085) (-779.290) (-778.709) [-775.604] -- 0:00:42
371500 -- (-776.536) [-774.821] (-774.965) (-777.233) * (-776.064) (-784.017) (-776.973) [-772.566] -- 0:00:42
372000 -- [-779.820] (-776.481) (-774.715) (-774.321) * (-776.903) (-775.387) (-774.914) [-781.169] -- 0:00:42
372500 -- (-776.268) (-774.740) (-778.814) [-775.098] * [-774.998] (-774.921) (-777.202) (-780.769) -- 0:00:42
373000 -- (-782.099) (-772.667) (-776.903) [-774.671] * (-777.815) (-776.536) [-775.643] (-776.620) -- 0:00:42
373500 -- (-777.183) (-776.657) [-776.342] (-774.303) * (-774.388) [-776.851] (-774.053) (-780.346) -- 0:00:41
374000 -- (-774.094) (-774.899) (-779.112) [-775.310] * [-772.588] (-775.937) (-775.768) (-776.694) -- 0:00:41
374500 -- (-776.544) [-774.695] (-775.194) (-775.610) * (-772.786) (-775.678) [-775.968] (-775.929) -- 0:00:41
375000 -- (-776.025) (-776.273) [-777.451] (-776.569) * (-778.872) (-775.036) [-775.914] (-777.719) -- 0:00:41
Average standard deviation of split frequencies: 0.013930
375500 -- [-777.517] (-775.500) (-777.986) (-774.360) * (-780.097) (-778.056) (-777.932) [-776.475] -- 0:00:41
376000 -- (-790.375) (-772.127) [-772.496] (-773.508) * [-778.859] (-775.230) (-780.309) (-776.611) -- 0:00:41
376500 -- (-786.639) [-777.387] (-779.030) (-773.221) * (-772.896) (-773.668) [-779.185] (-774.996) -- 0:00:41
377000 -- (-779.398) [-774.295] (-782.085) (-775.163) * (-775.050) [-777.854] (-776.426) (-774.696) -- 0:00:41
377500 -- [-777.346] (-773.938) (-777.268) (-778.656) * (-775.055) [-774.721] (-776.785) (-777.953) -- 0:00:41
378000 -- (-777.322) (-774.437) (-775.209) [-775.372] * (-775.364) (-774.739) [-777.261] (-775.938) -- 0:00:42
378500 -- (-774.589) (-775.672) [-776.586] (-776.797) * (-775.317) (-776.530) (-774.527) [-776.691] -- 0:00:42
379000 -- (-780.327) (-775.928) (-776.467) [-773.932] * (-774.749) (-776.300) (-777.106) [-774.859] -- 0:00:42
379500 -- (-776.163) (-776.057) (-776.271) [-774.393] * (-775.975) (-776.901) (-777.613) [-774.598] -- 0:00:42
380000 -- (-775.371) (-776.857) [-777.209] (-774.378) * (-773.512) (-777.888) [-777.284] (-776.275) -- 0:00:42
Average standard deviation of split frequencies: 0.013347
380500 -- (-777.994) [-776.533] (-775.524) (-777.936) * (-775.686) [-776.074] (-776.924) (-775.640) -- 0:00:42
381000 -- (-777.093) (-776.408) (-775.362) [-775.001] * (-774.047) (-777.136) [-773.186] (-775.332) -- 0:00:42
381500 -- (-776.336) (-777.394) (-775.808) [-774.298] * (-779.910) (-774.521) (-777.064) [-774.776] -- 0:00:42
382000 -- (-775.552) (-775.019) (-775.764) [-773.826] * (-774.250) [-774.148] (-778.448) (-775.231) -- 0:00:42
382500 -- (-776.025) [-775.481] (-777.476) (-773.871) * (-777.848) (-778.538) [-780.281] (-774.940) -- 0:00:41
383000 -- (-776.480) [-778.496] (-776.131) (-774.636) * (-777.880) [-775.691] (-775.992) (-775.236) -- 0:00:41
383500 -- (-776.995) (-783.615) (-775.414) [-776.156] * (-775.188) (-775.042) (-777.149) [-772.639] -- 0:00:41
384000 -- (-778.597) (-778.767) [-777.683] (-775.517) * (-774.862) (-776.924) (-775.379) [-776.112] -- 0:00:41
384500 -- (-779.916) (-777.594) [-777.265] (-773.499) * (-774.240) (-775.388) (-778.128) [-775.062] -- 0:00:41
385000 -- (-778.612) (-779.932) (-776.605) [-778.194] * [-775.747] (-778.414) (-776.407) (-780.209) -- 0:00:41
Average standard deviation of split frequencies: 0.012470
385500 -- (-774.781) [-778.398] (-779.412) (-776.905) * [-773.943] (-778.103) (-777.377) (-776.565) -- 0:00:41
386000 -- (-774.876) (-775.542) (-778.571) [-777.506] * [-774.333] (-779.958) (-776.087) (-775.104) -- 0:00:41
386500 -- (-777.918) [-774.936] (-776.901) (-779.061) * [-775.688] (-775.348) (-773.925) (-779.183) -- 0:00:41
387000 -- (-778.009) (-774.919) (-775.529) [-775.798] * (-776.109) (-775.915) [-776.660] (-776.147) -- 0:00:41
387500 -- (-779.300) (-775.148) [-779.109] (-774.076) * (-775.604) [-778.860] (-776.087) (-779.483) -- 0:00:41
388000 -- (-774.991) [-775.257] (-775.873) (-775.512) * (-777.193) (-775.050) (-778.072) [-778.831] -- 0:00:41
388500 -- (-774.742) [-776.211] (-775.352) (-776.645) * (-777.430) (-774.455) [-776.932] (-781.422) -- 0:00:40
389000 -- [-774.651] (-774.867) (-775.929) (-776.169) * (-774.002) [-774.158] (-779.246) (-781.679) -- 0:00:40
389500 -- (-779.396) (-774.867) (-776.129) [-776.292] * [-775.545] (-777.433) (-776.367) (-777.486) -- 0:00:42
390000 -- (-775.689) (-775.658) [-776.911] (-772.344) * (-774.738) (-776.997) (-777.312) [-776.637] -- 0:00:42
Average standard deviation of split frequencies: 0.012871
390500 -- (-774.583) [-776.150] (-776.620) (-775.898) * [-774.899] (-775.670) (-775.053) (-777.874) -- 0:00:42
391000 -- (-776.402) (-776.901) [-781.460] (-774.306) * [-776.362] (-775.670) (-775.209) (-777.005) -- 0:00:42
391500 -- (-778.153) [-774.892] (-778.632) (-774.159) * [-776.162] (-778.181) (-775.267) (-774.689) -- 0:00:41
392000 -- [-776.736] (-782.378) (-776.902) (-771.483) * (-777.987) [-774.763] (-775.149) (-775.668) -- 0:00:41
392500 -- [-777.129] (-773.804) (-779.287) (-775.295) * (-778.496) (-775.989) [-774.055] (-776.849) -- 0:00:41
393000 -- (-778.188) (-782.195) (-776.290) [-776.294] * [-778.936] (-775.594) (-775.370) (-775.176) -- 0:00:41
393500 -- (-776.714) (-777.813) (-775.296) [-773.080] * (-776.243) [-775.935] (-777.091) (-775.492) -- 0:00:41
394000 -- (-780.603) [-777.752] (-774.761) (-775.108) * [-776.056] (-776.211) (-776.439) (-776.028) -- 0:00:41
394500 -- [-776.159] (-777.085) (-776.807) (-775.300) * (-776.758) [-776.185] (-776.949) (-777.380) -- 0:00:41
395000 -- (-775.423) (-776.606) [-775.559] (-775.616) * (-776.437) [-776.367] (-773.957) (-776.166) -- 0:00:41
Average standard deviation of split frequencies: 0.012781
395500 -- (-777.499) [-776.047] (-775.728) (-776.094) * (-775.390) [-775.286] (-775.067) (-778.329) -- 0:00:41
396000 -- [-775.024] (-776.092) (-777.245) (-773.623) * (-776.756) (-778.617) [-775.459] (-777.486) -- 0:00:41
396500 -- [-775.916] (-777.989) (-777.701) (-774.062) * [-775.398] (-777.006) (-775.042) (-776.947) -- 0:00:41
397000 -- (-780.053) [-776.834] (-774.590) (-774.514) * (-776.643) [-777.670] (-775.690) (-776.642) -- 0:00:41
397500 -- (-777.054) [-774.420] (-775.360) (-778.839) * (-778.679) [-772.726] (-775.714) (-777.060) -- 0:00:40
398000 -- (-777.554) [-776.679] (-773.021) (-775.231) * (-776.675) (-775.379) [-779.606] (-777.929) -- 0:00:40
398500 -- (-775.436) (-775.824) (-775.252) [-775.770] * (-774.925) [-774.032] (-775.880) (-774.067) -- 0:00:40
399000 -- (-778.221) (-775.025) (-774.826) [-773.725] * (-781.152) (-774.303) (-775.414) [-773.686] -- 0:00:40
399500 -- (-775.964) [-778.760] (-777.124) (-773.695) * (-779.793) (-774.372) (-776.086) [-777.455] -- 0:00:40
400000 -- (-776.649) (-776.286) (-776.342) [-776.161] * (-779.647) [-775.671] (-777.744) (-776.096) -- 0:00:40
Average standard deviation of split frequencies: 0.013269
400500 -- (-778.500) (-776.272) [-775.600] (-775.809) * [-775.528] (-774.444) (-778.834) (-775.759) -- 0:00:40
401000 -- (-775.761) (-775.599) (-775.789) [-772.670] * (-776.078) (-771.735) [-775.684] (-774.854) -- 0:00:40
401500 -- (-777.054) [-775.672] (-777.829) (-780.686) * [-778.560] (-775.963) (-776.456) (-774.712) -- 0:00:40
402000 -- (-776.330) [-775.142] (-778.209) (-775.898) * [-778.736] (-779.800) (-775.191) (-774.202) -- 0:00:40
402500 -- [-774.906] (-775.607) (-778.849) (-776.075) * (-777.270) (-775.281) (-774.002) [-775.140] -- 0:00:40
403000 -- [-775.446] (-774.826) (-775.718) (-776.014) * [-774.735] (-774.706) (-774.699) (-773.132) -- 0:00:39
403500 -- (-776.521) (-777.293) (-777.303) [-775.270] * (-774.652) (-772.433) [-775.502] (-777.429) -- 0:00:39
404000 -- (-773.143) (-773.604) (-775.707) [-777.400] * [-775.018] (-779.712) (-775.292) (-784.030) -- 0:00:39
404500 -- (-777.105) (-775.361) (-775.870) [-776.611] * (-773.644) [-777.629] (-776.483) (-775.163) -- 0:00:41
405000 -- [-775.772] (-775.466) (-777.182) (-776.757) * (-773.844) (-778.547) (-780.336) [-776.064] -- 0:00:41
Average standard deviation of split frequencies: 0.012528
405500 -- (-776.185) (-775.329) [-776.816] (-774.345) * (-775.909) (-777.538) [-777.058] (-775.153) -- 0:00:41
406000 -- (-774.255) (-776.174) (-783.543) [-778.348] * [-771.899] (-776.438) (-775.703) (-775.219) -- 0:00:40
406500 -- (-775.299) (-776.470) [-775.591] (-777.379) * (-776.163) (-777.678) (-774.526) [-776.381] -- 0:00:40
407000 -- (-774.591) (-778.195) (-779.136) [-775.535] * (-774.209) (-773.537) (-775.803) [-777.404] -- 0:00:40
407500 -- (-775.717) (-778.394) (-778.867) [-778.023] * [-777.066] (-774.999) (-775.567) (-776.156) -- 0:00:40
408000 -- (-773.744) (-774.707) (-775.623) [-776.229] * (-775.071) (-776.363) (-777.127) [-776.249] -- 0:00:40
408500 -- (-774.625) (-775.216) [-776.263] (-777.011) * (-775.249) (-777.095) [-775.437] (-776.695) -- 0:00:40
409000 -- (-779.163) [-779.320] (-775.658) (-776.572) * [-773.584] (-778.210) (-774.654) (-776.554) -- 0:00:40
409500 -- (-776.085) (-777.477) (-776.315) [-775.600] * (-773.688) (-779.623) [-776.504] (-782.322) -- 0:00:40
410000 -- [-775.718] (-777.893) (-775.358) (-776.928) * [-775.387] (-774.674) (-777.381) (-775.513) -- 0:00:40
Average standard deviation of split frequencies: 0.012563
410500 -- (-774.248) [-779.674] (-778.272) (-775.613) * (-777.353) [-777.182] (-775.214) (-775.465) -- 0:00:40
411000 -- (-780.323) (-778.486) [-777.877] (-772.463) * (-775.309) [-778.125] (-774.705) (-775.655) -- 0:00:40
411500 -- [-772.848] (-778.213) (-775.375) (-775.158) * [-776.005] (-774.931) (-778.830) (-775.280) -- 0:00:40
412000 -- (-776.230) [-775.680] (-776.363) (-775.637) * (-779.509) [-776.158] (-775.168) (-782.299) -- 0:00:39
412500 -- (-778.221) [-777.143] (-775.756) (-775.971) * (-776.335) (-785.068) [-775.298] (-778.098) -- 0:00:39
413000 -- [-773.208] (-774.666) (-776.537) (-775.443) * (-774.963) (-779.226) [-779.311] (-775.009) -- 0:00:39
413500 -- (-776.062) [-775.735] (-777.472) (-774.427) * [-776.027] (-780.718) (-775.902) (-776.188) -- 0:00:39
414000 -- (-774.863) (-776.168) (-775.412) [-776.222] * (-776.623) [-776.307] (-773.372) (-777.783) -- 0:00:39
414500 -- [-776.691] (-775.626) (-776.283) (-776.269) * (-774.514) (-777.422) [-776.487] (-777.034) -- 0:00:39
415000 -- (-775.947) (-777.840) [-775.877] (-777.098) * [-772.680] (-778.922) (-777.798) (-774.719) -- 0:00:39
Average standard deviation of split frequencies: 0.011961
415500 -- (-777.521) (-776.406) [-778.942] (-784.036) * (-775.531) [-776.575] (-780.091) (-775.682) -- 0:00:39
416000 -- (-774.341) (-776.029) [-775.301] (-776.477) * [-776.799] (-778.538) (-779.117) (-774.049) -- 0:00:39
416500 -- [-777.924] (-774.887) (-775.716) (-775.636) * (-777.469) [-778.317] (-779.182) (-773.503) -- 0:00:39
417000 -- (-780.340) (-776.576) [-776.627] (-776.739) * (-777.060) [-774.179] (-776.517) (-775.172) -- 0:00:39
417500 -- [-778.805] (-773.434) (-776.282) (-776.072) * (-776.603) (-780.304) [-773.158] (-775.191) -- 0:00:39
418000 -- (-774.743) (-775.387) [-777.398] (-775.756) * (-772.547) (-775.561) [-777.935] (-775.773) -- 0:00:38
418500 -- (-775.477) (-777.432) [-776.507] (-774.968) * (-773.790) [-775.855] (-776.079) (-776.763) -- 0:00:38
419000 -- (-775.286) (-776.691) (-780.485) [-775.547] * (-776.041) [-776.055] (-775.589) (-777.054) -- 0:00:38
419500 -- (-775.889) [-785.002] (-776.960) (-775.728) * [-777.854] (-776.005) (-776.038) (-779.458) -- 0:00:38
420000 -- (-778.699) (-775.500) [-774.336] (-779.558) * (-774.401) (-774.910) (-779.433) [-772.085] -- 0:00:40
Average standard deviation of split frequencies: 0.012514
420500 -- (-776.515) (-775.182) (-776.352) [-777.466] * (-777.340) [-774.820] (-775.133) (-775.578) -- 0:00:39
421000 -- (-776.757) (-779.657) [-774.459] (-774.634) * (-776.328) (-775.917) [-778.239] (-774.529) -- 0:00:39
421500 -- (-778.163) (-776.958) [-775.037] (-777.575) * (-776.068) (-773.404) (-778.994) [-774.110] -- 0:00:39
422000 -- (-777.766) (-776.102) (-775.466) [-775.324] * (-777.983) [-777.614] (-776.178) (-775.770) -- 0:00:39
422500 -- [-776.285] (-776.290) (-773.678) (-777.051) * (-778.916) (-778.203) (-777.115) [-774.008] -- 0:00:39
423000 -- (-773.064) (-775.211) [-774.851] (-773.782) * [-775.095] (-775.255) (-775.027) (-776.737) -- 0:00:39
423500 -- [-776.360] (-776.495) (-775.988) (-777.141) * (-774.016) (-775.138) (-774.036) [-773.894] -- 0:00:39
424000 -- (-783.224) (-774.776) (-780.775) [-777.013] * (-773.926) (-775.435) (-774.154) [-776.063] -- 0:00:39
424500 -- [-777.314] (-777.436) (-773.611) (-776.704) * (-775.881) (-777.333) (-775.507) [-774.869] -- 0:00:39
425000 -- (-777.958) [-775.153] (-776.169) (-776.756) * (-775.225) (-778.104) (-775.976) [-773.096] -- 0:00:39
Average standard deviation of split frequencies: 0.012541
425500 -- (-777.261) (-777.953) [-778.563] (-773.647) * (-776.839) (-777.586) (-778.911) [-775.626] -- 0:00:39
426000 -- [-776.074] (-779.408) (-776.960) (-776.378) * [-776.731] (-777.676) (-775.090) (-774.876) -- 0:00:39
426500 -- (-776.223) (-776.491) [-777.519] (-776.677) * (-777.691) (-777.899) [-775.274] (-775.288) -- 0:00:38
427000 -- (-776.373) (-775.769) [-774.268] (-772.811) * (-778.510) (-782.236) (-774.048) [-774.623] -- 0:00:38
427500 -- (-779.655) [-777.133] (-776.903) (-777.995) * (-774.844) (-781.220) [-774.764] (-779.146) -- 0:00:38
428000 -- (-780.823) [-774.528] (-775.142) (-777.930) * (-773.954) (-777.883) [-774.207] (-775.387) -- 0:00:38
428500 -- (-777.887) [-777.969] (-774.882) (-778.500) * (-777.659) [-776.213] (-776.704) (-775.008) -- 0:00:38
429000 -- [-775.770] (-776.890) (-772.314) (-774.187) * [-776.981] (-775.108) (-772.751) (-775.514) -- 0:00:38
429500 -- [-777.244] (-775.607) (-779.275) (-777.756) * [-777.520] (-774.083) (-776.888) (-774.948) -- 0:00:38
430000 -- [-776.052] (-777.787) (-775.158) (-775.317) * (-778.521) (-776.649) (-775.328) [-774.512] -- 0:00:38
Average standard deviation of split frequencies: 0.012588
430500 -- (-779.778) (-775.282) (-775.267) [-775.259] * [-777.334] (-775.305) (-774.221) (-777.496) -- 0:00:38
431000 -- (-779.119) (-775.056) [-777.776] (-773.761) * (-777.689) (-777.529) (-774.217) [-775.727] -- 0:00:38
431500 -- (-774.555) [-771.343] (-774.730) (-775.466) * (-775.747) (-776.874) (-775.894) [-773.920] -- 0:00:38
432000 -- (-775.884) (-775.404) (-775.298) [-773.088] * [-776.395] (-773.944) (-774.975) (-776.945) -- 0:00:38
432500 -- [-777.541] (-774.629) (-776.591) (-775.972) * [-774.149] (-776.560) (-776.427) (-775.251) -- 0:00:38
433000 -- (-778.100) (-777.513) [-776.060] (-775.390) * (-775.616) (-777.421) (-774.613) [-777.372] -- 0:00:37
433500 -- [-777.603] (-775.963) (-774.003) (-774.722) * (-775.759) [-776.989] (-774.641) (-778.874) -- 0:00:37
434000 -- (-773.458) (-773.982) [-773.231] (-774.786) * (-783.137) (-776.422) (-776.979) [-776.791] -- 0:00:37
434500 -- [-775.197] (-777.191) (-775.867) (-777.072) * (-776.404) (-774.464) (-780.276) [-773.449] -- 0:00:37
435000 -- [-776.535] (-774.593) (-779.631) (-775.072) * [-779.309] (-775.954) (-778.159) (-776.129) -- 0:00:37
Average standard deviation of split frequencies: 0.012134
435500 -- (-776.919) [-775.147] (-780.028) (-784.657) * (-777.907) [-774.659] (-777.420) (-776.701) -- 0:00:38
436000 -- (-775.329) [-774.350] (-777.264) (-777.283) * (-775.426) [-775.953] (-778.317) (-776.163) -- 0:00:38
436500 -- (-776.518) (-773.662) (-777.564) [-776.782] * (-777.249) (-775.568) [-776.789] (-779.736) -- 0:00:38
437000 -- [-775.145] (-777.254) (-776.061) (-774.239) * (-778.159) (-779.369) (-775.768) [-778.866] -- 0:00:38
437500 -- (-779.261) [-776.345] (-783.582) (-775.453) * (-779.871) (-776.281) (-775.753) [-779.910] -- 0:00:38
438000 -- [-776.860] (-776.068) (-779.912) (-774.530) * (-776.323) (-775.156) (-773.281) [-775.869] -- 0:00:38
438500 -- (-779.020) (-775.998) (-779.548) [-773.161] * (-776.658) (-774.685) [-772.158] (-774.453) -- 0:00:38
439000 -- [-772.664] (-775.256) (-779.022) (-778.708) * (-779.434) [-775.510] (-774.155) (-778.441) -- 0:00:38
439500 -- [-776.910] (-774.907) (-777.919) (-777.082) * (-775.583) [-777.319] (-774.964) (-777.597) -- 0:00:38
440000 -- (-778.264) (-778.607) (-775.599) [-776.942] * (-777.166) (-776.657) [-774.175] (-777.823) -- 0:00:38
Average standard deviation of split frequencies: 0.012362
440500 -- (-777.898) (-776.680) (-776.153) [-775.985] * (-776.489) (-777.808) (-780.370) [-777.657] -- 0:00:38
441000 -- (-774.196) (-775.223) (-774.553) [-775.649] * [-775.274] (-781.297) (-780.652) (-778.721) -- 0:00:38
441500 -- (-773.603) [-777.021] (-775.581) (-777.042) * (-776.449) [-774.918] (-775.236) (-778.547) -- 0:00:37
442000 -- (-774.418) (-777.898) (-777.422) [-774.487] * [-776.999] (-775.223) (-775.859) (-779.674) -- 0:00:37
442500 -- (-774.415) (-775.552) [-778.095] (-775.130) * [-776.796] (-775.656) (-776.372) (-777.803) -- 0:00:37
443000 -- [-774.061] (-774.763) (-778.938) (-776.169) * [-778.998] (-774.705) (-775.461) (-776.556) -- 0:00:37
443500 -- [-774.905] (-776.682) (-778.772) (-776.755) * [-776.970] (-774.908) (-776.435) (-774.820) -- 0:00:37
444000 -- [-775.649] (-776.068) (-777.559) (-774.855) * (-777.222) (-776.940) [-775.882] (-776.282) -- 0:00:37
444500 -- [-778.789] (-776.125) (-777.755) (-774.583) * [-777.383] (-777.653) (-775.487) (-777.445) -- 0:00:37
445000 -- [-776.357] (-776.051) (-776.429) (-776.838) * (-779.931) [-773.937] (-780.271) (-777.251) -- 0:00:37
Average standard deviation of split frequencies: 0.012801
445500 -- [-775.027] (-777.987) (-783.009) (-776.280) * (-775.614) (-780.876) (-780.174) [-779.036] -- 0:00:37
446000 -- (-780.659) [-776.248] (-778.522) (-776.117) * (-774.474) (-776.269) (-775.949) [-777.014] -- 0:00:37
446500 -- (-775.563) (-778.239) (-777.439) [-775.503] * [-775.824] (-775.978) (-775.711) (-778.313) -- 0:00:37
447000 -- (-779.113) [-781.238] (-775.190) (-776.071) * [-776.792] (-775.838) (-775.668) (-776.600) -- 0:00:37
447500 -- (-776.168) (-776.362) (-775.272) [-776.545] * (-776.265) (-776.246) (-776.413) [-775.378] -- 0:00:37
448000 -- (-773.843) (-775.112) [-773.980] (-774.915) * (-780.402) [-776.179] (-777.403) (-778.823) -- 0:00:36
448500 -- [-774.907] (-775.421) (-775.400) (-776.401) * (-781.334) (-774.812) [-777.157] (-776.618) -- 0:00:36
449000 -- (-772.765) (-774.788) (-775.177) [-773.350] * (-772.519) (-773.762) (-771.143) [-775.674] -- 0:00:36
449500 -- (-775.282) (-776.154) (-775.244) [-773.219] * (-777.665) [-772.986] (-775.039) (-776.416) -- 0:00:36
450000 -- (-774.450) (-775.793) [-774.990] (-779.448) * (-775.350) [-777.132] (-774.707) (-776.115) -- 0:00:36
Average standard deviation of split frequencies: 0.012727
450500 -- [-776.631] (-778.299) (-777.439) (-775.711) * (-778.069) (-785.070) [-774.725] (-774.231) -- 0:00:36
451000 -- [-776.470] (-775.503) (-775.031) (-773.710) * (-782.367) (-775.626) (-775.064) [-775.406] -- 0:00:37
451500 -- (-775.051) (-774.804) [-776.917] (-776.283) * (-776.690) (-779.466) [-776.938] (-779.123) -- 0:00:37
452000 -- (-776.475) (-775.994) [-775.857] (-777.117) * (-779.198) (-775.048) (-778.346) [-776.909] -- 0:00:37
452500 -- (-775.443) [-775.482] (-774.765) (-773.558) * [-777.933] (-775.982) (-782.623) (-777.931) -- 0:00:37
453000 -- (-778.007) (-777.525) [-773.136] (-782.011) * (-779.881) (-777.029) (-775.055) [-776.660] -- 0:00:37
453500 -- (-778.441) (-774.410) (-775.845) [-776.380] * [-775.980] (-775.588) (-775.486) (-778.414) -- 0:00:37
454000 -- (-774.000) [-775.080] (-773.985) (-778.303) * (-775.786) [-777.590] (-777.457) (-775.487) -- 0:00:37
454500 -- (-775.642) (-778.976) (-776.780) [-775.318] * [-773.099] (-779.453) (-776.427) (-779.167) -- 0:00:37
455000 -- [-774.535] (-775.749) (-783.057) (-774.635) * (-778.285) (-781.788) (-774.164) [-779.688] -- 0:00:37
Average standard deviation of split frequencies: 0.012980
455500 -- (-777.409) (-775.317) (-776.710) [-775.136] * [-772.598] (-775.252) (-775.457) (-781.434) -- 0:00:37
456000 -- (-781.997) (-776.965) (-772.784) [-774.805] * (-775.222) [-777.479] (-774.320) (-778.174) -- 0:00:36
456500 -- (-775.200) (-774.982) (-772.533) [-774.975] * (-775.020) [-773.128] (-777.469) (-775.694) -- 0:00:36
457000 -- [-781.713] (-775.798) (-776.355) (-774.151) * (-776.463) (-774.678) (-782.684) [-774.877] -- 0:00:36
457500 -- [-774.885] (-775.984) (-774.448) (-776.335) * (-775.404) [-777.678] (-782.125) (-782.102) -- 0:00:36
458000 -- (-774.932) (-774.849) [-775.585] (-777.393) * [-776.221] (-775.948) (-778.377) (-776.813) -- 0:00:36
458500 -- (-775.871) [-774.878] (-776.215) (-777.068) * (-778.697) [-777.992] (-774.398) (-777.213) -- 0:00:36
459000 -- (-774.772) [-776.171] (-777.321) (-777.171) * [-778.525] (-775.381) (-775.418) (-774.854) -- 0:00:36
459500 -- (-775.958) [-776.572] (-778.117) (-780.500) * (-780.572) [-774.598] (-773.934) (-775.027) -- 0:00:36
460000 -- (-776.130) (-775.782) (-776.365) [-772.289] * (-776.796) (-776.216) [-774.636] (-776.209) -- 0:00:36
Average standard deviation of split frequencies: 0.012441
460500 -- (-777.202) [-774.866] (-780.365) (-776.343) * (-778.814) (-779.300) [-777.571] (-775.992) -- 0:00:36
461000 -- (-772.972) (-774.896) (-779.550) [-777.268] * [-775.392] (-774.485) (-774.396) (-774.266) -- 0:00:36
461500 -- [-776.471] (-776.361) (-778.011) (-775.998) * [-775.923] (-776.312) (-774.543) (-776.696) -- 0:00:36
462000 -- (-775.839) (-775.839) (-777.727) [-774.907] * [-778.141] (-776.719) (-776.754) (-774.148) -- 0:00:36
462500 -- [-774.660] (-775.418) (-775.732) (-776.120) * (-773.182) (-776.725) [-777.840] (-775.488) -- 0:00:36
463000 -- [-776.777] (-777.969) (-777.202) (-775.309) * (-781.673) (-774.424) (-776.822) [-777.074] -- 0:00:35
463500 -- [-776.695] (-776.150) (-775.314) (-774.594) * (-777.904) [-774.626] (-775.061) (-776.198) -- 0:00:35
464000 -- (-777.112) (-775.693) (-776.841) [-776.685] * (-775.268) [-779.044] (-773.509) (-775.823) -- 0:00:35
464500 -- (-777.418) (-777.703) (-775.400) [-774.595] * (-773.673) (-772.339) (-775.280) [-775.604] -- 0:00:35
465000 -- (-773.044) (-775.947) (-779.590) [-777.059] * (-776.548) [-772.047] (-776.599) (-774.180) -- 0:00:35
Average standard deviation of split frequencies: 0.011554
465500 -- (-779.076) (-777.313) [-776.236] (-775.443) * [-776.587] (-774.899) (-776.737) (-772.422) -- 0:00:35
466000 -- (-774.965) (-776.234) (-774.113) [-776.033] * (-777.183) (-779.315) (-776.249) [-775.341] -- 0:00:35
466500 -- [-775.972] (-777.635) (-778.076) (-776.834) * (-774.471) [-772.713] (-774.936) (-774.273) -- 0:00:36
467000 -- (-774.369) (-777.819) (-780.610) [-777.575] * (-774.161) (-781.779) [-775.696] (-771.867) -- 0:00:36
467500 -- (-778.602) (-776.316) (-774.941) [-773.739] * (-777.301) (-778.436) [-777.846] (-775.076) -- 0:00:36
468000 -- (-773.771) (-776.999) [-778.720] (-777.207) * (-778.667) (-776.193) (-777.236) [-775.290] -- 0:00:36
468500 -- (-772.028) (-776.745) [-778.138] (-776.654) * (-776.832) (-777.843) [-777.741] (-776.044) -- 0:00:36
469000 -- (-778.447) [-776.508] (-777.455) (-775.682) * (-776.885) [-776.992] (-778.892) (-775.259) -- 0:00:36
469500 -- [-772.232] (-776.605) (-776.633) (-777.180) * (-774.991) (-778.064) [-774.757] (-777.439) -- 0:00:36
470000 -- (-775.583) [-776.225] (-776.654) (-777.618) * [-775.001] (-777.290) (-776.313) (-776.481) -- 0:00:36
Average standard deviation of split frequencies: 0.011597
470500 -- [-772.478] (-774.079) (-778.215) (-785.769) * (-774.938) (-777.934) [-777.648] (-775.473) -- 0:00:36
471000 -- (-778.424) [-772.608] (-776.404) (-776.985) * (-777.163) (-779.584) [-777.233] (-780.641) -- 0:00:35
471500 -- (-773.668) [-775.041] (-775.565) (-775.659) * (-776.956) [-776.245] (-776.209) (-775.151) -- 0:00:35
472000 -- (-775.824) [-774.981] (-776.638) (-779.414) * (-774.704) (-774.284) [-773.868] (-777.651) -- 0:00:35
472500 -- (-775.883) (-775.585) [-774.938] (-776.702) * (-775.024) (-775.764) [-780.181] (-774.031) -- 0:00:35
473000 -- (-775.281) [-772.557] (-777.502) (-777.235) * (-774.628) [-774.902] (-778.083) (-775.062) -- 0:00:35
473500 -- (-775.039) [-773.837] (-778.624) (-776.436) * (-774.615) [-776.837] (-777.383) (-776.757) -- 0:00:35
474000 -- (-778.715) [-772.495] (-773.914) (-776.078) * (-777.071) (-777.048) (-775.325) [-775.319] -- 0:00:35
474500 -- (-778.136) (-774.423) [-775.274] (-775.074) * [-777.140] (-776.320) (-775.940) (-774.869) -- 0:00:35
475000 -- (-777.899) (-778.138) (-775.523) [-776.891] * (-778.392) (-779.201) (-774.704) [-776.135] -- 0:00:35
Average standard deviation of split frequencies: 0.011832
475500 -- (-775.952) (-776.553) (-779.404) [-774.773] * [-773.847] (-778.610) (-775.657) (-773.850) -- 0:00:35
476000 -- (-775.717) (-775.033) [-779.083] (-774.934) * [-774.102] (-776.920) (-775.877) (-775.800) -- 0:00:35
476500 -- [-775.266] (-775.305) (-776.228) (-775.780) * [-775.136] (-775.870) (-775.012) (-774.234) -- 0:00:35
477000 -- [-771.998] (-776.756) (-775.088) (-776.002) * (-774.235) (-777.440) (-776.926) [-776.210] -- 0:00:35
477500 -- (-777.324) (-779.407) [-773.660] (-778.210) * (-778.632) (-778.739) [-776.961] (-777.058) -- 0:00:35
478000 -- [-774.631] (-779.788) (-775.716) (-779.204) * [-777.609] (-776.730) (-775.231) (-775.271) -- 0:00:34
478500 -- (-774.771) (-776.160) [-774.782] (-774.839) * (-776.498) (-775.633) [-780.406] (-775.080) -- 0:00:34
479000 -- (-778.043) [-775.199] (-772.980) (-776.665) * (-774.687) (-774.758) [-775.288] (-775.080) -- 0:00:34
479500 -- (-775.899) (-776.978) [-775.363] (-777.018) * (-774.648) [-772.789] (-774.589) (-775.461) -- 0:00:34
480000 -- (-774.954) (-777.643) [-774.411] (-774.003) * (-775.772) [-773.883] (-774.363) (-776.524) -- 0:00:34
Average standard deviation of split frequencies: 0.010788
480500 -- [-775.206] (-774.094) (-774.358) (-779.343) * (-777.183) [-774.379] (-775.887) (-777.248) -- 0:00:34
481000 -- (-775.567) (-775.986) (-780.626) [-776.530] * (-775.200) [-775.136] (-776.059) (-776.372) -- 0:00:34
481500 -- (-777.171) (-776.111) (-777.696) [-777.962] * (-775.766) (-775.618) [-775.622] (-778.044) -- 0:00:34
482000 -- (-775.196) (-776.406) [-775.484] (-776.632) * (-774.993) [-776.887] (-775.034) (-777.542) -- 0:00:34
482500 -- (-778.080) (-775.715) (-775.625) [-777.048] * (-773.890) [-774.943] (-778.141) (-776.768) -- 0:00:35
483000 -- [-776.631] (-776.559) (-778.136) (-780.979) * (-774.945) [-773.238] (-774.270) (-774.686) -- 0:00:35
483500 -- [-775.485] (-775.565) (-778.205) (-775.237) * (-775.181) (-776.189) [-775.717] (-774.847) -- 0:00:35
484000 -- [-775.378] (-776.974) (-772.121) (-775.908) * (-773.226) (-779.312) (-775.706) [-772.971] -- 0:00:35
484500 -- (-775.549) [-778.049] (-777.857) (-775.069) * [-772.549] (-775.874) (-776.829) (-782.245) -- 0:00:35
485000 -- (-775.088) (-776.248) [-776.718] (-776.404) * (-776.086) (-775.484) [-776.953] (-774.444) -- 0:00:35
Average standard deviation of split frequencies: 0.010508
485500 -- (-773.629) [-774.229] (-774.768) (-777.210) * (-776.692) (-778.831) (-776.298) [-774.763] -- 0:00:34
486000 -- (-774.687) [-775.889] (-775.013) (-776.993) * (-775.775) (-774.169) [-776.222] (-775.582) -- 0:00:34
486500 -- (-774.484) (-774.204) (-776.012) [-776.384] * [-776.937] (-775.643) (-775.894) (-778.264) -- 0:00:34
487000 -- [-774.153] (-776.061) (-774.374) (-776.361) * (-773.395) [-777.910] (-776.657) (-776.453) -- 0:00:34
487500 -- (-775.618) [-774.838] (-774.849) (-773.154) * [-776.085] (-773.186) (-775.662) (-778.971) -- 0:00:34
488000 -- (-775.416) (-778.107) (-773.741) [-776.218] * (-777.172) (-775.858) (-775.513) [-774.947] -- 0:00:34
488500 -- (-776.290) (-776.527) [-778.142] (-777.087) * (-777.521) (-776.601) [-781.054] (-775.245) -- 0:00:34
489000 -- (-774.521) [-775.902] (-775.998) (-778.159) * (-776.706) (-774.381) (-776.734) [-774.082] -- 0:00:34
489500 -- [-775.609] (-777.074) (-777.843) (-775.430) * [-776.201] (-772.644) (-776.511) (-779.354) -- 0:00:34
490000 -- (-776.472) (-778.490) [-778.375] (-777.985) * [-775.425] (-776.224) (-775.440) (-774.187) -- 0:00:34
Average standard deviation of split frequencies: 0.009928
490500 -- [-777.882] (-779.913) (-778.648) (-778.451) * (-775.412) [-775.286] (-774.969) (-773.724) -- 0:00:34
491000 -- (-775.704) (-778.068) (-774.914) [-774.536] * (-775.631) [-775.719] (-776.466) (-774.435) -- 0:00:34
491500 -- (-775.247) (-777.221) (-779.216) [-780.574] * (-780.265) (-776.866) (-776.477) [-774.524] -- 0:00:34
492000 -- (-776.086) (-780.810) (-774.747) [-774.588] * [-776.172] (-776.255) (-776.069) (-774.299) -- 0:00:34
492500 -- [-776.325] (-778.252) (-773.302) (-775.078) * (-776.159) (-774.974) (-777.185) [-774.093] -- 0:00:34
493000 -- (-774.901) (-777.532) (-776.842) [-777.109] * (-775.507) (-777.753) [-776.760] (-775.054) -- 0:00:33
493500 -- (-774.981) [-774.281] (-777.807) (-780.974) * (-776.971) [-779.035] (-775.409) (-782.636) -- 0:00:33
494000 -- (-774.255) [-779.022] (-776.815) (-776.213) * (-774.022) (-774.544) [-775.507] (-775.751) -- 0:00:33
494500 -- (-776.116) (-780.171) (-776.136) [-774.767] * (-778.618) (-772.767) (-775.671) [-774.691] -- 0:00:33
495000 -- (-773.197) (-781.715) [-773.364] (-774.882) * (-776.293) (-775.311) [-775.634] (-773.184) -- 0:00:33
Average standard deviation of split frequencies: 0.010191
495500 -- (-775.386) (-775.876) (-777.547) [-774.289] * [-774.625] (-776.453) (-777.091) (-774.972) -- 0:00:33
496000 -- (-775.329) (-775.599) (-777.297) [-775.443] * (-775.567) [-776.649] (-775.234) (-774.650) -- 0:00:33
496500 -- (-777.628) (-774.970) [-775.519] (-774.391) * (-779.079) (-777.858) (-780.417) [-774.865] -- 0:00:33
497000 -- (-781.846) [-773.068] (-774.366) (-775.748) * (-776.420) [-775.697] (-775.562) (-777.392) -- 0:00:34
497500 -- (-778.295) (-774.727) [-772.413] (-776.589) * (-778.547) [-775.959] (-777.371) (-774.947) -- 0:00:34
498000 -- (-776.998) [-774.692] (-774.439) (-776.742) * (-775.849) (-776.244) [-776.468] (-774.643) -- 0:00:34
498500 -- (-777.106) (-774.791) [-775.962] (-778.556) * [-776.028] (-775.312) (-775.360) (-775.108) -- 0:00:34
499000 -- (-775.064) (-776.484) (-773.850) [-777.739] * [-776.370] (-774.817) (-775.079) (-775.967) -- 0:00:34
499500 -- (-774.590) [-774.086] (-777.125) (-776.060) * (-777.930) (-774.985) [-774.855] (-781.573) -- 0:00:34
500000 -- [-776.710] (-775.173) (-773.988) (-777.272) * [-775.525] (-775.276) (-777.575) (-780.433) -- 0:00:34
Average standard deviation of split frequencies: 0.010252
500500 -- (-780.272) (-776.937) [-774.989] (-777.041) * (-776.352) [-777.879] (-779.529) (-777.235) -- 0:00:33
501000 -- (-775.610) (-777.066) [-777.484] (-775.409) * (-776.605) (-774.443) [-774.567] (-777.230) -- 0:00:33
501500 -- (-777.065) (-778.430) [-775.007] (-777.149) * (-779.332) [-778.256] (-781.247) (-776.456) -- 0:00:33
502000 -- (-776.401) (-774.802) (-776.678) [-775.047] * (-775.340) [-772.421] (-783.336) (-775.640) -- 0:00:33
502500 -- (-775.911) (-775.529) (-774.392) [-775.183] * [-775.735] (-775.650) (-775.323) (-776.378) -- 0:00:33
503000 -- (-776.690) (-776.879) [-774.034] (-775.949) * [-775.894] (-775.384) (-779.668) (-777.889) -- 0:00:33
503500 -- (-776.133) (-777.844) (-776.592) [-775.254] * [-773.372] (-776.140) (-777.689) (-777.634) -- 0:00:33
504000 -- (-775.630) (-776.091) [-776.978] (-776.468) * (-779.546) [-776.619] (-779.411) (-778.748) -- 0:00:33
504500 -- (-776.982) (-778.595) [-775.049] (-776.584) * (-773.579) (-776.254) [-773.971] (-776.289) -- 0:00:33
505000 -- (-774.657) (-775.312) (-774.478) [-777.215] * (-773.871) (-777.316) (-773.055) [-777.676] -- 0:00:33
Average standard deviation of split frequencies: 0.009954
505500 -- (-773.025) (-776.200) (-774.935) [-774.693] * (-774.151) [-778.680] (-777.862) (-772.827) -- 0:00:33
506000 -- [-774.863] (-775.330) (-776.807) (-777.871) * [-775.867] (-777.786) (-777.985) (-775.660) -- 0:00:33
506500 -- (-777.560) (-776.491) [-776.775] (-779.818) * [-776.214] (-774.089) (-782.403) (-780.764) -- 0:00:33
507000 -- [-777.495] (-776.564) (-774.450) (-773.920) * [-779.609] (-778.625) (-778.894) (-775.909) -- 0:00:33
507500 -- (-776.074) [-775.564] (-774.834) (-778.433) * [-776.680] (-773.314) (-773.039) (-779.905) -- 0:00:32
508000 -- [-774.861] (-779.189) (-777.995) (-776.708) * [-776.560] (-774.764) (-776.434) (-779.835) -- 0:00:32
508500 -- [-771.890] (-775.420) (-775.251) (-775.394) * (-775.542) (-775.405) [-776.491] (-775.616) -- 0:00:32
509000 -- (-776.454) (-775.806) [-778.158] (-775.733) * [-775.824] (-776.740) (-775.116) (-775.884) -- 0:00:32
509500 -- [-774.965] (-778.044) (-778.974) (-776.940) * (-777.555) [-774.736] (-775.936) (-775.297) -- 0:00:32
510000 -- [-776.619] (-781.509) (-774.505) (-777.602) * (-777.675) (-775.342) (-776.412) [-774.593] -- 0:00:32
Average standard deviation of split frequencies: 0.010103
510500 -- [-775.853] (-778.705) (-783.914) (-777.513) * (-774.649) (-775.302) (-782.470) [-775.358] -- 0:00:32
511000 -- (-780.080) [-776.209] (-776.596) (-778.136) * (-775.046) (-776.092) [-775.747] (-775.718) -- 0:00:33
511500 -- (-779.786) (-775.222) (-776.507) [-779.143] * [-775.619] (-774.897) (-777.065) (-775.503) -- 0:00:33
512000 -- (-774.347) [-775.911] (-775.515) (-775.911) * (-776.902) (-778.029) (-777.251) [-777.806] -- 0:00:33
512500 -- (-776.912) (-774.208) [-776.638] (-780.806) * (-778.596) (-777.263) (-774.838) [-777.082] -- 0:00:33
513000 -- [-773.969] (-776.214) (-777.237) (-775.914) * (-778.701) (-776.842) (-775.121) [-777.998] -- 0:00:33
513500 -- (-775.251) [-773.778] (-775.367) (-779.414) * (-777.833) [-780.754] (-775.815) (-776.931) -- 0:00:33
514000 -- [-774.006] (-776.674) (-777.477) (-778.606) * (-774.647) (-776.460) [-774.173] (-775.874) -- 0:00:33
514500 -- (-776.310) (-780.866) [-776.826] (-778.230) * (-774.799) (-777.173) (-775.904) [-775.225] -- 0:00:33
515000 -- (-774.621) (-777.289) [-777.177] (-777.084) * (-777.177) (-775.415) (-775.988) [-775.071] -- 0:00:32
Average standard deviation of split frequencies: 0.009846
515500 -- [-775.107] (-774.968) (-776.926) (-775.298) * (-774.896) [-778.850] (-778.129) (-775.407) -- 0:00:32
516000 -- (-776.797) (-778.009) (-775.044) [-774.588] * (-773.901) (-776.870) (-774.453) [-777.866] -- 0:00:32
516500 -- (-774.918) (-774.874) [-776.388] (-774.053) * (-775.551) (-778.327) [-776.190] (-781.087) -- 0:00:32
517000 -- [-771.537] (-775.893) (-776.612) (-776.070) * (-775.776) (-776.758) (-778.031) [-777.203] -- 0:00:32
517500 -- (-775.096) (-775.222) (-775.847) [-775.330] * (-774.273) (-776.900) (-778.870) [-775.392] -- 0:00:32
518000 -- (-778.870) (-773.409) (-778.093) [-775.022] * (-775.108) [-776.858] (-780.982) (-777.483) -- 0:00:32
518500 -- (-772.704) (-773.506) (-776.627) [-773.572] * [-774.978] (-774.601) (-778.890) (-782.239) -- 0:00:32
519000 -- [-775.934] (-776.296) (-775.909) (-779.018) * (-774.418) [-777.027] (-778.202) (-775.358) -- 0:00:32
519500 -- [-779.919] (-775.845) (-776.763) (-777.069) * [-776.309] (-776.676) (-774.259) (-774.569) -- 0:00:32
520000 -- [-774.244] (-776.077) (-776.537) (-776.722) * (-774.219) [-775.803] (-779.738) (-778.116) -- 0:00:32
Average standard deviation of split frequencies: 0.009808
520500 -- [-773.695] (-777.424) (-776.725) (-776.588) * [-774.796] (-779.070) (-776.087) (-777.720) -- 0:00:32
521000 -- [-775.848] (-775.638) (-775.390) (-776.256) * [-777.171] (-775.980) (-779.107) (-774.454) -- 0:00:32
521500 -- (-776.758) [-775.701] (-775.184) (-775.170) * (-773.730) (-776.576) (-777.320) [-776.431] -- 0:00:32
522000 -- (-777.202) (-776.909) [-776.670] (-777.028) * (-776.351) (-777.406) (-777.337) [-776.579] -- 0:00:32
522500 -- (-776.017) [-775.753] (-777.080) (-775.745) * (-777.789) (-777.309) [-775.493] (-773.508) -- 0:00:31
523000 -- (-774.308) (-774.601) (-776.468) [-776.251] * (-775.079) [-775.166] (-778.726) (-776.218) -- 0:00:31
523500 -- (-777.158) (-776.081) [-775.832] (-776.151) * (-776.591) [-776.709] (-777.780) (-775.973) -- 0:00:31
524000 -- [-775.670] (-774.860) (-777.423) (-780.783) * (-778.991) (-776.451) (-776.283) [-774.649] -- 0:00:31
524500 -- (-774.951) (-775.739) [-777.664] (-774.709) * [-775.605] (-775.527) (-773.442) (-774.984) -- 0:00:31
525000 -- [-775.507] (-774.376) (-777.441) (-776.508) * (-772.589) [-777.645] (-777.906) (-775.733) -- 0:00:31
Average standard deviation of split frequencies: 0.010306
525500 -- (-775.485) [-776.262] (-779.736) (-776.146) * (-777.677) (-775.767) (-777.756) [-774.888] -- 0:00:32
526000 -- [-778.705] (-775.754) (-776.284) (-776.401) * (-776.435) (-776.378) [-775.298] (-776.326) -- 0:00:32
526500 -- [-775.125] (-776.647) (-775.489) (-779.472) * (-774.841) [-774.862] (-776.118) (-777.124) -- 0:00:32
527000 -- (-774.639) [-775.024] (-774.945) (-778.879) * (-776.491) (-775.400) [-776.949] (-776.721) -- 0:00:32
527500 -- [-775.615] (-775.637) (-777.630) (-777.430) * (-774.293) (-775.405) (-777.803) [-778.193] -- 0:00:32
528000 -- (-777.715) [-775.372] (-780.635) (-776.554) * (-777.616) [-775.321] (-777.582) (-775.767) -- 0:00:32
528500 -- (-777.445) (-774.887) (-782.196) [-778.261] * (-778.153) (-778.519) (-773.076) [-775.958] -- 0:00:32
529000 -- (-778.095) [-777.069] (-779.807) (-777.188) * (-773.179) (-774.658) (-776.335) [-776.693] -- 0:00:32
529500 -- (-775.765) (-776.807) (-773.814) [-777.005] * [-776.702] (-776.918) (-773.650) (-777.632) -- 0:00:31
530000 -- (-777.560) (-775.964) [-777.130] (-776.801) * (-776.177) [-775.128] (-774.929) (-778.299) -- 0:00:31
Average standard deviation of split frequencies: 0.010907
530500 -- [-775.627] (-780.591) (-773.329) (-782.338) * (-774.181) [-774.578] (-772.600) (-779.321) -- 0:00:31
531000 -- [-777.030] (-777.870) (-778.039) (-781.155) * (-774.242) (-774.613) [-775.823] (-781.614) -- 0:00:31
531500 -- [-775.908] (-778.734) (-776.810) (-782.064) * (-775.349) [-776.199] (-776.211) (-778.898) -- 0:00:31
532000 -- (-775.341) [-777.359] (-778.369) (-777.512) * (-775.456) [-775.723] (-775.132) (-776.091) -- 0:00:31
532500 -- [-777.139] (-776.921) (-779.161) (-776.899) * [-777.547] (-779.948) (-776.560) (-777.265) -- 0:00:31
533000 -- (-777.155) (-780.747) (-776.781) [-775.039] * (-773.328) [-778.290] (-776.124) (-776.371) -- 0:00:31
533500 -- (-776.787) (-775.110) [-778.397] (-776.717) * (-776.003) (-776.923) [-776.226] (-777.809) -- 0:00:31
534000 -- (-774.276) (-776.712) [-775.816] (-776.800) * (-776.325) [-775.457] (-779.371) (-775.434) -- 0:00:31
534500 -- (-775.732) (-775.508) [-775.058] (-775.847) * (-775.805) [-777.398] (-777.226) (-774.885) -- 0:00:31
535000 -- [-774.611] (-775.544) (-775.667) (-776.015) * (-780.250) (-777.256) [-775.759] (-775.566) -- 0:00:31
Average standard deviation of split frequencies: 0.011336
535500 -- (-776.702) (-776.415) (-777.228) [-776.169] * (-778.874) (-779.911) [-774.934] (-774.884) -- 0:00:31
536000 -- (-775.116) (-776.329) [-775.515] (-774.313) * (-777.122) (-774.846) [-776.671] (-776.454) -- 0:00:31
536500 -- (-776.037) [-776.509] (-776.658) (-775.925) * [-786.616] (-777.142) (-775.615) (-772.540) -- 0:00:31
537000 -- [-777.841] (-775.664) (-778.662) (-773.692) * (-777.481) (-778.440) (-777.463) [-776.604] -- 0:00:31
537500 -- [-778.410] (-776.761) (-779.008) (-775.018) * [-776.142] (-775.956) (-775.617) (-777.430) -- 0:00:30
538000 -- [-777.717] (-775.713) (-778.124) (-780.593) * (-778.087) (-778.244) [-776.709] (-777.337) -- 0:00:30
538500 -- (-774.476) [-777.337] (-776.555) (-776.811) * (-774.545) (-778.947) (-776.869) [-775.730] -- 0:00:30
539000 -- (-775.124) [-775.945] (-774.975) (-774.040) * (-775.798) (-775.828) [-778.054] (-781.749) -- 0:00:30
539500 -- (-777.291) [-775.466] (-777.107) (-776.640) * (-775.737) (-775.197) (-774.990) [-774.685] -- 0:00:30
540000 -- (-775.672) (-775.229) [-776.741] (-777.271) * (-776.187) [-772.468] (-776.500) (-774.585) -- 0:00:30
Average standard deviation of split frequencies: 0.011238
540500 -- [-776.139] (-775.010) (-778.964) (-779.727) * (-775.625) [-772.183] (-774.482) (-776.028) -- 0:00:30
541000 -- (-779.997) (-776.694) (-774.727) [-776.563] * (-773.388) [-772.234] (-778.219) (-776.015) -- 0:00:31
541500 -- [-775.849] (-775.900) (-777.604) (-775.525) * (-777.910) (-775.349) (-776.837) [-775.675] -- 0:00:31
542000 -- (-775.370) [-778.265] (-778.375) (-776.462) * (-775.556) [-773.074] (-777.508) (-776.220) -- 0:00:31
542500 -- (-776.620) [-776.138] (-777.635) (-775.831) * (-776.106) (-775.000) [-775.667] (-772.503) -- 0:00:31
543000 -- (-775.745) (-773.816) [-774.822] (-780.520) * (-775.589) (-775.456) [-776.427] (-775.784) -- 0:00:31
543500 -- [-776.479] (-780.198) (-775.271) (-775.036) * (-778.180) [-773.354] (-776.272) (-773.724) -- 0:00:31
544000 -- (-774.127) (-773.961) [-775.990] (-775.110) * [-776.570] (-775.444) (-777.917) (-773.440) -- 0:00:31
544500 -- [-774.000] (-778.723) (-783.052) (-774.329) * (-778.913) (-776.103) (-777.333) [-776.902] -- 0:00:30
545000 -- [-777.279] (-778.385) (-775.605) (-775.983) * (-776.058) (-776.039) [-772.837] (-773.308) -- 0:00:30
Average standard deviation of split frequencies: 0.010451
545500 -- (-777.056) [-777.377] (-777.057) (-773.792) * (-775.017) (-779.513) (-776.913) [-775.454] -- 0:00:30
546000 -- (-776.626) (-777.484) (-776.802) [-774.268] * (-777.334) [-778.819] (-774.599) (-776.969) -- 0:00:30
546500 -- (-775.417) (-776.371) (-776.082) [-774.571] * [-776.759] (-779.528) (-776.496) (-775.369) -- 0:00:30
547000 -- (-778.591) (-775.551) [-774.729] (-775.655) * (-780.814) (-776.070) [-776.021] (-772.448) -- 0:00:30
547500 -- [-773.250] (-780.544) (-775.008) (-776.584) * (-774.545) (-775.632) [-774.845] (-775.075) -- 0:00:30
548000 -- (-774.376) [-777.261] (-775.961) (-774.106) * (-778.636) (-776.370) [-774.551] (-773.159) -- 0:00:30
548500 -- (-775.474) (-775.163) [-776.463] (-777.682) * (-777.704) (-778.162) [-773.623] (-779.614) -- 0:00:30
549000 -- (-775.651) (-775.112) [-779.215] (-779.068) * (-774.665) (-775.530) [-774.486] (-781.177) -- 0:00:30
549500 -- (-775.679) (-775.136) [-776.195] (-778.089) * [-776.908] (-774.125) (-778.421) (-777.890) -- 0:00:30
550000 -- [-776.527] (-775.164) (-777.884) (-777.422) * [-774.359] (-774.913) (-778.345) (-776.955) -- 0:00:30
Average standard deviation of split frequencies: 0.011081
550500 -- [-777.782] (-774.808) (-774.075) (-779.146) * (-775.131) (-775.277) (-773.851) [-782.550] -- 0:00:30
551000 -- (-777.076) (-778.342) (-779.570) [-777.498] * [-777.206] (-775.828) (-775.196) (-775.875) -- 0:00:30
551500 -- [-773.244] (-776.785) (-777.739) (-776.585) * [-774.834] (-779.580) (-777.576) (-774.024) -- 0:00:30
552000 -- (-776.979) [-776.818] (-778.138) (-777.162) * (-775.294) (-776.556) (-776.536) [-772.838] -- 0:00:30
552500 -- [-776.087] (-776.517) (-776.651) (-777.433) * [-775.409] (-778.853) (-776.631) (-774.970) -- 0:00:29
553000 -- [-776.116] (-775.684) (-775.296) (-776.589) * (-774.943) (-777.422) [-777.482] (-777.142) -- 0:00:29
553500 -- (-775.590) [-776.667] (-775.511) (-775.803) * (-776.183) [-777.240] (-775.492) (-776.317) -- 0:00:29
554000 -- [-774.981] (-775.807) (-775.391) (-776.931) * [-780.085] (-775.407) (-777.458) (-773.500) -- 0:00:29
554500 -- (-781.439) (-773.115) [-775.157] (-775.523) * (-776.642) (-776.355) (-776.785) [-774.180] -- 0:00:29
555000 -- (-776.949) (-774.960) (-775.310) [-775.726] * [-780.934] (-778.661) (-773.856) (-775.919) -- 0:00:29
Average standard deviation of split frequencies: 0.010504
555500 -- [-775.159] (-773.476) (-775.845) (-777.383) * (-780.209) (-778.642) [-777.203] (-777.239) -- 0:00:30
556000 -- (-775.128) (-775.169) (-775.152) [-775.202] * (-775.778) (-776.937) (-776.896) [-776.077] -- 0:00:30
556500 -- (-777.445) [-773.150] (-775.983) (-776.534) * [-775.261] (-778.577) (-774.797) (-774.668) -- 0:00:30
557000 -- (-775.259) (-778.065) (-777.442) [-775.034] * [-774.056] (-776.025) (-779.474) (-778.424) -- 0:00:30
557500 -- (-774.682) (-774.520) (-775.556) [-777.923] * (-775.660) [-776.811] (-777.677) (-774.456) -- 0:00:30
558000 -- [-775.896] (-781.149) (-775.624) (-778.641) * (-775.361) (-778.968) (-778.800) [-777.527] -- 0:00:30
558500 -- [-775.928] (-776.978) (-776.528) (-776.769) * (-775.728) (-783.270) (-776.926) [-774.507] -- 0:00:30
559000 -- (-776.728) (-775.570) [-776.557] (-776.474) * (-777.257) (-780.631) (-776.359) [-775.081] -- 0:00:29
559500 -- [-776.483] (-776.373) (-777.150) (-775.043) * (-777.773) (-779.532) [-775.906] (-774.022) -- 0:00:29
560000 -- (-775.050) (-777.920) [-776.277] (-775.215) * (-777.482) [-774.839] (-775.452) (-778.154) -- 0:00:29
Average standard deviation of split frequencies: 0.011024
560500 -- [-772.076] (-776.155) (-775.728) (-777.993) * (-776.576) (-777.331) (-776.024) [-778.758] -- 0:00:29
561000 -- [-775.010] (-775.951) (-777.378) (-773.794) * (-773.981) (-775.587) [-775.226] (-775.510) -- 0:00:29
561500 -- (-774.726) (-775.490) (-776.428) [-774.570] * (-777.038) [-779.767] (-777.413) (-773.714) -- 0:00:29
562000 -- (-775.114) (-778.013) (-775.236) [-772.888] * (-779.869) (-775.395) [-775.759] (-778.315) -- 0:00:29
562500 -- (-775.212) (-775.799) [-775.183] (-776.220) * (-782.082) (-777.180) [-776.991] (-778.055) -- 0:00:29
563000 -- [-777.421] (-776.132) (-778.373) (-776.288) * (-772.870) (-773.149) (-779.147) [-776.086] -- 0:00:29
563500 -- [-776.920] (-775.564) (-774.848) (-776.917) * (-775.453) [-777.352] (-778.259) (-773.938) -- 0:00:29
564000 -- (-774.109) (-777.284) (-774.867) [-774.757] * (-773.732) (-777.070) [-777.744] (-779.459) -- 0:00:29
564500 -- (-778.999) (-775.207) (-776.412) [-774.967] * (-776.114) (-777.383) [-776.673] (-778.171) -- 0:00:29
565000 -- (-774.959) [-775.770] (-775.115) (-774.634) * (-779.880) [-777.891] (-779.966) (-778.745) -- 0:00:29
Average standard deviation of split frequencies: 0.010214
565500 -- [-773.393] (-775.125) (-778.285) (-775.178) * [-774.694] (-777.079) (-776.231) (-779.687) -- 0:00:29
566000 -- (-776.809) (-779.239) (-774.451) [-773.319] * (-773.800) [-776.132] (-775.676) (-776.282) -- 0:00:29
566500 -- (-774.150) [-775.403] (-776.227) (-775.594) * (-775.480) (-776.957) [-774.657] (-775.728) -- 0:00:29
567000 -- (-774.420) (-775.736) (-775.854) [-775.173] * (-777.808) (-776.108) (-776.078) [-774.412] -- 0:00:29
567500 -- (-773.828) (-775.718) (-776.254) [-775.858] * [-777.473] (-776.948) (-779.313) (-775.847) -- 0:00:28
568000 -- (-778.385) (-776.421) (-778.075) [-777.864] * [-773.935] (-777.815) (-775.344) (-782.242) -- 0:00:28
568500 -- [-775.639] (-775.745) (-779.284) (-777.186) * (-772.338) [-776.679] (-781.208) (-781.405) -- 0:00:28
569000 -- [-777.000] (-775.981) (-775.815) (-777.247) * (-776.791) (-777.919) [-775.595] (-776.397) -- 0:00:28
569500 -- [-777.783] (-774.281) (-780.805) (-778.866) * (-778.633) (-775.255) [-776.941] (-776.269) -- 0:00:28
570000 -- (-775.397) [-774.903] (-779.009) (-779.798) * [-781.098] (-775.904) (-775.698) (-775.631) -- 0:00:29
Average standard deviation of split frequencies: 0.010087
570500 -- [-773.980] (-776.180) (-780.228) (-781.737) * (-777.955) (-775.601) (-772.128) [-776.996] -- 0:00:29
571000 -- (-776.967) (-778.161) [-774.358] (-781.732) * [-773.922] (-777.811) (-777.262) (-775.541) -- 0:00:29
571500 -- (-776.655) (-775.305) [-776.181] (-778.861) * (-775.903) (-775.001) [-779.536] (-779.776) -- 0:00:29
572000 -- [-775.615] (-776.713) (-778.458) (-779.597) * (-775.384) (-775.174) [-777.489] (-777.242) -- 0:00:29
572500 -- (-776.112) [-774.215] (-778.176) (-777.330) * (-777.493) (-777.105) [-774.148] (-775.614) -- 0:00:29
573000 -- (-774.038) (-775.821) [-775.756] (-777.316) * [-773.821] (-774.337) (-777.210) (-775.429) -- 0:00:29
573500 -- (-776.546) (-777.245) [-774.526] (-774.549) * [-776.501] (-777.226) (-775.695) (-776.128) -- 0:00:29
574000 -- [-773.607] (-777.953) (-776.273) (-775.393) * [-776.666] (-776.415) (-777.253) (-778.493) -- 0:00:28
574500 -- [-773.301] (-778.192) (-774.569) (-774.768) * (-775.883) [-774.599] (-775.532) (-778.631) -- 0:00:28
575000 -- (-774.456) (-777.393) [-775.553] (-778.804) * [-776.061] (-775.947) (-774.637) (-779.523) -- 0:00:28
Average standard deviation of split frequencies: 0.010036
575500 -- (-777.681) [-776.561] (-776.295) (-775.018) * (-777.736) (-775.214) (-775.484) [-777.185] -- 0:00:28
576000 -- (-772.162) [-775.975] (-774.946) (-776.502) * (-772.557) (-777.415) [-774.937] (-780.166) -- 0:00:28
576500 -- [-772.915] (-776.291) (-772.517) (-776.949) * [-777.000] (-778.022) (-779.986) (-777.968) -- 0:00:28
577000 -- (-778.029) (-776.166) (-775.804) [-774.664] * [-776.394] (-776.988) (-777.923) (-781.065) -- 0:00:28
577500 -- (-779.104) (-775.280) [-774.466] (-776.783) * (-776.122) [-778.567] (-778.357) (-776.544) -- 0:00:28
578000 -- (-775.537) (-775.105) (-773.913) [-775.806] * [-774.720] (-776.216) (-777.083) (-777.697) -- 0:00:28
578500 -- (-775.073) [-777.436] (-774.477) (-775.594) * [-776.582] (-775.021) (-778.249) (-780.110) -- 0:00:28
579000 -- (-776.636) (-779.399) (-774.996) [-777.853] * (-776.908) (-775.614) (-776.976) [-779.101] -- 0:00:28
579500 -- (-777.038) (-779.736) [-776.007] (-777.948) * (-777.674) (-778.034) (-776.617) [-779.583] -- 0:00:28
580000 -- (-774.510) (-780.116) (-774.569) [-773.795] * [-774.743] (-776.562) (-775.986) (-775.535) -- 0:00:28
Average standard deviation of split frequencies: 0.009607
580500 -- (-776.233) [-775.731] (-774.407) (-774.819) * [-779.034] (-776.525) (-774.741) (-777.868) -- 0:00:28
581000 -- [-774.776] (-776.711) (-775.078) (-774.957) * (-778.940) (-775.297) [-775.246] (-777.629) -- 0:00:28
581500 -- [-776.227] (-776.682) (-776.341) (-776.390) * (-775.762) [-776.345] (-775.998) (-775.894) -- 0:00:28
582000 -- [-776.009] (-777.473) (-779.591) (-774.377) * (-775.121) (-779.207) (-775.906) [-773.655] -- 0:00:28
582500 -- (-775.836) (-775.223) [-778.135] (-775.171) * (-778.833) (-776.705) [-771.963] (-775.895) -- 0:00:27
583000 -- (-777.218) (-777.508) (-776.031) [-775.576] * (-778.893) (-776.485) [-776.368] (-778.525) -- 0:00:27
583500 -- (-776.735) (-779.600) (-775.679) [-776.555] * (-776.274) (-775.543) [-775.649] (-779.814) -- 0:00:27
584000 -- [-775.673] (-777.562) (-775.082) (-776.094) * (-778.848) (-775.435) (-775.771) [-776.744] -- 0:00:27
584500 -- (-775.616) (-776.820) [-779.586] (-777.678) * (-774.582) (-779.368) [-776.709] (-778.926) -- 0:00:28
585000 -- (-775.230) (-775.682) (-776.358) [-774.042] * (-777.236) [-775.474] (-775.788) (-776.632) -- 0:00:28
Average standard deviation of split frequencies: 0.009206
585500 -- (-775.182) (-780.633) (-774.826) [-777.145] * (-774.973) (-774.806) [-776.415] (-776.908) -- 0:00:28
586000 -- (-779.436) (-779.190) [-774.583] (-777.384) * (-774.546) (-772.664) [-778.075] (-779.651) -- 0:00:28
586500 -- (-773.829) (-775.118) (-776.882) [-775.991] * (-776.313) (-774.198) [-775.958] (-780.620) -- 0:00:28
587000 -- [-774.691] (-776.042) (-775.659) (-773.059) * (-775.812) (-776.072) (-772.825) [-774.695] -- 0:00:28
587500 -- (-776.479) (-778.829) [-780.078] (-775.715) * (-776.787) (-775.474) [-777.276] (-775.617) -- 0:00:28
588000 -- [-776.592] (-775.354) (-778.728) (-777.861) * (-774.538) [-779.251] (-779.035) (-777.515) -- 0:00:28
588500 -- [-776.064] (-776.043) (-776.098) (-775.500) * (-774.745) (-783.600) (-773.773) [-775.565] -- 0:00:27
589000 -- [-777.112] (-774.922) (-775.057) (-775.862) * [-775.498] (-776.279) (-776.654) (-775.665) -- 0:00:27
589500 -- [-782.896] (-781.687) (-774.959) (-776.364) * [-782.178] (-776.664) (-775.382) (-777.400) -- 0:00:27
590000 -- (-777.807) (-776.473) (-776.755) [-779.627] * (-775.788) [-774.582] (-775.807) (-776.895) -- 0:00:27
Average standard deviation of split frequencies: 0.009400
590500 -- (-780.292) (-773.735) [-775.463] (-775.917) * (-780.480) [-775.762] (-776.058) (-778.673) -- 0:00:27
591000 -- (-774.861) [-774.480] (-781.220) (-774.698) * (-778.220) (-775.728) (-776.901) [-775.863] -- 0:00:27
591500 -- (-778.086) (-775.335) (-776.791) [-774.594] * (-775.763) (-776.094) [-776.035] (-775.989) -- 0:00:27
592000 -- (-775.506) [-777.034] (-778.235) (-780.005) * [-776.864] (-776.735) (-776.257) (-776.276) -- 0:00:27
592500 -- (-779.240) (-775.411) [-776.426] (-775.373) * (-781.741) (-777.596) (-777.355) [-774.786] -- 0:00:27
593000 -- (-777.291) (-775.093) (-777.229) [-776.143] * (-777.987) (-776.197) (-775.674) [-775.062] -- 0:00:27
593500 -- (-774.424) [-777.113] (-775.419) (-776.101) * (-774.685) (-776.476) [-775.335] (-781.972) -- 0:00:27
594000 -- (-777.035) (-780.008) [-777.936] (-776.111) * (-775.202) [-778.642] (-775.834) (-772.923) -- 0:00:27
594500 -- (-775.123) (-777.311) [-774.286] (-778.522) * [-778.655] (-777.174) (-775.722) (-776.336) -- 0:00:27
595000 -- (-775.332) [-776.354] (-777.534) (-780.478) * (-779.268) (-778.366) [-776.380] (-776.578) -- 0:00:27
Average standard deviation of split frequencies: 0.009184
595500 -- (-778.419) (-777.674) [-778.421] (-776.495) * [-774.447] (-777.280) (-775.496) (-778.634) -- 0:00:27
596000 -- (-775.289) [-774.112] (-776.199) (-774.402) * (-775.812) [-774.499] (-776.676) (-777.729) -- 0:00:27
596500 -- (-776.295) (-780.925) [-776.678] (-775.733) * [-775.670] (-774.054) (-777.855) (-779.505) -- 0:00:27
597000 -- (-777.541) (-778.201) [-775.646] (-775.346) * (-774.689) (-781.874) [-772.258] (-777.306) -- 0:00:27
597500 -- (-778.460) (-773.567) (-777.473) [-775.693] * (-776.829) (-780.221) [-773.885] (-776.527) -- 0:00:26
598000 -- (-775.429) [-775.198] (-776.097) (-776.481) * (-775.626) (-783.585) [-774.683] (-778.160) -- 0:00:26
598500 -- [-780.914] (-775.014) (-776.450) (-776.783) * (-776.893) [-774.696] (-776.250) (-777.662) -- 0:00:26
599000 -- (-780.907) (-781.316) [-779.627] (-777.241) * (-776.176) (-774.277) (-775.757) [-775.968] -- 0:00:26
599500 -- (-778.138) [-776.732] (-776.384) (-780.377) * (-775.872) [-777.062] (-775.928) (-775.317) -- 0:00:26
600000 -- [-776.174] (-776.190) (-777.500) (-780.100) * [-776.707] (-777.235) (-778.555) (-775.430) -- 0:00:26
Average standard deviation of split frequencies: 0.008764
600500 -- (-778.396) [-773.479] (-775.431) (-776.259) * [-776.096] (-776.548) (-775.580) (-777.642) -- 0:00:27
601000 -- (-776.199) (-776.485) (-775.903) [-778.303] * (-779.499) (-776.485) (-775.282) [-775.594] -- 0:00:27
601500 -- (-775.817) [-775.872] (-778.503) (-777.655) * (-778.317) [-776.742] (-776.655) (-774.632) -- 0:00:27
602000 -- (-775.877) [-777.086] (-776.858) (-778.811) * [-777.840] (-775.631) (-774.620) (-777.394) -- 0:00:27
602500 -- [-773.264] (-773.955) (-774.545) (-778.864) * (-777.561) (-775.094) [-776.501] (-777.165) -- 0:00:27
603000 -- (-776.498) (-774.913) (-775.534) [-777.836] * (-777.123) [-775.693] (-775.604) (-774.442) -- 0:00:26
603500 -- (-776.416) [-776.556] (-775.100) (-774.157) * (-774.949) (-778.587) [-775.273] (-778.559) -- 0:00:26
604000 -- (-776.008) [-773.889] (-772.200) (-775.776) * (-776.556) [-775.352] (-774.673) (-778.850) -- 0:00:26
604500 -- (-778.793) (-776.448) [-778.044] (-778.193) * (-779.551) (-773.611) (-774.998) [-776.977] -- 0:00:26
605000 -- [-775.372] (-774.780) (-776.801) (-775.781) * [-774.373] (-775.539) (-779.386) (-777.378) -- 0:00:26
Average standard deviation of split frequencies: 0.008859
605500 -- (-777.823) (-775.190) (-777.228) [-777.129] * (-779.000) [-774.798] (-781.233) (-778.638) -- 0:00:26
606000 -- [-776.140] (-775.281) (-777.332) (-776.306) * [-774.563] (-779.090) (-776.881) (-775.492) -- 0:00:26
606500 -- (-776.008) [-775.461] (-779.405) (-776.623) * (-774.995) [-774.745] (-776.939) (-780.245) -- 0:00:26
607000 -- (-774.831) (-776.074) [-775.905] (-776.130) * [-773.976] (-779.573) (-775.214) (-777.036) -- 0:00:26
607500 -- [-774.939] (-776.742) (-778.270) (-775.662) * (-776.664) (-775.198) (-777.491) [-775.391] -- 0:00:26
608000 -- (-775.838) (-782.909) [-775.335] (-774.885) * (-778.254) (-776.736) [-777.657] (-782.993) -- 0:00:26
608500 -- (-775.787) (-775.143) (-777.158) [-775.309] * (-774.972) (-774.713) [-773.806] (-779.883) -- 0:00:26
609000 -- (-776.189) [-776.242] (-779.130) (-776.316) * (-775.686) [-776.423] (-774.558) (-777.241) -- 0:00:26
609500 -- (-776.221) (-774.399) [-778.912] (-775.815) * [-775.988] (-776.112) (-775.011) (-775.701) -- 0:00:26
610000 -- (-776.795) (-775.174) [-775.372] (-776.218) * (-776.824) (-775.868) (-775.333) [-773.073] -- 0:00:26
Average standard deviation of split frequencies: 0.007679
610500 -- (-776.161) (-776.817) [-774.948] (-781.368) * (-777.437) (-778.516) (-774.684) [-777.947] -- 0:00:26
611000 -- (-775.578) [-777.200] (-775.401) (-775.109) * (-778.134) [-777.266] (-775.997) (-776.341) -- 0:00:26
611500 -- (-775.620) [-776.439] (-776.079) (-774.449) * (-774.982) (-773.370) [-777.081] (-780.085) -- 0:00:26
612000 -- [-777.546] (-775.754) (-777.321) (-774.862) * (-775.190) [-777.465] (-779.460) (-776.942) -- 0:00:25
612500 -- (-775.428) [-774.258] (-779.457) (-776.516) * (-778.329) (-781.290) (-776.717) [-773.911] -- 0:00:25
613000 -- [-775.440] (-777.090) (-779.924) (-778.794) * (-775.852) (-774.804) [-780.815] (-775.984) -- 0:00:25
613500 -- (-773.679) (-776.092) (-778.356) [-776.314] * (-773.617) [-777.294] (-774.867) (-775.243) -- 0:00:25
614000 -- (-777.224) (-774.479) (-777.124) [-778.843] * (-774.441) (-777.040) [-776.250] (-775.340) -- 0:00:25
614500 -- (-778.003) (-774.859) [-779.235] (-775.211) * (-776.902) [-777.938] (-775.396) (-774.157) -- 0:00:25
615000 -- (-777.302) (-775.903) [-780.244] (-776.781) * [-772.750] (-778.312) (-777.176) (-775.874) -- 0:00:25
Average standard deviation of split frequencies: 0.007693
615500 -- (-774.858) (-774.731) [-781.731] (-779.217) * (-779.053) (-778.505) (-776.806) [-774.845] -- 0:00:25
616000 -- (-776.620) [-774.764] (-775.915) (-778.848) * (-782.001) (-775.818) (-780.478) [-775.473] -- 0:00:26
616500 -- (-774.109) [-775.234] (-776.374) (-779.835) * (-782.172) (-775.680) [-774.748] (-775.338) -- 0:00:26
617000 -- (-778.003) (-777.577) [-777.329] (-777.872) * (-778.133) (-783.281) (-777.036) [-774.946] -- 0:00:26
617500 -- (-775.960) (-775.169) [-776.156] (-775.200) * (-774.609) (-776.536) [-773.801] (-776.585) -- 0:00:26
618000 -- [-774.066] (-778.003) (-775.452) (-780.140) * (-774.797) (-772.611) (-777.028) [-775.269] -- 0:00:25
618500 -- [-775.480] (-776.700) (-776.438) (-777.402) * (-776.021) (-777.715) [-776.590] (-778.763) -- 0:00:25
619000 -- (-778.335) (-775.154) (-775.731) [-779.018] * (-773.605) (-775.440) [-776.256] (-776.882) -- 0:00:25
619500 -- (-777.811) [-775.840] (-774.685) (-781.773) * (-778.591) (-778.438) (-775.219) [-778.097] -- 0:00:25
620000 -- (-780.101) [-777.272] (-774.711) (-780.131) * (-776.835) (-774.599) [-773.302] (-775.096) -- 0:00:25
Average standard deviation of split frequencies: 0.007435
620500 -- (-775.614) [-775.871] (-775.857) (-780.435) * [-774.936] (-779.725) (-775.448) (-774.615) -- 0:00:25
621000 -- (-776.491) (-774.956) [-775.975] (-777.460) * (-777.441) (-774.918) (-774.375) [-774.452] -- 0:00:25
621500 -- (-778.167) (-775.503) (-779.968) [-777.215] * [-775.169] (-780.871) (-778.389) (-774.122) -- 0:00:25
622000 -- [-776.773] (-779.631) (-779.210) (-775.408) * (-778.971) (-777.406) [-777.148] (-775.281) -- 0:00:25
622500 -- [-776.529] (-781.527) (-776.432) (-773.731) * [-772.322] (-776.766) (-775.950) (-776.984) -- 0:00:25
623000 -- (-774.808) [-775.646] (-775.345) (-776.598) * (-775.003) (-773.239) (-777.210) [-777.060] -- 0:00:25
623500 -- (-775.691) [-776.137] (-783.285) (-777.179) * [-776.562] (-779.442) (-777.211) (-775.989) -- 0:00:25
624000 -- (-777.270) (-775.262) [-778.838] (-780.139) * (-775.178) [-776.536] (-774.454) (-781.466) -- 0:00:25
624500 -- (-783.272) (-773.815) (-776.847) [-774.735] * [-772.933] (-774.461) (-774.807) (-775.056) -- 0:00:25
625000 -- (-776.755) [-772.833] (-775.580) (-776.421) * (-775.788) [-779.215] (-775.284) (-775.885) -- 0:00:25
Average standard deviation of split frequencies: 0.007570
625500 -- [-783.745] (-776.253) (-774.148) (-775.405) * (-774.318) (-779.312) (-777.896) [-777.752] -- 0:00:25
626000 -- (-779.990) (-774.858) [-775.965] (-776.312) * [-775.535] (-775.688) (-777.621) (-784.065) -- 0:00:25
626500 -- (-774.927) [-775.697] (-783.981) (-775.933) * [-772.411] (-780.016) (-775.646) (-776.944) -- 0:00:25
627000 -- (-778.370) (-776.827) (-776.307) [-775.267] * (-778.186) (-778.061) (-775.495) [-776.278] -- 0:00:24
627500 -- (-779.039) [-779.722] (-773.304) (-775.842) * (-777.350) [-775.565] (-777.272) (-776.473) -- 0:00:24
628000 -- (-775.495) [-775.204] (-775.910) (-775.941) * (-780.624) [-776.065] (-779.898) (-777.309) -- 0:00:24
628500 -- (-774.935) [-775.188] (-775.564) (-776.953) * [-776.679] (-777.327) (-774.400) (-784.754) -- 0:00:24
629000 -- (-774.881) (-777.178) [-773.258] (-777.075) * (-776.036) (-778.953) (-774.247) [-774.853] -- 0:00:24
629500 -- (-777.385) (-773.050) [-774.259] (-776.929) * (-776.586) (-774.629) [-773.378] (-778.231) -- 0:00:24
630000 -- (-775.655) (-778.696) [-776.197] (-779.126) * [-774.446] (-775.696) (-774.429) (-777.023) -- 0:00:24
Average standard deviation of split frequencies: 0.007003
630500 -- [-779.210] (-777.240) (-776.594) (-776.588) * (-772.215) [-778.562] (-774.093) (-777.435) -- 0:00:24
631000 -- (-777.291) (-778.346) (-777.164) [-777.679] * (-775.135) [-776.333] (-773.011) (-774.870) -- 0:00:25
631500 -- [-777.665] (-777.568) (-776.137) (-776.828) * (-775.545) (-775.518) (-772.969) [-777.956] -- 0:00:25
632000 -- (-780.803) [-775.384] (-776.025) (-775.027) * (-775.298) (-776.349) [-776.542] (-776.278) -- 0:00:25
632500 -- (-777.333) (-777.074) [-774.329] (-776.019) * (-776.823) (-775.918) [-774.477] (-777.872) -- 0:00:24
633000 -- (-779.688) [-774.626] (-779.768) (-776.491) * (-776.637) (-777.286) [-777.385] (-779.856) -- 0:00:24
633500 -- [-776.798] (-777.616) (-778.908) (-779.148) * (-775.608) (-774.029) [-774.642] (-780.696) -- 0:00:24
634000 -- (-775.321) (-775.482) (-777.096) [-773.673] * (-777.524) (-775.562) (-776.963) [-779.621] -- 0:00:24
634500 -- (-776.171) [-775.895] (-778.112) (-775.614) * (-776.255) [-778.286] (-774.656) (-777.141) -- 0:00:24
635000 -- (-777.201) [-779.131] (-778.061) (-774.839) * [-775.777] (-778.304) (-771.295) (-779.308) -- 0:00:24
Average standard deviation of split frequencies: 0.007295
635500 -- (-775.964) [-776.601] (-776.940) (-774.676) * (-778.958) (-775.810) [-774.535] (-775.999) -- 0:00:24
636000 -- [-776.769] (-776.343) (-775.923) (-774.784) * (-775.568) [-774.688] (-772.370) (-776.527) -- 0:00:24
636500 -- (-775.976) (-776.229) (-775.370) [-775.563] * [-774.562] (-774.576) (-775.479) (-776.088) -- 0:00:24
637000 -- [-775.087] (-777.625) (-773.862) (-779.778) * (-775.599) (-776.174) [-771.779] (-777.750) -- 0:00:24
637500 -- (-775.493) (-779.951) [-773.788] (-773.874) * (-775.301) (-776.603) [-773.742] (-775.221) -- 0:00:24
638000 -- (-780.012) (-779.410) (-775.534) [-775.380] * [-775.525] (-773.877) (-776.062) (-778.736) -- 0:00:24
638500 -- (-779.115) [-775.410] (-776.670) (-776.385) * (-775.119) [-774.990] (-776.716) (-776.914) -- 0:00:24
639000 -- (-778.463) (-778.297) [-775.873] (-773.877) * [-776.192] (-775.658) (-774.924) (-775.736) -- 0:00:24
639500 -- (-775.733) (-775.284) (-779.337) [-773.820] * (-775.523) (-775.505) [-776.579] (-776.578) -- 0:00:24
640000 -- (-774.941) (-776.611) [-776.441] (-779.198) * [-778.096] (-772.359) (-776.396) (-778.591) -- 0:00:24
Average standard deviation of split frequencies: 0.006971
640500 -- (-776.373) [-775.361] (-776.374) (-775.783) * [-773.305] (-775.977) (-777.693) (-778.623) -- 0:00:24
641000 -- [-776.351] (-778.056) (-778.664) (-775.782) * [-774.321] (-774.659) (-777.823) (-777.711) -- 0:00:24
641500 -- (-777.296) (-775.732) [-777.073] (-777.054) * (-775.416) [-774.823] (-773.301) (-776.368) -- 0:00:24
642000 -- (-775.985) [-777.229] (-774.755) (-774.151) * (-777.633) (-777.645) [-775.464] (-776.937) -- 0:00:23
642500 -- (-778.304) (-775.903) (-777.081) [-773.943] * (-778.988) [-777.076] (-775.537) (-776.439) -- 0:00:23
643000 -- (-777.423) (-774.408) [-776.520] (-775.824) * [-775.352] (-775.618) (-775.509) (-780.134) -- 0:00:23
643500 -- (-776.966) [-776.500] (-776.155) (-776.837) * [-775.150] (-778.242) (-775.807) (-776.066) -- 0:00:23
644000 -- [-781.053] (-777.808) (-777.128) (-775.213) * (-775.516) (-772.847) (-776.949) [-772.511] -- 0:00:23
644500 -- (-776.155) [-775.806] (-774.474) (-774.831) * (-774.878) (-775.090) [-779.418] (-777.308) -- 0:00:23
645000 -- (-775.006) (-775.174) (-774.551) [-774.589] * (-774.965) [-774.483] (-779.091) (-775.076) -- 0:00:23
Average standard deviation of split frequencies: 0.007067
645500 -- (-773.087) (-774.307) (-775.823) [-774.580] * (-776.124) (-779.314) (-777.359) [-775.166] -- 0:00:23
646000 -- (-772.110) (-776.687) [-778.544] (-777.248) * (-773.151) [-776.227] (-775.290) (-774.447) -- 0:00:23
646500 -- (-776.296) (-774.908) (-775.956) [-775.509] * (-777.618) (-773.864) (-777.073) [-776.399] -- 0:00:23
647000 -- (-775.250) [-773.036] (-777.774) (-777.270) * [-774.949] (-778.709) (-776.002) (-778.945) -- 0:00:24
647500 -- (-776.893) [-775.210] (-779.344) (-776.868) * [-778.103] (-778.395) (-779.977) (-773.765) -- 0:00:23
648000 -- (-778.582) [-776.875] (-776.822) (-778.902) * (-775.880) (-776.794) (-777.777) [-776.990] -- 0:00:23
648500 -- (-774.283) (-775.830) [-779.696] (-774.288) * (-776.907) (-780.476) [-776.358] (-775.407) -- 0:00:23
649000 -- (-774.344) (-777.166) [-779.107] (-774.080) * [-774.725] (-774.301) (-779.763) (-776.426) -- 0:00:23
649500 -- (-776.590) (-777.699) (-779.599) [-772.201] * (-777.337) [-772.988] (-776.862) (-776.412) -- 0:00:23
650000 -- (-779.848) (-777.726) (-776.137) [-775.051] * (-777.044) (-775.916) [-777.278] (-780.332) -- 0:00:23
Average standard deviation of split frequencies: 0.006635
650500 -- (-776.792) [-775.912] (-774.543) (-778.863) * (-775.822) [-775.540] (-776.992) (-776.803) -- 0:00:23
651000 -- (-777.120) (-776.676) (-774.836) [-771.900] * [-774.957] (-771.563) (-775.103) (-774.839) -- 0:00:23
651500 -- (-776.601) [-774.959] (-775.859) (-776.036) * (-774.892) [-773.774] (-776.957) (-780.968) -- 0:00:23
652000 -- (-778.169) [-776.482] (-777.571) (-775.725) * [-774.603] (-773.203) (-774.484) (-775.968) -- 0:00:23
652500 -- (-782.370) (-775.171) (-776.342) [-777.401] * (-774.880) (-775.900) [-776.685] (-775.868) -- 0:00:23
653000 -- (-778.734) [-776.229] (-775.337) (-778.133) * [-772.940] (-778.361) (-781.902) (-779.708) -- 0:00:23
653500 -- (-779.263) (-776.733) [-776.071] (-776.531) * [-775.691] (-776.132) (-781.478) (-776.801) -- 0:00:23
654000 -- (-775.578) (-781.151) [-776.280] (-778.444) * (-775.119) (-778.192) (-777.093) [-774.283] -- 0:00:23
654500 -- (-774.249) (-777.326) (-777.379) [-774.329] * (-774.039) (-777.418) (-779.022) [-773.523] -- 0:00:23
655000 -- (-776.596) (-775.285) (-780.094) [-774.400] * (-778.762) (-776.482) (-776.791) [-774.718] -- 0:00:23
Average standard deviation of split frequencies: 0.006467
655500 -- (-775.388) [-774.450] (-778.060) (-778.806) * (-777.015) [-772.455] (-774.190) (-777.130) -- 0:00:23
656000 -- (-780.074) [-775.423] (-775.396) (-773.165) * (-776.980) (-776.326) [-775.146] (-776.286) -- 0:00:23
656500 -- (-776.449) (-774.549) [-773.308] (-782.144) * (-776.680) [-775.879] (-776.187) (-777.863) -- 0:00:23
657000 -- (-775.343) [-775.018] (-775.609) (-779.219) * (-775.697) (-775.519) [-775.047] (-777.875) -- 0:00:22
657500 -- (-777.431) [-775.631] (-773.345) (-781.197) * (-777.598) [-780.040] (-775.990) (-775.652) -- 0:00:22
658000 -- (-778.660) (-774.593) (-775.971) [-779.213] * (-774.699) (-779.497) (-775.974) [-773.840] -- 0:00:22
658500 -- (-781.066) [-775.563] (-774.258) (-775.101) * (-774.572) (-776.348) [-775.512] (-780.229) -- 0:00:22
659000 -- (-778.300) (-775.970) (-778.254) [-774.372] * (-777.640) (-776.104) (-779.650) [-777.286] -- 0:00:22
659500 -- (-777.577) [-774.966] (-775.124) (-774.821) * (-778.511) (-774.436) (-783.184) [-778.724] -- 0:00:22
660000 -- (-775.454) [-775.622] (-775.573) (-775.332) * (-776.712) (-778.987) [-775.403] (-777.090) -- 0:00:22
Average standard deviation of split frequencies: 0.006121
660500 -- [-777.731] (-776.222) (-776.271) (-774.712) * [-775.239] (-780.102) (-775.656) (-775.134) -- 0:00:22
661000 -- (-780.353) (-780.035) (-776.594) [-777.056] * (-778.833) (-775.609) [-774.839] (-775.751) -- 0:00:22
661500 -- (-776.953) [-778.873] (-777.902) (-775.544) * (-774.473) (-776.937) (-776.963) [-776.912] -- 0:00:22
662000 -- [-775.166] (-777.358) (-777.522) (-778.824) * (-775.290) (-778.184) (-778.081) [-779.421] -- 0:00:22
662500 -- (-774.901) (-775.710) (-775.486) [-777.619] * (-771.972) (-776.181) [-775.662] (-778.526) -- 0:00:22
663000 -- (-777.752) (-776.031) (-776.176) [-775.266] * [-777.006] (-775.474) (-778.434) (-777.183) -- 0:00:22
663500 -- [-776.148] (-778.530) (-775.608) (-774.121) * (-775.972) (-773.244) [-776.546] (-775.242) -- 0:00:22
664000 -- [-783.692] (-775.926) (-774.668) (-773.077) * (-774.210) (-775.819) (-778.131) [-779.169] -- 0:00:22
664500 -- (-778.337) (-775.534) (-776.696) [-775.621] * (-774.731) (-776.916) [-775.151] (-775.436) -- 0:00:22
665000 -- (-778.218) (-777.246) [-776.842] (-774.626) * [-773.800] (-776.037) (-778.291) (-775.947) -- 0:00:22
Average standard deviation of split frequencies: 0.006445
665500 -- (-776.547) (-775.545) [-773.289] (-777.117) * (-775.582) [-774.957] (-774.978) (-777.086) -- 0:00:22
666000 -- (-775.588) (-775.829) (-778.349) [-775.875] * (-776.663) (-773.433) (-773.317) [-775.517] -- 0:00:22
666500 -- (-777.387) [-778.572] (-775.875) (-776.419) * (-774.283) [-774.690] (-778.589) (-775.634) -- 0:00:22
667000 -- (-774.697) [-774.277] (-777.219) (-776.935) * (-776.660) [-775.510] (-777.077) (-775.996) -- 0:00:22
667500 -- [-775.119] (-777.029) (-774.986) (-774.809) * (-775.010) (-772.704) (-775.549) [-776.992] -- 0:00:22
668000 -- (-777.050) (-781.572) (-776.795) [-777.343] * (-774.500) [-774.350] (-777.508) (-777.047) -- 0:00:22
668500 -- (-776.123) [-776.354] (-778.583) (-776.525) * (-773.197) (-775.987) [-779.010] (-778.399) -- 0:00:22
669000 -- (-776.055) [-780.133] (-780.023) (-773.488) * (-773.302) (-773.843) (-778.642) [-776.109] -- 0:00:22
669500 -- (-776.555) [-776.615] (-779.498) (-777.954) * (-775.935) (-777.353) [-775.074] (-774.308) -- 0:00:22
670000 -- [-775.209] (-778.575) (-778.168) (-775.375) * (-778.192) [-777.022] (-777.217) (-776.103) -- 0:00:22
Average standard deviation of split frequencies: 0.006178
670500 -- (-776.037) [-776.651] (-778.864) (-778.265) * [-773.840] (-776.099) (-775.297) (-775.364) -- 0:00:22
671000 -- (-777.352) [-777.263] (-776.838) (-778.155) * (-774.696) (-778.121) (-776.602) [-775.833] -- 0:00:22
671500 -- (-775.502) (-775.480) [-774.596] (-775.936) * (-772.972) [-776.363] (-783.762) (-775.581) -- 0:00:22
672000 -- (-782.490) [-775.059] (-776.830) (-778.100) * (-775.327) [-775.018] (-775.298) (-776.695) -- 0:00:21
672500 -- (-777.695) [-773.559] (-778.270) (-778.576) * (-776.917) (-775.603) [-779.420] (-776.754) -- 0:00:21
673000 -- (-776.030) [-776.431] (-774.664) (-780.250) * (-776.402) [-773.276] (-779.810) (-776.817) -- 0:00:21
673500 -- [-775.464] (-776.003) (-775.960) (-776.165) * (-776.268) [-774.010] (-782.920) (-775.857) -- 0:00:21
674000 -- (-776.078) [-775.012] (-775.279) (-776.636) * (-775.301) [-775.034] (-774.579) (-775.149) -- 0:00:21
674500 -- [-776.076] (-777.221) (-774.535) (-778.810) * (-777.153) (-777.999) [-775.698] (-778.853) -- 0:00:21
675000 -- [-775.557] (-778.095) (-775.421) (-779.556) * [-776.646] (-774.642) (-778.264) (-776.964) -- 0:00:21
Average standard deviation of split frequencies: 0.006276
675500 -- (-777.060) (-775.563) [-775.309] (-778.966) * (-775.465) [-774.445] (-773.987) (-778.261) -- 0:00:21
676000 -- (-775.044) [-776.579] (-774.555) (-778.293) * (-776.426) [-774.747] (-778.860) (-775.376) -- 0:00:21
676500 -- (-778.039) [-775.816] (-775.451) (-779.876) * (-776.418) [-774.729] (-777.477) (-774.837) -- 0:00:21
677000 -- (-776.130) (-776.464) [-773.183] (-776.280) * [-774.803] (-777.506) (-775.472) (-780.243) -- 0:00:21
677500 -- (-775.787) (-777.514) (-776.221) [-776.855] * (-778.753) (-775.587) [-775.555] (-775.351) -- 0:00:21
678000 -- (-775.310) (-775.088) (-774.379) [-776.719] * (-777.963) (-778.072) [-776.275] (-775.601) -- 0:00:21
678500 -- (-776.439) [-777.060] (-774.680) (-781.780) * (-775.207) (-774.260) [-772.848] (-781.279) -- 0:00:21
679000 -- (-776.902) [-774.990] (-775.096) (-775.905) * [-774.786] (-776.021) (-775.287) (-781.703) -- 0:00:21
679500 -- [-779.966] (-775.033) (-772.148) (-775.750) * (-786.173) [-776.933] (-773.924) (-780.568) -- 0:00:21
680000 -- [-778.551] (-776.946) (-779.084) (-777.944) * (-773.683) (-778.118) (-776.097) [-780.023] -- 0:00:21
Average standard deviation of split frequencies: 0.006233
680500 -- [-776.050] (-774.791) (-781.523) (-784.835) * [-776.136] (-779.594) (-775.830) (-779.182) -- 0:00:21
681000 -- (-778.501) (-775.173) [-774.807] (-775.705) * (-779.199) (-778.397) (-778.503) [-776.209] -- 0:00:21
681500 -- (-775.009) (-776.122) [-778.056] (-774.561) * (-778.039) (-778.307) (-777.993) [-776.107] -- 0:00:21
682000 -- (-781.513) (-773.047) [-778.465] (-777.452) * (-775.555) [-779.234] (-780.392) (-774.806) -- 0:00:21
682500 -- (-777.647) (-773.410) [-776.135] (-777.032) * (-780.692) [-776.523] (-775.365) (-775.193) -- 0:00:21
683000 -- (-781.066) [-776.110] (-775.483) (-775.916) * [-775.626] (-778.068) (-776.588) (-775.551) -- 0:00:21
683500 -- [-774.152] (-776.207) (-779.673) (-782.014) * (-778.130) (-777.890) [-777.255] (-777.514) -- 0:00:21
684000 -- (-779.000) (-774.497) [-776.425] (-776.139) * (-775.913) (-774.732) [-775.354] (-776.449) -- 0:00:21
684500 -- (-776.649) (-774.266) (-774.658) [-775.445] * (-774.956) (-774.585) (-773.691) [-775.709] -- 0:00:21
685000 -- (-776.293) (-776.542) [-781.560] (-774.746) * (-776.197) (-776.636) [-776.394] (-775.706) -- 0:00:21
Average standard deviation of split frequencies: 0.005968
685500 -- (-774.438) [-777.163] (-774.514) (-779.280) * (-775.602) (-775.075) (-779.496) [-774.063] -- 0:00:21
686000 -- (-778.620) (-776.767) [-775.501] (-779.069) * (-775.186) [-779.664] (-778.494) (-783.504) -- 0:00:21
686500 -- [-777.533] (-778.640) (-777.315) (-776.373) * (-780.423) (-774.801) [-776.919] (-776.133) -- 0:00:21
687000 -- (-775.418) (-775.715) (-777.621) [-772.637] * (-776.286) [-775.467] (-777.863) (-774.936) -- 0:00:20
687500 -- (-776.816) (-774.357) (-775.189) [-777.664] * [-775.779] (-775.087) (-778.930) (-777.235) -- 0:00:20
688000 -- (-778.777) (-776.811) (-776.761) [-775.769] * (-775.502) (-775.452) (-783.000) [-778.225] -- 0:00:20
688500 -- (-777.312) (-776.045) [-775.673] (-777.367) * (-776.351) (-776.686) [-776.554] (-775.655) -- 0:00:20
689000 -- (-774.688) (-774.738) [-775.056] (-775.470) * (-777.746) (-778.776) [-774.924] (-777.736) -- 0:00:20
689500 -- (-776.273) (-776.710) [-778.858] (-780.173) * [-776.113] (-778.918) (-776.080) (-775.560) -- 0:00:20
690000 -- (-778.791) (-779.001) [-775.526] (-774.733) * [-776.145] (-775.481) (-775.912) (-774.485) -- 0:00:20
Average standard deviation of split frequencies: 0.005532
690500 -- (-775.696) (-775.232) (-776.548) [-775.817] * [-774.862] (-777.698) (-776.319) (-778.888) -- 0:00:20
691000 -- (-777.799) [-776.237] (-775.044) (-775.397) * (-774.320) (-775.943) [-775.005] (-778.983) -- 0:00:20
691500 -- (-777.543) (-774.896) [-775.815] (-775.108) * (-775.094) (-775.183) (-775.617) [-779.702] -- 0:00:20
692000 -- (-773.568) [-774.062] (-774.999) (-774.921) * (-778.773) [-775.901] (-775.388) (-778.001) -- 0:00:20
692500 -- (-774.609) (-776.899) [-776.994] (-774.569) * [-775.712] (-777.749) (-774.201) (-777.837) -- 0:00:20
693000 -- (-776.367) (-777.606) (-777.100) [-776.815] * [-775.104] (-774.621) (-776.326) (-777.698) -- 0:00:20
693500 -- (-777.303) [-774.838] (-775.585) (-775.081) * (-776.511) (-780.817) (-779.978) [-776.428] -- 0:00:20
694000 -- (-776.549) (-777.872) [-776.615] (-775.122) * (-775.833) [-778.901] (-780.317) (-777.001) -- 0:00:20
694500 -- (-776.101) [-776.834] (-779.997) (-773.458) * (-776.535) (-776.624) [-775.356] (-782.489) -- 0:00:20
695000 -- (-777.371) (-776.131) (-775.448) [-773.471] * (-775.683) (-775.817) (-777.701) [-775.229] -- 0:00:20
Average standard deviation of split frequencies: 0.005846
695500 -- (-776.122) (-775.559) [-775.106] (-774.933) * (-776.701) (-776.033) [-775.710] (-775.463) -- 0:00:20
696000 -- [-775.035] (-776.408) (-775.855) (-775.635) * (-776.391) (-774.879) (-776.085) [-773.375] -- 0:00:20
696500 -- (-775.593) (-776.640) (-776.772) [-775.220] * (-777.655) [-777.172] (-775.636) (-777.111) -- 0:00:20
697000 -- (-776.981) [-775.527] (-780.226) (-777.402) * (-776.621) (-777.304) (-775.511) [-775.617] -- 0:00:20
697500 -- (-777.620) (-776.989) [-774.321] (-778.500) * [-775.997] (-777.271) (-778.029) (-774.782) -- 0:00:20
698000 -- (-778.175) (-778.164) [-775.319] (-776.186) * [-773.927] (-777.510) (-782.622) (-777.028) -- 0:00:20
698500 -- (-775.861) (-774.829) [-775.099] (-776.953) * (-775.096) (-775.036) (-778.179) [-777.762] -- 0:00:20
699000 -- (-774.819) (-775.858) [-775.685] (-778.759) * [-775.664] (-779.018) (-778.874) (-775.222) -- 0:00:20
699500 -- (-776.897) [-776.206] (-774.847) (-778.760) * [-774.432] (-779.884) (-777.691) (-774.633) -- 0:00:20
700000 -- (-774.673) [-774.330] (-780.330) (-774.811) * [-774.359] (-778.386) (-782.004) (-775.626) -- 0:00:20
Average standard deviation of split frequencies: 0.006232
700500 -- (-775.027) (-778.653) (-779.724) [-776.834] * [-775.990] (-778.171) (-774.774) (-776.995) -- 0:00:20
701000 -- (-775.220) [-776.076] (-781.006) (-777.893) * (-774.602) [-773.609] (-774.569) (-779.196) -- 0:00:20
701500 -- (-775.844) (-773.098) [-776.035] (-777.986) * (-775.530) [-773.844] (-776.306) (-781.258) -- 0:00:19
702000 -- (-778.453) [-775.638] (-777.900) (-776.668) * (-775.766) [-776.052] (-774.996) (-778.986) -- 0:00:19
702500 -- (-778.957) [-776.505] (-776.488) (-777.461) * (-776.379) [-773.736] (-775.101) (-777.235) -- 0:00:19
703000 -- (-776.409) [-776.182] (-776.091) (-780.642) * (-777.247) [-776.022] (-775.088) (-777.906) -- 0:00:19
703500 -- (-776.481) [-778.641] (-776.213) (-772.941) * (-775.266) [-777.535] (-776.263) (-776.722) -- 0:00:19
704000 -- [-775.993] (-774.411) (-776.225) (-776.738) * (-777.874) (-779.639) (-776.892) [-777.156] -- 0:00:19
704500 -- [-775.652] (-776.456) (-777.129) (-776.255) * [-781.414] (-777.646) (-774.873) (-781.035) -- 0:00:19
705000 -- (-778.678) [-773.677] (-779.678) (-775.672) * (-782.349) (-776.839) (-776.844) [-776.435] -- 0:00:19
Average standard deviation of split frequencies: 0.006150
705500 -- (-776.706) [-774.504] (-779.367) (-776.478) * (-781.237) [-775.697] (-774.927) (-776.270) -- 0:00:19
706000 -- (-773.577) (-775.133) (-782.700) [-773.122] * [-778.394] (-781.297) (-775.947) (-776.284) -- 0:00:19
706500 -- [-780.554] (-777.443) (-779.314) (-776.041) * (-777.435) (-775.899) (-773.753) [-775.112] -- 0:00:19
707000 -- (-774.773) (-778.037) (-772.445) [-778.957] * (-774.496) (-777.393) (-783.573) [-777.556] -- 0:00:19
707500 -- (-775.755) [-773.493] (-776.574) (-775.976) * (-776.641) [-775.742] (-776.533) (-777.985) -- 0:00:19
708000 -- (-779.099) (-776.224) (-775.387) [-773.670] * (-780.467) (-775.385) (-776.344) [-776.654] -- 0:00:19
708500 -- (-774.203) [-775.073] (-776.123) (-780.049) * (-774.670) (-775.157) [-779.211] (-778.225) -- 0:00:19
709000 -- [-774.925] (-775.210) (-776.288) (-784.435) * (-776.447) (-776.450) [-776.654] (-779.884) -- 0:00:19
709500 -- (-777.276) (-776.389) (-774.915) [-775.037] * (-776.321) [-776.670] (-775.911) (-777.928) -- 0:00:19
710000 -- (-780.150) (-776.060) (-774.860) [-778.155] * (-774.967) (-776.167) (-777.218) [-774.775] -- 0:00:19
Average standard deviation of split frequencies: 0.006354
710500 -- (-774.340) (-775.722) (-776.055) [-774.572] * (-777.195) (-775.168) [-776.161] (-776.258) -- 0:00:19
711000 -- (-779.217) [-775.297] (-774.589) (-774.747) * [-775.325] (-776.980) (-776.424) (-780.057) -- 0:00:19
711500 -- (-778.385) (-774.416) (-775.235) [-777.630] * (-776.390) [-774.391] (-777.197) (-778.938) -- 0:00:19
712000 -- (-776.498) (-775.886) [-773.122] (-778.877) * (-775.835) (-776.857) (-778.612) [-774.789] -- 0:00:19
712500 -- (-775.937) (-775.926) [-774.043] (-777.137) * (-777.237) (-774.970) [-776.093] (-779.699) -- 0:00:19
713000 -- [-774.757] (-775.476) (-779.941) (-776.002) * (-776.948) (-775.695) (-777.897) [-774.982] -- 0:00:19
713500 -- (-774.775) (-774.875) [-777.439] (-774.750) * [-776.091] (-775.116) (-778.968) (-777.811) -- 0:00:19
714000 -- (-775.169) (-775.255) (-777.979) [-777.251] * (-779.070) (-777.615) (-782.543) [-775.047] -- 0:00:19
714500 -- (-774.654) [-776.422] (-777.024) (-777.007) * (-778.927) (-777.866) (-777.805) [-776.647] -- 0:00:19
715000 -- (-775.517) [-774.036] (-776.344) (-779.008) * [-776.047] (-779.331) (-777.819) (-776.657) -- 0:00:19
Average standard deviation of split frequencies: 0.006549
715500 -- (-775.301) (-777.891) (-778.703) [-775.541] * (-775.787) [-775.155] (-777.861) (-779.350) -- 0:00:19
716000 -- (-777.923) [-774.507] (-777.204) (-777.730) * (-777.559) (-775.776) (-777.909) [-776.076] -- 0:00:19
716500 -- (-779.494) [-779.566] (-774.935) (-778.655) * (-776.427) [-777.084] (-779.485) (-775.383) -- 0:00:18
717000 -- (-779.929) (-777.978) [-772.308] (-777.939) * [-775.386] (-775.451) (-777.517) (-774.988) -- 0:00:18
717500 -- (-776.800) (-776.212) [-775.010] (-775.539) * (-777.752) (-776.184) (-775.518) [-775.761] -- 0:00:18
718000 -- (-773.080) (-772.200) (-776.993) [-772.155] * (-779.772) (-773.104) (-774.603) [-779.856] -- 0:00:18
718500 -- (-778.454) [-774.753] (-773.918) (-776.149) * [-773.945] (-776.577) (-777.150) (-778.386) -- 0:00:18
719000 -- (-776.695) (-774.295) [-774.789] (-778.222) * (-776.304) [-776.435] (-775.533) (-775.970) -- 0:00:18
719500 -- (-776.355) (-774.577) (-775.745) [-774.749] * (-776.371) (-774.999) (-775.427) [-774.216] -- 0:00:18
720000 -- (-780.788) (-777.858) (-774.853) [-776.662] * (-776.163) (-775.162) (-778.454) [-777.442] -- 0:00:18
Average standard deviation of split frequencies: 0.006610
720500 -- [-776.389] (-777.439) (-774.623) (-779.214) * [-776.652] (-777.059) (-775.677) (-772.932) -- 0:00:18
721000 -- (-777.052) (-778.267) (-776.977) [-774.931] * (-777.541) (-778.119) (-777.448) [-772.885] -- 0:00:18
721500 -- (-774.078) (-776.637) [-775.981] (-778.946) * (-777.050) (-774.060) (-776.892) [-772.584] -- 0:00:18
722000 -- (-775.604) [-778.178] (-775.021) (-775.144) * (-775.287) (-777.098) (-775.496) [-776.205] -- 0:00:18
722500 -- (-774.636) [-774.788] (-777.774) (-775.940) * [-777.761] (-775.967) (-775.876) (-778.176) -- 0:00:18
723000 -- (-775.895) [-774.686] (-781.554) (-779.570) * [-779.550] (-775.200) (-780.674) (-781.857) -- 0:00:18
723500 -- [-778.266] (-776.355) (-774.019) (-780.213) * (-784.103) (-775.236) [-779.113] (-776.853) -- 0:00:18
724000 -- (-776.930) (-776.334) [-772.896] (-776.327) * [-775.936] (-775.789) (-781.187) (-776.460) -- 0:00:18
724500 -- (-777.343) (-784.111) (-776.157) [-777.699] * (-777.470) [-775.049] (-775.318) (-778.429) -- 0:00:18
725000 -- (-775.291) (-775.715) (-779.246) [-776.333] * [-777.314] (-775.315) (-778.091) (-777.428) -- 0:00:18
Average standard deviation of split frequencies: 0.006767
725500 -- [-776.908] (-776.012) (-773.445) (-777.326) * (-779.633) (-779.652) (-779.073) [-777.135] -- 0:00:18
726000 -- (-777.723) (-776.474) [-777.056] (-777.095) * (-774.959) [-779.701] (-776.064) (-777.394) -- 0:00:18
726500 -- (-775.102) (-776.017) [-772.650] (-776.316) * [-775.809] (-777.519) (-778.694) (-776.243) -- 0:00:18
727000 -- (-773.382) (-778.742) [-775.338] (-776.730) * (-781.630) (-776.801) [-778.790] (-776.072) -- 0:00:18
727500 -- (-775.644) (-775.575) (-774.697) [-775.086] * (-779.835) (-775.566) [-776.370] (-775.584) -- 0:00:18
728000 -- (-778.825) (-775.830) [-775.187] (-775.658) * [-777.986] (-775.478) (-783.980) (-777.513) -- 0:00:18
728500 -- (-780.748) (-776.617) (-776.727) [-778.713] * (-775.429) (-775.959) (-776.928) [-776.663] -- 0:00:18
729000 -- [-776.584] (-776.120) (-777.202) (-775.088) * (-775.777) (-776.496) (-776.775) [-778.481] -- 0:00:18
729500 -- (-777.170) [-774.823] (-773.703) (-776.916) * (-775.184) [-777.032] (-777.887) (-776.625) -- 0:00:18
730000 -- [-777.321] (-777.090) (-778.887) (-776.842) * [-776.585] (-774.960) (-775.870) (-780.906) -- 0:00:18
Average standard deviation of split frequencies: 0.007029
730500 -- (-781.564) [-775.263] (-777.913) (-774.540) * (-776.682) (-776.333) (-779.243) [-774.847] -- 0:00:18
731000 -- [-777.336] (-777.094) (-776.058) (-776.715) * [-776.589] (-775.057) (-779.309) (-775.449) -- 0:00:18
731500 -- (-781.270) (-775.952) (-772.686) [-772.738] * (-780.052) [-775.399] (-778.279) (-780.905) -- 0:00:17
732000 -- (-775.307) (-777.759) [-777.155] (-775.239) * (-777.336) (-774.907) (-773.944) [-779.863] -- 0:00:17
732500 -- (-776.475) [-777.842] (-780.185) (-774.960) * (-777.153) (-774.494) (-775.166) [-777.552] -- 0:00:17
733000 -- (-778.619) (-776.139) [-773.857] (-775.919) * [-779.168] (-777.924) (-775.220) (-775.628) -- 0:00:18
733500 -- (-776.756) (-777.569) [-774.568] (-779.878) * (-777.406) (-779.947) [-776.306] (-777.649) -- 0:00:18
734000 -- (-777.692) (-776.442) [-775.303] (-777.801) * (-775.465) (-774.878) [-775.927] (-776.236) -- 0:00:18
734500 -- [-775.147] (-775.746) (-777.413) (-781.003) * (-777.802) (-775.199) [-777.663] (-778.049) -- 0:00:18
735000 -- (-776.952) (-775.158) (-775.589) [-779.653] * (-778.654) (-774.948) (-777.609) [-773.965] -- 0:00:18
Average standard deviation of split frequencies: 0.007079
735500 -- (-779.746) (-775.803) [-776.301] (-774.492) * (-776.715) (-775.070) [-777.113] (-774.852) -- 0:00:17
736000 -- (-775.857) (-774.964) [-775.368] (-774.962) * [-779.399] (-776.399) (-777.139) (-772.398) -- 0:00:17
736500 -- (-775.093) (-775.688) (-775.458) [-776.711] * (-776.228) [-774.892] (-778.422) (-775.327) -- 0:00:17
737000 -- (-779.261) [-779.355] (-774.161) (-777.223) * [-777.625] (-777.792) (-779.136) (-774.561) -- 0:00:17
737500 -- (-776.017) (-777.571) [-777.264] (-777.163) * (-780.861) (-775.435) [-774.393] (-779.419) -- 0:00:17
738000 -- (-775.096) [-781.381] (-775.175) (-778.468) * (-778.598) (-776.611) (-775.481) [-776.123] -- 0:00:17
738500 -- (-776.206) (-775.586) (-776.885) [-775.772] * (-775.590) (-776.566) [-775.904] (-775.846) -- 0:00:17
739000 -- (-776.180) [-775.118] (-776.196) (-775.241) * (-778.539) (-779.313) (-775.276) [-779.938] -- 0:00:17
739500 -- (-773.646) (-776.851) (-778.536) [-775.208] * (-780.219) (-778.930) (-775.601) [-775.415] -- 0:00:17
740000 -- (-775.353) [-775.047] (-779.245) (-774.949) * (-775.452) (-783.111) (-775.322) [-775.080] -- 0:00:17
Average standard deviation of split frequencies: 0.006834
740500 -- (-775.981) (-776.953) (-774.994) [-776.917] * (-775.418) [-776.884] (-775.975) (-778.468) -- 0:00:17
741000 -- [-775.557] (-775.058) (-776.519) (-776.195) * (-778.870) [-779.263] (-776.228) (-777.559) -- 0:00:17
741500 -- (-774.471) (-774.212) (-777.612) [-774.431] * (-782.710) (-779.900) [-775.208] (-782.402) -- 0:00:17
742000 -- (-780.852) (-776.928) (-776.506) [-774.730] * (-778.811) (-776.843) [-775.231] (-776.947) -- 0:00:17
742500 -- (-774.800) [-774.969] (-777.501) (-770.961) * [-776.749] (-777.092) (-778.936) (-775.170) -- 0:00:17
743000 -- [-773.360] (-776.996) (-775.810) (-773.645) * (-777.263) (-776.701) [-775.876] (-775.882) -- 0:00:17
743500 -- (-777.220) (-774.404) (-780.285) [-777.676] * [-775.364] (-775.611) (-775.502) (-776.801) -- 0:00:17
744000 -- (-775.159) [-776.261] (-776.703) (-779.863) * (-775.226) (-777.053) [-775.431] (-776.318) -- 0:00:17
744500 -- (-775.913) (-777.720) [-775.063] (-775.783) * (-776.491) (-775.181) [-776.521] (-775.032) -- 0:00:17
745000 -- (-776.940) (-775.099) [-775.102] (-776.686) * (-774.313) (-777.373) (-777.662) [-775.480] -- 0:00:17
Average standard deviation of split frequencies: 0.006652
745500 -- [-776.248] (-776.656) (-781.880) (-774.215) * [-774.917] (-777.415) (-774.433) (-779.741) -- 0:00:17
746000 -- (-774.868) [-774.944] (-777.303) (-774.676) * [-776.380] (-778.622) (-779.611) (-779.350) -- 0:00:17
746500 -- [-775.794] (-778.358) (-778.711) (-777.398) * (-778.866) (-777.531) [-778.321] (-775.253) -- 0:00:16
747000 -- (-773.397) [-775.034] (-774.810) (-777.618) * (-776.016) [-775.698] (-776.511) (-774.637) -- 0:00:16
747500 -- (-773.902) (-773.660) (-777.817) [-778.901] * (-776.819) (-776.307) [-773.477] (-775.467) -- 0:00:16
748000 -- [-774.645] (-775.678) (-776.462) (-777.046) * (-775.106) (-775.364) [-775.571] (-776.493) -- 0:00:16
748500 -- (-772.986) [-777.569] (-779.267) (-775.454) * (-779.253) (-777.365) (-775.808) [-777.535] -- 0:00:17
749000 -- [-777.163] (-778.701) (-779.644) (-776.407) * (-776.587) (-776.877) (-775.313) [-777.990] -- 0:00:17
749500 -- (-775.668) (-776.287) [-774.905] (-777.878) * (-778.482) (-776.491) (-776.899) [-776.824] -- 0:00:17
750000 -- (-779.106) (-776.326) (-775.233) [-777.774] * (-780.782) [-778.323] (-775.423) (-777.008) -- 0:00:17
Average standard deviation of split frequencies: 0.006478
750500 -- (-777.698) (-780.093) [-777.649] (-775.887) * [-779.770] (-775.609) (-777.229) (-779.024) -- 0:00:16
751000 -- [-776.797] (-777.594) (-775.432) (-774.114) * (-775.586) (-775.394) [-774.145] (-775.849) -- 0:00:16
751500 -- (-778.636) [-777.426] (-774.659) (-775.813) * (-774.482) (-776.594) (-777.470) [-776.332] -- 0:00:16
752000 -- [-777.220] (-775.500) (-776.480) (-774.786) * (-780.110) [-775.292] (-776.531) (-777.061) -- 0:00:16
752500 -- (-774.128) (-775.758) (-775.986) [-773.846] * [-774.607] (-775.495) (-774.382) (-775.706) -- 0:00:16
753000 -- (-778.258) (-776.627) [-776.330] (-774.948) * (-776.328) (-775.639) (-776.192) [-778.717] -- 0:00:16
753500 -- [-774.767] (-773.102) (-777.988) (-775.469) * [-775.589] (-775.482) (-771.902) (-778.542) -- 0:00:16
754000 -- [-782.486] (-779.982) (-776.687) (-775.674) * (-774.199) (-777.008) (-776.117) [-776.154] -- 0:00:16
754500 -- (-776.589) (-775.907) (-775.724) [-776.389] * (-775.391) [-778.721] (-776.196) (-777.944) -- 0:00:16
755000 -- (-776.922) [-776.078] (-775.583) (-775.697) * (-775.404) (-785.632) [-775.170] (-782.170) -- 0:00:16
Average standard deviation of split frequencies: 0.006498
755500 -- [-775.106] (-777.264) (-776.532) (-781.358) * (-777.996) (-778.143) [-775.368] (-780.915) -- 0:00:16
756000 -- (-775.452) (-778.884) (-774.700) [-775.678] * (-776.625) (-780.004) [-777.108] (-775.280) -- 0:00:16
756500 -- (-775.554) [-775.504] (-774.731) (-776.561) * [-776.382] (-781.811) (-776.855) (-775.452) -- 0:00:16
757000 -- (-779.978) [-776.861] (-777.376) (-775.636) * (-774.714) [-776.148] (-777.105) (-779.789) -- 0:00:16
757500 -- (-776.619) [-775.319] (-775.689) (-778.225) * (-775.238) (-778.341) (-778.269) [-778.191] -- 0:00:16
758000 -- [-777.747] (-774.152) (-782.087) (-776.319) * (-774.965) [-777.473] (-775.352) (-776.618) -- 0:00:16
758500 -- (-772.991) [-775.916] (-777.438) (-776.299) * (-776.520) (-775.834) (-774.502) [-777.923] -- 0:00:16
759000 -- [-774.003] (-775.718) (-775.753) (-780.692) * (-775.120) (-777.899) (-778.852) [-775.119] -- 0:00:16
759500 -- (-777.162) (-775.298) (-774.690) [-775.655] * (-779.062) (-775.430) (-775.724) [-772.725] -- 0:00:16
760000 -- (-779.599) (-774.675) [-774.369] (-775.030) * (-775.392) (-775.151) [-776.263] (-774.697) -- 0:00:16
Average standard deviation of split frequencies: 0.006458
760500 -- (-775.255) (-773.019) (-775.192) [-775.452] * (-778.806) (-775.763) (-774.028) [-773.386] -- 0:00:16
761000 -- [-775.207] (-775.793) (-779.106) (-776.441) * (-776.600) (-775.913) (-774.635) [-775.096] -- 0:00:16
761500 -- (-777.141) [-774.895] (-785.187) (-775.684) * (-772.433) (-775.051) (-777.457) [-772.912] -- 0:00:15
762000 -- (-776.194) (-777.531) (-777.759) [-780.484] * [-775.961] (-776.376) (-774.841) (-775.888) -- 0:00:15
762500 -- (-776.700) (-777.215) [-780.003] (-776.776) * (-772.754) [-776.195] (-774.255) (-777.411) -- 0:00:15
763000 -- [-776.313] (-775.176) (-776.044) (-776.052) * (-775.866) [-774.130] (-775.817) (-778.897) -- 0:00:15
763500 -- [-776.652] (-773.206) (-779.648) (-778.135) * [-776.948] (-773.568) (-775.025) (-777.071) -- 0:00:15
764000 -- [-777.161] (-776.007) (-778.076) (-778.267) * [-775.283] (-775.546) (-775.158) (-775.695) -- 0:00:16
764500 -- (-776.672) (-777.758) [-776.347] (-779.835) * (-776.813) [-773.943] (-775.040) (-777.372) -- 0:00:16
765000 -- (-772.855) (-774.051) (-774.507) [-776.223] * (-776.202) (-776.637) (-775.704) [-777.086] -- 0:00:15
Average standard deviation of split frequencies: 0.006122
765500 -- [-774.618] (-777.071) (-777.877) (-775.623) * [-775.455] (-775.914) (-773.791) (-776.649) -- 0:00:15
766000 -- [-773.150] (-777.939) (-780.107) (-775.782) * [-776.552] (-774.666) (-776.550) (-777.340) -- 0:00:15
766500 -- (-774.027) (-774.813) [-775.587] (-779.655) * (-775.218) (-775.946) (-775.336) [-776.223] -- 0:00:15
767000 -- (-774.258) (-775.531) [-775.779] (-776.157) * [-774.978] (-778.171) (-774.190) (-779.383) -- 0:00:15
767500 -- (-776.663) (-775.704) (-777.110) [-776.107] * (-779.083) (-775.111) [-775.930] (-775.580) -- 0:00:15
768000 -- (-774.290) (-774.962) (-776.986) [-777.478] * (-779.116) (-777.848) [-776.330] (-775.632) -- 0:00:15
768500 -- (-774.472) [-776.923] (-774.826) (-776.457) * (-775.310) (-776.616) (-775.428) [-774.960] -- 0:00:15
769000 -- (-777.865) (-775.443) (-774.997) [-778.300] * [-775.033] (-777.364) (-772.882) (-776.534) -- 0:00:15
769500 -- (-772.483) [-775.503] (-779.717) (-778.971) * (-774.784) (-775.477) [-775.604] (-774.511) -- 0:00:15
770000 -- [-775.033] (-777.124) (-776.221) (-778.437) * (-778.513) (-775.451) (-775.364) [-778.725] -- 0:00:15
Average standard deviation of split frequencies: 0.005891
770500 -- [-777.471] (-776.081) (-776.720) (-774.313) * [-776.219] (-774.281) (-776.340) (-775.240) -- 0:00:15
771000 -- (-778.487) (-775.303) [-773.987] (-774.157) * (-775.975) (-775.305) [-775.215] (-777.550) -- 0:00:15
771500 -- (-777.973) (-776.601) (-776.161) [-774.684] * (-773.655) (-779.476) (-773.838) [-776.265] -- 0:00:15
772000 -- (-774.613) (-773.792) (-775.241) [-774.748] * [-774.423] (-776.816) (-777.210) (-775.591) -- 0:00:15
772500 -- (-775.301) (-776.023) [-778.184] (-776.650) * (-775.199) (-776.811) [-774.915] (-772.773) -- 0:00:15
773000 -- [-778.370] (-776.917) (-775.528) (-776.018) * (-775.374) (-779.157) [-776.021] (-775.003) -- 0:00:15
773500 -- (-776.593) (-782.158) [-774.844] (-775.075) * (-775.347) (-775.841) (-777.978) [-775.399] -- 0:00:15
774000 -- (-775.052) (-776.575) [-777.026] (-772.842) * (-774.790) (-776.810) [-776.658] (-778.641) -- 0:00:15
774500 -- [-774.813] (-776.324) (-779.221) (-777.406) * [-777.721] (-773.444) (-775.696) (-779.270) -- 0:00:15
775000 -- (-777.064) [-775.681] (-776.569) (-777.448) * [-772.818] (-775.071) (-775.673) (-781.194) -- 0:00:15
Average standard deviation of split frequencies: 0.005563
775500 -- (-773.276) (-777.505) [-775.362] (-773.498) * [-775.118] (-773.238) (-779.170) (-775.360) -- 0:00:15
776000 -- (-776.711) [-776.006] (-775.357) (-776.424) * (-775.517) [-778.021] (-775.407) (-776.851) -- 0:00:15
776500 -- (-777.211) [-778.139] (-774.790) (-777.892) * (-776.326) [-775.050] (-774.572) (-775.454) -- 0:00:14
777000 -- (-774.906) (-777.877) (-776.093) [-775.381] * (-779.165) (-779.371) (-773.028) [-774.433] -- 0:00:14
777500 -- (-772.130) [-776.600] (-775.573) (-775.712) * (-778.842) (-774.887) (-772.735) [-774.589] -- 0:00:14
778000 -- (-775.793) (-776.528) (-776.671) [-775.430] * (-782.719) (-777.935) [-777.934] (-779.125) -- 0:00:14
778500 -- (-775.863) [-775.418] (-775.567) (-781.388) * (-779.429) (-778.284) [-776.215] (-777.673) -- 0:00:14
779000 -- (-775.688) (-774.184) (-776.343) [-775.059] * (-782.006) (-773.396) (-774.385) [-776.268] -- 0:00:14
779500 -- (-777.176) (-780.155) [-777.494] (-773.448) * [-775.027] (-776.008) (-776.306) (-777.393) -- 0:00:14
780000 -- [-776.165] (-776.124) (-777.466) (-778.025) * [-775.205] (-775.420) (-777.173) (-778.669) -- 0:00:14
Average standard deviation of split frequencies: 0.005053
780500 -- (-777.398) [-772.565] (-779.418) (-777.974) * (-776.195) (-775.708) [-773.530] (-779.592) -- 0:00:14
781000 -- (-776.437) (-778.128) (-775.231) [-777.618] * (-774.194) (-776.009) [-774.110] (-776.111) -- 0:00:14
781500 -- (-773.647) [-778.293] (-776.911) (-779.200) * (-774.389) (-775.801) (-773.877) [-775.624] -- 0:00:14
782000 -- (-774.932) (-780.425) [-779.755] (-779.373) * (-774.585) [-772.727] (-775.873) (-776.342) -- 0:00:14
782500 -- [-775.576] (-777.590) (-777.075) (-780.849) * [-777.968] (-774.710) (-775.045) (-775.209) -- 0:00:14
783000 -- [-773.921] (-777.891) (-776.112) (-775.593) * (-779.042) [-776.460] (-777.454) (-775.272) -- 0:00:14
783500 -- (-776.061) [-775.102] (-778.871) (-775.196) * (-781.311) [-777.574] (-776.917) (-776.031) -- 0:00:14
784000 -- (-773.770) [-776.846] (-777.735) (-776.878) * [-775.539] (-775.846) (-775.361) (-776.445) -- 0:00:14
784500 -- (-774.926) (-776.658) (-777.938) [-775.803] * (-774.145) (-774.068) (-775.746) [-776.292] -- 0:00:14
785000 -- (-775.951) [-777.603] (-778.252) (-777.507) * (-774.958) [-775.031] (-776.654) (-776.199) -- 0:00:14
Average standard deviation of split frequencies: 0.005051
785500 -- (-773.954) (-776.525) [-773.971] (-776.191) * (-777.946) [-777.456] (-776.077) (-777.075) -- 0:00:14
786000 -- [-773.779] (-776.432) (-775.303) (-778.912) * [-775.265] (-777.484) (-776.344) (-777.037) -- 0:00:14
786500 -- (-776.232) [-774.620] (-775.529) (-777.450) * [-775.970] (-775.076) (-778.072) (-780.986) -- 0:00:14
787000 -- (-775.646) (-775.490) (-774.970) [-778.378] * (-776.417) (-774.203) (-773.534) [-778.505] -- 0:00:14
787500 -- (-775.355) [-776.786] (-775.021) (-777.992) * (-777.548) (-775.357) (-777.746) [-774.427] -- 0:00:14
788000 -- (-776.938) (-777.685) [-774.011] (-778.731) * (-774.069) [-774.721] (-776.964) (-777.206) -- 0:00:14
788500 -- [-776.241] (-774.941) (-775.705) (-775.888) * (-775.155) (-773.941) [-774.429] (-775.647) -- 0:00:14
789000 -- (-774.655) [-772.109] (-775.508) (-775.095) * (-775.947) (-776.119) (-777.562) [-776.911] -- 0:00:14
789500 -- (-775.354) [-776.401] (-773.224) (-775.649) * [-775.993] (-775.704) (-776.811) (-777.686) -- 0:00:14
790000 -- (-776.287) (-777.252) [-773.706] (-775.122) * [-774.794] (-779.522) (-775.389) (-775.579) -- 0:00:14
Average standard deviation of split frequencies: 0.005272
790500 -- (-776.516) (-775.269) [-773.600] (-776.749) * (-776.680) (-778.502) (-774.936) [-775.342] -- 0:00:14
791000 -- (-775.202) (-774.981) [-773.656] (-775.314) * (-773.514) [-776.842] (-772.514) (-775.541) -- 0:00:14
791500 -- (-773.100) (-776.716) (-774.592) [-777.321] * (-777.468) [-772.433] (-774.452) (-775.108) -- 0:00:13
792000 -- (-776.235) (-776.654) [-774.050] (-782.779) * (-783.088) [-772.289] (-774.972) (-775.183) -- 0:00:13
792500 -- [-774.263] (-777.961) (-774.186) (-779.532) * (-777.682) (-774.418) (-775.913) [-776.695] -- 0:00:13
793000 -- (-776.238) (-776.335) (-775.550) [-772.585] * (-775.304) (-775.610) [-776.717] (-778.947) -- 0:00:13
793500 -- (-775.672) (-776.886) (-777.222) [-778.692] * (-776.031) (-778.472) (-776.058) [-776.814] -- 0:00:13
794000 -- (-775.323) (-776.395) [-774.457] (-776.092) * [-775.661] (-775.883) (-776.458) (-774.726) -- 0:00:13
794500 -- (-777.427) (-775.780) [-776.769] (-777.238) * [-775.925] (-773.987) (-774.083) (-775.573) -- 0:00:13
795000 -- (-777.154) (-775.200) [-773.823] (-775.332) * (-776.098) [-775.976] (-775.464) (-778.433) -- 0:00:13
Average standard deviation of split frequencies: 0.005205
795500 -- (-773.751) (-776.762) [-775.534] (-774.077) * (-776.907) [-775.983] (-777.214) (-779.376) -- 0:00:13
796000 -- [-774.792] (-775.530) (-781.107) (-774.368) * [-774.902] (-776.300) (-775.213) (-777.862) -- 0:00:13
796500 -- (-781.228) (-775.371) (-783.684) [-773.279] * (-776.221) [-779.233] (-776.757) (-776.474) -- 0:00:13
797000 -- (-779.503) [-773.655] (-775.604) (-776.385) * (-777.646) (-778.192) (-775.574) [-774.958] -- 0:00:13
797500 -- [-775.467] (-777.214) (-775.734) (-774.660) * (-777.210) (-774.253) (-776.832) [-775.132] -- 0:00:13
798000 -- [-774.507] (-776.083) (-776.827) (-777.229) * (-778.024) (-773.919) (-776.058) [-775.691] -- 0:00:13
798500 -- (-779.635) (-775.193) (-780.369) [-775.944] * (-779.655) (-774.577) (-774.927) [-774.932] -- 0:00:13
799000 -- (-778.302) [-774.831] (-775.635) (-774.451) * (-777.927) (-775.300) (-779.751) [-774.589] -- 0:00:13
799500 -- (-777.621) (-775.120) [-775.231] (-775.489) * (-776.022) [-774.041] (-777.782) (-777.588) -- 0:00:13
800000 -- (-778.169) (-775.134) (-775.674) [-774.005] * (-777.231) [-775.525] (-779.266) (-778.081) -- 0:00:13
Average standard deviation of split frequencies: 0.004741
800500 -- (-779.365) [-775.249] (-780.535) (-776.480) * (-784.361) [-773.926] (-777.485) (-781.270) -- 0:00:13
801000 -- (-773.951) (-775.719) [-781.204] (-775.137) * (-782.340) [-773.859] (-775.465) (-775.839) -- 0:00:13
801500 -- [-775.965] (-776.061) (-775.498) (-776.524) * (-774.760) [-772.824] (-775.995) (-773.767) -- 0:00:13
802000 -- (-775.734) [-775.209] (-776.791) (-774.917) * (-776.622) (-776.368) [-774.962] (-774.513) -- 0:00:13
802500 -- (-777.329) [-773.046] (-777.645) (-773.016) * [-776.270] (-779.673) (-775.395) (-776.264) -- 0:00:13
803000 -- (-776.153) (-775.524) (-776.849) [-774.829] * (-775.980) (-779.552) [-778.075] (-774.396) -- 0:00:13
803500 -- (-776.457) (-776.265) [-774.673] (-776.738) * (-776.879) (-774.857) (-776.663) [-775.275] -- 0:00:13
804000 -- (-773.777) (-780.181) [-775.756] (-775.739) * (-778.309) (-775.829) (-774.675) [-773.819] -- 0:00:13
804500 -- (-778.847) (-776.288) [-780.667] (-775.017) * [-776.602] (-776.644) (-776.651) (-775.963) -- 0:00:13
805000 -- [-774.897] (-778.309) (-773.618) (-774.282) * (-776.288) (-780.786) (-779.022) [-775.380] -- 0:00:13
Average standard deviation of split frequencies: 0.004833
805500 -- (-773.159) [-777.327] (-776.959) (-775.730) * (-776.001) (-773.628) [-772.840] (-776.249) -- 0:00:13
806000 -- [-776.658] (-777.993) (-776.866) (-778.110) * (-777.217) (-775.758) [-773.920] (-777.939) -- 0:00:12
806500 -- [-775.788] (-775.391) (-775.919) (-777.465) * (-778.730) (-776.408) (-778.584) [-779.030] -- 0:00:12
807000 -- [-776.902] (-779.457) (-775.087) (-779.624) * (-777.749) (-775.443) [-778.257] (-776.267) -- 0:00:12
807500 -- [-777.051] (-775.036) (-775.535) (-774.843) * (-778.386) [-775.171] (-776.695) (-776.474) -- 0:00:12
808000 -- (-784.127) (-777.141) [-773.761] (-774.012) * (-777.099) [-774.751] (-772.684) (-775.727) -- 0:00:12
808500 -- (-776.520) (-779.890) [-773.079] (-775.108) * (-773.222) (-775.438) [-774.787] (-775.370) -- 0:00:12
809000 -- (-777.183) (-777.852) [-774.505] (-781.111) * (-778.901) [-774.106] (-773.371) (-776.402) -- 0:00:12
809500 -- (-776.718) [-776.169] (-779.209) (-778.609) * (-780.119) (-775.016) (-776.035) [-779.129] -- 0:00:12
810000 -- (-778.659) (-776.544) [-774.805] (-773.649) * [-776.808] (-776.821) (-773.949) (-781.931) -- 0:00:12
Average standard deviation of split frequencies: 0.004377
810500 -- (-779.668) [-775.902] (-781.395) (-775.706) * (-783.329) (-780.409) [-774.697] (-781.018) -- 0:00:12
811000 -- (-774.980) [-777.239] (-774.791) (-778.757) * [-778.824] (-777.022) (-774.772) (-775.223) -- 0:00:12
811500 -- (-776.097) [-775.637] (-774.881) (-776.099) * (-779.865) (-777.762) [-777.988] (-779.000) -- 0:00:12
812000 -- (-775.835) (-777.210) [-773.435] (-778.445) * (-776.579) (-778.666) [-775.371] (-779.043) -- 0:00:12
812500 -- [-779.999] (-774.715) (-776.209) (-774.622) * (-775.776) [-775.892] (-775.155) (-779.527) -- 0:00:12
813000 -- (-776.341) (-776.151) (-775.232) [-775.866] * [-776.343] (-776.976) (-776.722) (-781.965) -- 0:00:12
813500 -- (-776.178) [-778.451] (-775.468) (-777.877) * (-776.507) [-777.963] (-771.982) (-777.003) -- 0:00:12
814000 -- (-775.815) (-776.373) [-775.560] (-775.954) * (-778.620) (-780.849) [-774.688] (-776.169) -- 0:00:12
814500 -- (-774.457) (-776.672) [-777.440] (-778.125) * (-776.932) [-777.003] (-779.068) (-774.908) -- 0:00:12
815000 -- (-774.792) [-778.184] (-776.366) (-776.074) * (-774.978) (-777.384) (-779.828) [-776.847] -- 0:00:12
Average standard deviation of split frequencies: 0.004348
815500 -- (-775.961) [-777.469] (-779.325) (-775.962) * [-775.240] (-777.500) (-775.416) (-776.919) -- 0:00:12
816000 -- [-776.022] (-775.709) (-779.326) (-778.916) * (-779.038) (-777.697) (-776.244) [-775.582] -- 0:00:12
816500 -- (-780.441) [-777.872] (-774.936) (-774.907) * (-783.665) (-774.251) [-775.474] (-774.756) -- 0:00:12
817000 -- (-777.436) [-774.064] (-778.439) (-774.658) * (-775.686) (-778.123) (-777.396) [-773.620] -- 0:00:12
817500 -- (-776.460) (-776.332) (-776.323) [-775.628] * [-777.814] (-775.280) (-775.304) (-775.863) -- 0:00:12
818000 -- (-776.689) (-775.309) (-775.822) [-774.859] * (-776.373) [-775.617] (-776.278) (-775.266) -- 0:00:12
818500 -- (-774.768) (-775.860) [-777.176] (-777.488) * (-777.221) (-778.325) (-778.614) [-775.300] -- 0:00:12
819000 -- (-777.174) [-777.704] (-778.223) (-775.007) * (-775.931) (-776.959) (-775.772) [-774.191] -- 0:00:12
819500 -- (-777.390) (-774.182) [-772.998] (-775.671) * (-776.620) [-776.073] (-776.953) (-772.675) -- 0:00:12
820000 -- (-775.687) (-775.761) (-780.209) [-773.314] * (-776.280) [-775.570] (-776.259) (-775.369) -- 0:00:12
Average standard deviation of split frequencies: 0.004384
820500 -- (-773.958) (-776.640) [-776.213] (-777.466) * [-777.522] (-774.078) (-776.123) (-776.854) -- 0:00:12
821000 -- (-772.953) (-779.757) [-777.670] (-775.803) * (-779.021) (-777.536) (-776.935) [-774.250] -- 0:00:11
821500 -- (-775.631) [-776.699] (-773.924) (-777.775) * (-777.927) (-776.114) [-778.558] (-775.801) -- 0:00:11
822000 -- (-775.329) (-776.637) (-775.267) [-774.991] * (-777.486) [-776.543] (-778.612) (-775.222) -- 0:00:11
822500 -- [-776.720] (-777.228) (-773.025) (-776.149) * [-777.610] (-780.144) (-777.915) (-774.242) -- 0:00:11
823000 -- (-775.619) (-775.808) [-775.472] (-777.440) * (-776.057) [-776.670] (-780.788) (-775.152) -- 0:00:11
823500 -- (-776.731) (-776.339) [-776.388] (-776.493) * (-775.324) [-774.268] (-776.922) (-774.385) -- 0:00:11
824000 -- (-775.533) (-776.597) (-775.340) [-778.135] * (-775.683) [-776.361] (-778.160) (-777.384) -- 0:00:11
824500 -- (-774.173) (-775.936) (-775.670) [-776.365] * (-773.997) [-775.936] (-774.708) (-780.022) -- 0:00:11
825000 -- (-773.411) (-773.831) [-777.780] (-778.735) * (-775.944) (-776.023) [-776.539] (-778.443) -- 0:00:11
Average standard deviation of split frequencies: 0.004446
825500 -- (-775.439) (-778.120) [-774.481] (-782.431) * (-777.197) (-776.038) (-776.702) [-773.884] -- 0:00:11
826000 -- (-775.650) [-776.537] (-779.539) (-778.334) * (-777.450) (-775.228) (-776.716) [-778.928] -- 0:00:11
826500 -- [-773.235] (-775.742) (-782.269) (-778.656) * (-776.220) (-777.587) (-777.681) [-776.267] -- 0:00:11
827000 -- (-774.132) [-776.101] (-778.470) (-778.777) * [-775.180] (-774.374) (-778.426) (-774.950) -- 0:00:11
827500 -- (-775.511) (-775.861) (-775.521) [-775.325] * (-776.129) (-780.734) [-773.108] (-775.087) -- 0:00:11
828000 -- (-777.319) (-775.940) [-774.696] (-774.771) * (-777.772) (-781.162) (-777.346) [-774.664] -- 0:00:11
828500 -- [-778.748] (-777.180) (-776.197) (-775.264) * [-777.781] (-781.167) (-778.661) (-776.814) -- 0:00:11
829000 -- (-775.099) (-781.791) (-777.418) [-774.576] * (-776.415) (-776.401) [-777.068] (-779.527) -- 0:00:11
829500 -- [-775.051] (-783.274) (-778.476) (-780.609) * (-775.850) (-775.412) (-775.953) [-774.949] -- 0:00:11
830000 -- (-773.246) (-780.558) [-777.306] (-774.851) * (-776.772) (-776.713) (-775.196) [-776.050] -- 0:00:11
Average standard deviation of split frequencies: 0.004361
830500 -- (-775.881) (-780.940) (-777.344) [-774.662] * (-779.252) (-778.027) (-779.508) [-781.104] -- 0:00:11
831000 -- [-773.792] (-778.357) (-774.547) (-778.414) * [-779.267] (-777.763) (-779.469) (-780.192) -- 0:00:11
831500 -- [-775.302] (-775.159) (-777.898) (-777.394) * (-777.402) [-778.875] (-778.701) (-776.492) -- 0:00:11
832000 -- (-780.520) [-775.589] (-775.636) (-784.703) * [-774.945] (-776.602) (-776.483) (-776.128) -- 0:00:11
832500 -- (-776.001) (-775.872) [-775.109] (-776.846) * [-775.455] (-776.365) (-773.261) (-777.131) -- 0:00:11
833000 -- (-774.498) [-775.204] (-775.198) (-777.496) * [-776.477] (-776.876) (-774.743) (-776.159) -- 0:00:11
833500 -- (-775.455) (-776.749) [-780.067] (-774.921) * (-777.212) [-775.669] (-776.777) (-778.997) -- 0:00:11
834000 -- (-778.168) (-776.017) [-779.737] (-772.767) * (-778.489) (-776.780) [-775.021] (-778.071) -- 0:00:11
834500 -- (-775.290) (-779.630) (-777.110) [-774.060] * (-778.432) (-776.269) (-776.840) [-778.027] -- 0:00:11
835000 -- (-774.933) (-778.666) [-774.193] (-775.725) * (-779.390) [-773.413] (-777.287) (-778.113) -- 0:00:11
Average standard deviation of split frequencies: 0.004452
835500 -- (-776.360) (-775.823) (-776.849) [-777.235] * (-776.514) (-776.078) [-777.100] (-778.201) -- 0:00:11
836000 -- [-774.967] (-775.087) (-776.769) (-775.981) * (-776.081) (-777.851) [-772.826] (-778.712) -- 0:00:10
836500 -- (-775.906) (-779.657) [-774.114] (-775.147) * (-775.591) [-775.582] (-777.081) (-776.280) -- 0:00:10
837000 -- (-777.397) [-774.709] (-772.956) (-777.132) * [-775.053] (-775.796) (-778.219) (-777.609) -- 0:00:10
837500 -- (-775.368) [-776.940] (-773.849) (-776.994) * (-775.368) (-774.847) (-782.634) [-776.670] -- 0:00:10
838000 -- (-777.936) [-777.546] (-776.109) (-777.401) * (-775.241) [-773.478] (-778.261) (-777.466) -- 0:00:10
838500 -- (-775.860) (-775.294) [-775.857] (-773.986) * (-776.438) (-779.168) (-780.697) [-776.038] -- 0:00:10
839000 -- [-775.654] (-772.821) (-779.337) (-775.704) * (-776.688) (-775.531) (-780.161) [-774.880] -- 0:00:10
839500 -- (-774.899) (-779.485) (-784.460) [-779.129] * [-775.915] (-781.609) (-781.539) (-775.268) -- 0:00:10
840000 -- (-773.885) [-774.767] (-775.871) (-775.911) * (-777.486) (-779.496) (-780.038) [-775.056] -- 0:00:10
Average standard deviation of split frequencies: 0.004161
840500 -- [-778.713] (-774.240) (-775.866) (-775.916) * (-780.975) (-776.094) [-776.712] (-776.207) -- 0:00:10
841000 -- (-776.139) (-777.123) [-775.670] (-775.746) * (-779.410) [-773.554] (-778.243) (-778.374) -- 0:00:10
841500 -- [-775.905] (-777.840) (-775.776) (-775.821) * (-773.965) (-775.148) (-779.259) [-778.357] -- 0:00:10
842000 -- (-775.447) [-776.866] (-776.362) (-780.797) * [-777.181] (-777.934) (-778.339) (-778.400) -- 0:00:10
842500 -- (-776.102) (-775.921) (-776.287) [-774.888] * (-776.820) [-776.840] (-778.894) (-775.732) -- 0:00:10
843000 -- (-776.467) (-776.417) (-775.757) [-775.438] * (-775.079) (-779.590) [-774.857] (-775.270) -- 0:00:10
843500 -- [-775.333] (-779.697) (-775.629) (-777.005) * [-777.564] (-776.631) (-774.415) (-777.175) -- 0:00:10
844000 -- [-774.796] (-782.440) (-778.608) (-779.296) * (-775.520) (-776.394) [-775.046] (-779.670) -- 0:00:10
844500 -- (-777.870) (-777.768) (-772.597) [-778.467] * (-777.924) (-775.981) [-776.327] (-777.189) -- 0:00:10
845000 -- [-774.306] (-776.897) (-778.772) (-777.504) * (-776.216) (-775.674) (-775.734) [-776.815] -- 0:00:10
Average standard deviation of split frequencies: 0.004076
845500 -- (-777.181) (-776.554) (-775.404) [-774.878] * (-776.232) (-775.109) (-776.083) [-776.382] -- 0:00:10
846000 -- (-778.087) (-777.663) [-772.942] (-774.952) * (-783.397) (-777.463) [-776.876] (-776.908) -- 0:00:10
846500 -- (-775.580) (-776.067) [-777.474] (-774.016) * (-778.939) (-779.355) [-776.507] (-777.899) -- 0:00:10
847000 -- (-775.756) (-776.078) [-774.009] (-775.957) * (-779.618) (-778.541) [-771.798] (-777.114) -- 0:00:10
847500 -- [-774.139] (-774.965) (-774.534) (-775.802) * [-774.802] (-776.983) (-777.312) (-782.556) -- 0:00:10
848000 -- (-774.963) [-776.596] (-775.860) (-775.001) * [-774.925] (-775.825) (-781.623) (-775.337) -- 0:00:10
848500 -- [-775.443] (-774.854) (-776.807) (-778.023) * (-778.400) (-776.989) (-778.274) [-776.264] -- 0:00:10
849000 -- (-775.986) (-775.216) (-778.041) [-775.610] * (-774.723) (-776.136) (-778.566) [-775.867] -- 0:00:10
849500 -- (-776.621) [-773.525] (-780.305) (-777.881) * [-775.501] (-776.306) (-778.938) (-775.600) -- 0:00:10
850000 -- (-773.773) (-776.230) (-779.828) [-776.546] * [-773.480] (-777.621) (-775.581) (-777.022) -- 0:00:10
Average standard deviation of split frequencies: 0.004521
850500 -- (-775.803) (-778.222) [-775.023] (-775.310) * (-775.912) [-777.983] (-775.545) (-775.192) -- 0:00:10
851000 -- (-775.542) (-774.613) (-774.787) [-775.792] * (-775.980) [-775.931] (-777.250) (-775.273) -- 0:00:09
851500 -- (-777.582) (-774.299) (-774.277) [-776.815] * (-776.030) (-776.256) [-776.398] (-774.152) -- 0:00:09
852000 -- (-774.305) [-774.626] (-775.346) (-776.753) * [-774.774] (-774.886) (-776.315) (-775.300) -- 0:00:09
852500 -- [-776.191] (-776.031) (-776.406) (-775.354) * (-780.725) (-775.547) [-776.102] (-781.220) -- 0:00:09
853000 -- (-779.572) [-778.868] (-777.306) (-776.243) * (-778.155) (-775.958) [-775.943] (-777.019) -- 0:00:09
853500 -- (-776.645) [-779.564] (-777.953) (-777.890) * (-775.802) [-775.944] (-774.461) (-774.899) -- 0:00:09
854000 -- (-777.556) (-777.224) (-775.493) [-775.452] * (-776.774) (-775.750) (-776.439) [-776.352] -- 0:00:09
854500 -- [-776.272] (-775.591) (-777.380) (-778.495) * [-778.426] (-775.956) (-777.612) (-775.138) -- 0:00:09
855000 -- (-776.902) [-776.534] (-775.614) (-776.008) * (-775.793) (-776.113) [-777.197] (-775.860) -- 0:00:09
Average standard deviation of split frequencies: 0.004406
855500 -- (-777.135) (-778.584) [-776.885] (-775.153) * (-778.413) [-775.922] (-775.919) (-777.392) -- 0:00:09
856000 -- (-775.177) [-776.965] (-779.280) (-776.885) * (-778.437) (-775.928) (-776.661) [-775.322] -- 0:00:09
856500 -- (-775.704) (-778.072) [-776.311] (-779.363) * (-775.353) (-777.536) (-775.227) [-778.785] -- 0:00:09
857000 -- [-777.319] (-775.795) (-776.277) (-774.442) * (-775.089) (-779.594) (-776.926) [-778.455] -- 0:00:09
857500 -- (-776.927) (-775.375) [-776.665] (-775.528) * (-773.650) (-780.652) (-778.567) [-776.286] -- 0:00:09
858000 -- [-776.882] (-774.648) (-776.930) (-774.281) * (-776.049) (-779.327) (-779.537) [-775.122] -- 0:00:09
858500 -- (-777.226) (-779.247) [-775.890] (-776.780) * [-776.599] (-775.475) (-776.050) (-775.673) -- 0:00:09
859000 -- [-777.850] (-774.695) (-777.356) (-776.228) * (-776.358) (-775.168) (-775.598) [-783.593] -- 0:00:09
859500 -- (-775.840) (-774.722) [-778.193] (-774.707) * [-778.975] (-774.943) (-774.516) (-779.231) -- 0:00:09
860000 -- [-775.263] (-777.465) (-777.482) (-776.541) * (-779.253) [-772.387] (-776.897) (-776.777) -- 0:00:09
Average standard deviation of split frequencies: 0.004584
860500 -- (-775.695) (-776.301) (-781.240) [-776.235] * (-782.934) [-780.612] (-773.339) (-774.716) -- 0:00:09
861000 -- (-777.038) [-774.237] (-772.668) (-777.938) * [-775.394] (-777.564) (-774.753) (-780.488) -- 0:00:09
861500 -- (-775.881) (-779.795) (-775.290) [-778.020] * (-777.942) (-774.836) (-773.298) [-775.047] -- 0:00:09
862000 -- (-777.991) (-782.708) [-775.702] (-775.122) * [-776.829] (-773.735) (-775.816) (-774.852) -- 0:00:09
862500 -- (-777.453) (-781.508) [-778.013] (-776.992) * (-775.830) (-775.295) [-774.696] (-774.830) -- 0:00:09
863000 -- [-774.327] (-777.656) (-776.248) (-777.082) * (-776.611) (-777.293) (-775.773) [-775.003] -- 0:00:09
863500 -- (-776.396) (-775.783) [-778.894] (-773.641) * (-776.467) [-779.161] (-774.864) (-778.010) -- 0:00:09
864000 -- (-776.061) (-775.961) (-780.045) [-772.976] * (-778.058) [-779.904] (-775.375) (-776.602) -- 0:00:09
864500 -- (-776.749) [-776.901] (-776.816) (-777.065) * (-778.240) [-775.700] (-774.802) (-775.639) -- 0:00:09
865000 -- [-774.560] (-775.938) (-775.884) (-776.610) * (-775.927) [-777.177] (-776.443) (-775.516) -- 0:00:09
Average standard deviation of split frequencies: 0.004527
865500 -- (-775.590) (-777.860) [-776.370] (-779.358) * (-775.670) (-773.982) [-773.084] (-775.901) -- 0:00:09
866000 -- (-777.958) (-781.413) (-776.015) [-777.262] * (-779.965) (-776.059) (-774.779) [-775.814] -- 0:00:08
866500 -- [-774.843] (-781.016) (-777.901) (-776.856) * (-776.870) [-776.322] (-778.257) (-776.724) -- 0:00:08
867000 -- [-773.878] (-773.599) (-778.374) (-777.046) * (-774.780) (-773.347) (-776.818) [-777.308] -- 0:00:08
867500 -- (-777.287) (-776.090) (-779.397) [-776.643] * [-773.663] (-775.431) (-780.503) (-779.286) -- 0:00:08
868000 -- [-773.909] (-778.004) (-780.171) (-774.546) * (-773.995) [-775.645] (-773.500) (-775.045) -- 0:00:08
868500 -- (-775.546) (-775.736) (-776.713) [-776.154] * (-776.245) (-775.760) (-776.614) [-778.839] -- 0:00:08
869000 -- (-778.307) (-779.091) [-777.274] (-777.940) * [-775.765] (-774.780) (-773.172) (-778.333) -- 0:00:08
869500 -- [-775.778] (-776.587) (-775.849) (-783.626) * (-775.813) (-775.392) (-776.127) [-781.894] -- 0:00:08
870000 -- (-777.922) (-777.303) [-775.267] (-777.469) * [-775.646] (-774.172) (-776.753) (-778.867) -- 0:00:08
Average standard deviation of split frequencies: 0.004730
870500 -- (-777.310) (-777.191) (-775.334) [-776.626] * (-776.838) (-777.424) [-775.756] (-779.514) -- 0:00:08
871000 -- [-775.067] (-775.778) (-774.692) (-774.341) * (-778.433) (-778.725) (-783.572) [-777.206] -- 0:00:08
871500 -- (-776.547) (-775.856) (-775.400) [-774.531] * (-775.540) [-774.176] (-779.574) (-776.852) -- 0:00:08
872000 -- (-775.271) (-775.993) [-776.513] (-776.419) * (-778.086) (-776.499) (-778.416) [-775.675] -- 0:00:08
872500 -- (-775.865) (-775.805) (-775.600) [-777.963] * (-774.594) (-774.723) (-777.169) [-776.657] -- 0:00:08
873000 -- (-777.631) [-773.245] (-778.779) (-776.854) * [-775.676] (-776.257) (-777.717) (-777.091) -- 0:00:08
873500 -- (-778.716) (-773.003) [-773.443] (-775.334) * (-776.089) [-775.301] (-773.668) (-777.480) -- 0:00:08
874000 -- (-778.666) [-773.732] (-777.817) (-775.058) * (-776.356) (-777.511) (-775.361) [-777.484] -- 0:00:08
874500 -- (-776.285) (-774.388) (-775.376) [-775.036] * (-775.311) [-777.819] (-777.488) (-774.784) -- 0:00:08
875000 -- (-778.209) (-775.420) (-778.560) [-777.913] * [-775.213] (-776.738) (-775.551) (-775.120) -- 0:00:08
Average standard deviation of split frequencies: 0.004617
875500 -- (-776.202) (-778.980) [-777.733] (-776.885) * (-774.653) (-776.156) (-773.856) [-776.011] -- 0:00:08
876000 -- (-776.833) [-775.720] (-776.231) (-777.211) * (-775.252) [-776.168] (-776.384) (-774.581) -- 0:00:08
876500 -- (-775.277) [-777.039] (-775.363) (-776.676) * (-777.221) (-775.398) (-773.721) [-777.129] -- 0:00:08
877000 -- (-776.772) [-775.695] (-775.599) (-776.838) * (-777.533) (-775.577) [-775.600] (-780.142) -- 0:00:08
877500 -- (-777.353) (-775.205) [-774.392] (-776.303) * [-776.508] (-776.291) (-774.382) (-778.531) -- 0:00:08
878000 -- (-782.234) (-776.710) [-774.495] (-775.724) * [-773.497] (-776.735) (-775.154) (-779.381) -- 0:00:08
878500 -- (-774.462) [-774.837] (-776.567) (-775.760) * (-775.807) [-775.915] (-774.473) (-779.071) -- 0:00:08
879000 -- (-778.132) [-778.378] (-777.395) (-777.330) * (-775.874) [-776.495] (-776.736) (-774.972) -- 0:00:08
879500 -- (-776.272) [-777.353] (-776.336) (-776.491) * [-776.163] (-776.747) (-777.969) (-776.053) -- 0:00:08
880000 -- (-775.255) (-775.317) [-775.160] (-776.108) * [-773.952] (-776.888) (-776.021) (-778.296) -- 0:00:08
Average standard deviation of split frequencies: 0.004339
880500 -- (-777.951) (-776.392) (-773.206) [-778.717] * (-774.913) [-776.997] (-773.275) (-777.454) -- 0:00:08
881000 -- (-775.114) (-780.114) (-775.105) [-777.403] * (-776.725) (-776.062) [-778.564] (-777.197) -- 0:00:07
881500 -- (-776.395) (-782.620) [-773.054] (-778.797) * (-780.152) (-776.607) (-777.954) [-775.910] -- 0:00:07
882000 -- (-778.912) [-777.354] (-774.550) (-779.094) * (-776.757) (-775.549) [-774.114] (-773.438) -- 0:00:07
882500 -- (-775.578) (-774.316) [-773.186] (-776.678) * [-775.712] (-777.618) (-776.043) (-777.461) -- 0:00:07
883000 -- (-778.689) (-777.932) (-776.962) [-774.957] * [-776.522] (-779.090) (-775.330) (-776.841) -- 0:00:07
883500 -- (-775.313) [-776.738] (-776.133) (-774.989) * (-776.460) [-773.819] (-779.261) (-774.713) -- 0:00:07
884000 -- [-773.459] (-780.377) (-776.967) (-774.622) * (-780.050) [-774.780] (-775.903) (-777.050) -- 0:00:07
884500 -- (-776.871) (-779.977) (-774.744) [-774.811] * (-775.811) (-775.654) (-776.607) [-775.644] -- 0:00:07
885000 -- (-776.456) (-777.430) (-776.660) [-775.007] * (-776.120) (-776.568) [-776.496] (-774.931) -- 0:00:07
Average standard deviation of split frequencies: 0.004593
885500 -- (-774.665) [-775.400] (-776.921) (-775.507) * (-775.599) [-778.401] (-773.902) (-775.939) -- 0:00:07
886000 -- (-775.256) [-774.832] (-776.808) (-778.577) * (-775.899) [-774.937] (-774.373) (-775.139) -- 0:00:07
886500 -- (-776.731) (-776.160) [-775.894] (-776.561) * [-776.390] (-776.233) (-778.649) (-776.327) -- 0:00:07
887000 -- (-774.341) (-776.416) [-776.576] (-778.970) * (-776.764) (-776.925) (-774.410) [-778.197] -- 0:00:07
887500 -- [-775.732] (-775.734) (-778.378) (-780.006) * (-777.575) (-776.035) [-774.625] (-777.404) -- 0:00:07
888000 -- [-775.344] (-780.235) (-775.805) (-775.441) * (-777.103) (-775.954) [-776.459] (-773.496) -- 0:00:07
888500 -- (-776.008) (-775.046) [-776.554] (-775.901) * (-780.176) (-773.574) (-774.372) [-777.430] -- 0:00:07
889000 -- (-776.671) (-776.229) [-774.532] (-779.237) * (-778.901) (-774.026) [-776.018] (-775.839) -- 0:00:07
889500 -- (-776.414) (-776.451) [-775.588] (-782.133) * (-776.107) (-775.863) (-776.307) [-776.735] -- 0:00:07
890000 -- (-774.586) (-778.677) (-773.577) [-774.838] * (-774.223) [-775.090] (-776.571) (-777.134) -- 0:00:07
Average standard deviation of split frequencies: 0.004513
890500 -- (-776.014) [-773.496] (-775.656) (-776.745) * [-774.376] (-775.393) (-774.070) (-775.500) -- 0:00:07
891000 -- (-774.804) (-775.722) (-775.181) [-776.424] * (-774.806) (-775.153) [-774.818] (-775.346) -- 0:00:07
891500 -- (-777.643) (-777.009) (-775.691) [-775.071] * (-775.137) (-775.365) [-773.978] (-773.083) -- 0:00:07
892000 -- (-775.875) (-778.007) (-776.986) [-774.888] * (-779.942) [-776.663] (-776.457) (-774.859) -- 0:00:07
892500 -- [-776.674] (-776.936) (-778.488) (-774.748) * (-778.813) [-776.637] (-773.309) (-775.917) -- 0:00:07
893000 -- (-774.515) (-779.650) (-778.362) [-776.017] * (-778.277) (-776.258) (-774.704) [-776.067] -- 0:00:07
893500 -- (-772.775) (-776.232) [-775.094] (-774.635) * (-777.153) (-773.705) (-777.580) [-777.277] -- 0:00:07
894000 -- (-775.697) [-773.280] (-774.524) (-778.475) * (-775.682) [-775.978] (-775.685) (-777.753) -- 0:00:07
894500 -- (-776.390) (-775.281) [-777.323] (-776.554) * [-775.197] (-778.778) (-775.713) (-777.963) -- 0:00:07
895000 -- (-776.162) (-773.324) (-778.487) [-775.072] * (-776.872) (-775.436) (-778.235) [-774.328] -- 0:00:07
Average standard deviation of split frequencies: 0.004818
895500 -- (-776.290) [-775.473] (-780.278) (-775.076) * (-776.197) (-776.783) [-774.461] (-777.031) -- 0:00:07
896000 -- (-781.514) (-774.936) (-774.440) [-773.225] * (-776.269) (-776.937) (-773.965) [-771.990] -- 0:00:06
896500 -- (-776.722) [-774.880] (-779.007) (-774.136) * (-773.644) [-775.115] (-775.827) (-779.714) -- 0:00:06
897000 -- (-778.471) [-777.459] (-773.303) (-778.102) * (-777.583) [-776.983] (-774.804) (-775.070) -- 0:00:06
897500 -- (-776.096) [-778.164] (-775.744) (-775.411) * (-777.436) [-773.664] (-776.560) (-778.491) -- 0:00:06
898000 -- [-777.140] (-776.273) (-776.990) (-773.936) * (-775.010) (-774.301) [-778.394] (-778.937) -- 0:00:06
898500 -- (-775.804) (-776.121) (-776.603) [-774.288] * (-775.450) [-776.598] (-778.395) (-778.986) -- 0:00:06
899000 -- (-777.252) (-776.643) [-776.692] (-775.058) * [-774.929] (-777.072) (-778.062) (-782.733) -- 0:00:06
899500 -- (-774.530) [-778.874] (-775.603) (-775.979) * (-773.301) (-777.628) (-775.599) [-778.582] -- 0:00:06
900000 -- (-776.572) (-775.909) [-775.744] (-775.564) * (-776.804) (-780.020) [-777.136] (-778.018) -- 0:00:06
Average standard deviation of split frequencies: 0.004986
900500 -- (-777.101) (-777.302) [-777.046] (-780.943) * (-776.004) [-778.054] (-776.467) (-774.375) -- 0:00:06
901000 -- (-779.092) (-777.656) (-775.932) [-774.945] * [-779.666] (-778.488) (-775.627) (-776.407) -- 0:00:06
901500 -- (-775.672) (-776.943) [-776.312] (-774.820) * (-777.265) [-772.648] (-778.766) (-775.383) -- 0:00:06
902000 -- (-775.273) (-779.452) [-776.009] (-776.030) * (-778.422) (-775.230) [-775.936] (-776.531) -- 0:00:06
902500 -- (-777.675) (-779.155) [-777.941] (-777.898) * (-776.807) (-777.771) [-774.827] (-776.050) -- 0:00:06
903000 -- (-775.308) (-778.461) (-774.799) [-779.650] * [-774.223] (-779.340) (-776.224) (-775.726) -- 0:00:06
903500 -- (-774.823) (-778.811) (-778.886) [-776.651] * [-774.817] (-775.721) (-776.597) (-779.699) -- 0:00:06
904000 -- (-778.586) [-774.757] (-777.182) (-775.972) * [-774.168] (-777.110) (-777.309) (-780.867) -- 0:00:06
904500 -- [-776.670] (-779.391) (-774.788) (-775.004) * (-775.652) (-777.999) [-775.205] (-778.296) -- 0:00:06
905000 -- (-775.234) (-775.855) [-774.649] (-775.486) * (-776.997) [-777.730] (-778.977) (-772.620) -- 0:00:06
Average standard deviation of split frequencies: 0.004984
905500 -- (-777.421) (-774.942) [-773.785] (-777.198) * [-775.941] (-776.769) (-778.391) (-773.712) -- 0:00:06
906000 -- (-778.114) (-775.114) (-776.998) [-775.009] * [-775.804] (-776.473) (-780.420) (-775.982) -- 0:00:06
906500 -- (-775.907) (-775.606) (-775.204) [-775.834] * (-778.620) (-775.040) (-785.593) [-782.266] -- 0:00:06
907000 -- (-775.596) [-778.118] (-772.589) (-776.338) * (-776.485) (-777.096) (-783.832) [-775.482] -- 0:00:06
907500 -- (-781.384) (-777.543) [-771.677] (-774.990) * (-779.735) (-775.433) [-775.243] (-780.252) -- 0:00:06
908000 -- (-775.819) (-776.560) [-775.312] (-776.179) * [-778.332] (-773.970) (-776.180) (-777.689) -- 0:00:06
908500 -- (-775.931) [-776.132] (-775.771) (-777.363) * (-775.021) [-773.185] (-775.541) (-775.426) -- 0:00:06
909000 -- [-776.709] (-777.525) (-777.740) (-779.672) * (-775.917) (-775.467) (-778.705) [-775.595] -- 0:00:06
909500 -- (-777.842) (-777.080) [-774.773] (-778.155) * (-779.205) (-778.884) [-775.527] (-774.817) -- 0:00:06
910000 -- (-777.170) (-774.526) (-774.430) [-775.820] * [-777.099] (-773.139) (-777.094) (-777.015) -- 0:00:06
Average standard deviation of split frequencies: 0.005204
910500 -- (-776.632) (-776.344) [-776.503] (-775.283) * [-775.899] (-775.378) (-776.246) (-775.742) -- 0:00:05
911000 -- (-777.123) [-775.943] (-775.232) (-780.167) * [-775.984] (-777.017) (-775.585) (-777.522) -- 0:00:05
911500 -- [-777.238] (-775.341) (-779.249) (-779.130) * (-780.380) (-774.966) (-782.804) [-781.419] -- 0:00:05
912000 -- (-775.252) (-775.879) (-772.911) [-778.930] * (-777.175) (-774.642) (-777.452) [-778.418] -- 0:00:05
912500 -- [-775.477] (-779.599) (-776.200) (-776.868) * [-774.124] (-777.375) (-776.421) (-776.997) -- 0:00:05
913000 -- [-774.254] (-772.915) (-775.373) (-777.046) * (-775.531) (-777.133) [-775.254] (-775.586) -- 0:00:05
913500 -- (-777.308) [-775.234] (-775.711) (-778.193) * (-774.747) (-780.097) [-774.474] (-775.458) -- 0:00:05
914000 -- (-775.803) (-779.868) [-775.868] (-776.686) * (-779.373) (-774.963) (-775.443) [-779.210] -- 0:00:05
914500 -- (-775.412) [-775.972] (-774.718) (-777.452) * (-776.878) [-775.148] (-775.539) (-780.352) -- 0:00:05
915000 -- (-775.957) [-775.796] (-777.359) (-777.384) * (-775.181) (-775.826) [-776.305] (-777.647) -- 0:00:05
Average standard deviation of split frequencies: 0.004984
915500 -- (-778.636) (-777.375) [-776.409] (-774.463) * (-776.859) (-777.377) (-774.660) [-778.248] -- 0:00:05
916000 -- (-776.952) (-776.457) [-775.564] (-777.183) * [-775.453] (-778.161) (-778.733) (-776.244) -- 0:00:05
916500 -- (-778.749) [-778.839] (-775.974) (-778.856) * [-775.557] (-777.006) (-778.365) (-776.135) -- 0:00:05
917000 -- (-775.045) (-778.242) [-775.434] (-781.708) * [-774.157] (-775.241) (-777.135) (-777.806) -- 0:00:05
917500 -- (-775.515) (-774.832) [-778.072] (-777.627) * (-778.943) (-777.445) (-776.659) [-774.253] -- 0:00:05
918000 -- (-775.176) (-780.282) [-776.694] (-777.565) * (-784.093) [-775.281] (-777.789) (-779.055) -- 0:00:05
918500 -- [-774.988] (-777.897) (-776.374) (-777.437) * [-778.483] (-778.292) (-774.455) (-779.210) -- 0:00:05
919000 -- (-773.264) (-776.015) (-776.730) [-775.303] * (-776.476) [-777.628] (-775.448) (-777.678) -- 0:00:05
919500 -- (-780.088) (-773.201) (-776.495) [-774.946] * (-776.875) [-778.649] (-779.231) (-776.108) -- 0:00:05
920000 -- [-774.167] (-775.474) (-782.099) (-774.510) * [-778.048] (-774.767) (-777.017) (-777.473) -- 0:00:05
Average standard deviation of split frequencies: 0.004932
920500 -- (-778.267) (-777.662) (-775.627) [-775.050] * (-775.567) (-775.424) [-774.940] (-777.728) -- 0:00:05
921000 -- (-775.000) (-776.663) [-776.488] (-775.863) * (-775.453) (-775.212) [-778.182] (-776.817) -- 0:00:05
921500 -- (-777.056) [-779.896] (-778.251) (-777.539) * [-775.656] (-776.868) (-776.808) (-777.094) -- 0:00:05
922000 -- (-776.717) (-779.956) (-775.558) [-774.156] * (-774.870) (-774.977) (-778.809) [-776.503] -- 0:00:05
922500 -- (-775.587) (-778.795) [-777.676] (-775.205) * (-776.399) (-775.518) (-774.753) [-772.673] -- 0:00:05
923000 -- [-779.272] (-778.023) (-777.603) (-775.161) * [-774.845] (-782.013) (-779.933) (-776.786) -- 0:00:05
923500 -- (-778.866) [-773.543] (-775.916) (-777.638) * (-774.992) (-777.164) [-775.599] (-777.594) -- 0:00:05
924000 -- (-778.085) [-775.090] (-778.869) (-777.530) * [-776.632] (-776.442) (-774.729) (-777.448) -- 0:00:05
924500 -- (-776.923) [-776.754] (-775.379) (-775.703) * (-781.393) (-779.888) [-774.466] (-782.536) -- 0:00:05
925000 -- (-774.424) (-772.718) (-776.866) [-775.400] * (-780.113) [-779.143] (-774.022) (-777.322) -- 0:00:05
Average standard deviation of split frequencies: 0.004876
925500 -- [-774.514] (-776.235) (-776.113) (-774.500) * (-777.370) (-781.441) [-774.222] (-776.185) -- 0:00:04
926000 -- [-777.906] (-778.426) (-775.371) (-775.778) * [-773.955] (-776.189) (-777.769) (-780.885) -- 0:00:04
926500 -- (-780.194) [-774.230] (-775.318) (-777.199) * [-779.294] (-775.265) (-775.459) (-777.978) -- 0:00:04
927000 -- (-777.051) [-774.322] (-776.037) (-777.242) * (-774.653) [-773.614] (-774.020) (-776.630) -- 0:00:04
927500 -- (-780.331) [-776.726] (-776.291) (-779.762) * (-777.345) (-777.281) (-773.666) [-776.949] -- 0:00:04
928000 -- (-777.193) (-773.710) (-775.950) [-775.171] * [-776.975] (-777.176) (-776.249) (-774.304) -- 0:00:04
928500 -- (-776.420) [-774.691] (-774.581) (-776.062) * (-776.682) (-774.774) (-776.928) [-775.924] -- 0:00:04
929000 -- [-776.292] (-774.538) (-783.437) (-774.511) * (-775.760) (-776.197) (-774.802) [-777.404] -- 0:00:04
929500 -- (-779.527) [-771.923] (-778.209) (-777.540) * [-775.181] (-778.492) (-775.401) (-777.163) -- 0:00:04
930000 -- (-778.926) (-775.956) [-778.549] (-774.192) * (-775.872) (-778.587) [-774.611] (-776.354) -- 0:00:04
Average standard deviation of split frequencies: 0.004905
930500 -- [-776.180] (-776.479) (-780.198) (-776.917) * (-775.922) (-777.576) [-775.003] (-778.343) -- 0:00:04
931000 -- (-776.086) (-778.110) (-779.579) [-775.011] * (-777.680) (-775.611) [-780.279] (-776.385) -- 0:00:04
931500 -- (-772.873) (-772.775) (-777.627) [-776.464] * [-775.396] (-775.573) (-780.253) (-776.419) -- 0:00:04
932000 -- (-775.115) [-774.697] (-777.034) (-777.925) * (-774.606) (-776.471) (-778.039) [-772.685] -- 0:00:04
932500 -- (-777.365) [-778.638] (-775.783) (-777.711) * [-775.200] (-776.485) (-776.680) (-778.599) -- 0:00:04
933000 -- [-774.087] (-775.584) (-775.368) (-776.816) * [-778.718] (-775.412) (-774.292) (-775.582) -- 0:00:04
933500 -- [-775.136] (-774.788) (-774.075) (-772.809) * (-774.648) (-775.309) [-775.116] (-773.485) -- 0:00:04
934000 -- [-777.333] (-775.238) (-776.386) (-773.982) * (-775.011) [-775.056] (-775.267) (-774.915) -- 0:00:04
934500 -- (-775.169) (-775.759) (-778.993) [-775.903] * (-774.295) (-772.717) (-777.319) [-773.919] -- 0:00:04
935000 -- (-775.441) (-778.398) (-779.259) [-775.100] * [-774.338] (-776.555) (-777.298) (-776.864) -- 0:00:04
Average standard deviation of split frequencies: 0.005195
935500 -- [-778.511] (-779.890) (-777.126) (-774.932) * [-778.348] (-776.685) (-777.251) (-776.214) -- 0:00:04
936000 -- (-778.544) (-778.574) (-779.771) [-773.230] * (-773.568) [-777.981] (-781.743) (-777.042) -- 0:00:04
936500 -- (-778.718) [-773.557] (-775.296) (-773.084) * [-775.312] (-778.237) (-775.505) (-778.343) -- 0:00:04
937000 -- (-778.675) (-773.943) [-778.088] (-774.630) * (-775.449) (-777.767) (-777.886) [-777.318] -- 0:00:04
937500 -- (-776.282) [-774.417] (-775.647) (-775.128) * (-778.855) [-777.577] (-776.079) (-776.252) -- 0:00:04
938000 -- [-782.874] (-772.813) (-777.065) (-774.802) * (-777.895) [-776.836] (-778.578) (-774.910) -- 0:00:04
938500 -- (-776.469) [-777.698] (-774.742) (-783.424) * (-775.125) (-775.506) [-774.926] (-775.174) -- 0:00:04
939000 -- (-779.618) (-775.248) (-776.677) [-775.108] * (-779.371) [-775.882] (-776.433) (-778.318) -- 0:00:04
939500 -- (-775.721) (-774.645) [-775.192] (-777.550) * (-778.005) [-775.707] (-776.407) (-778.056) -- 0:00:04
940000 -- (-776.161) (-774.710) (-774.468) [-780.321] * (-781.747) [-777.080] (-776.939) (-776.881) -- 0:00:04
Average standard deviation of split frequencies: 0.004985
940500 -- (-776.927) [-774.997] (-774.523) (-776.787) * (-778.533) (-776.989) (-776.861) [-775.976] -- 0:00:03
941000 -- (-776.369) [-776.789] (-777.661) (-778.062) * (-780.727) (-774.965) (-774.376) [-772.514] -- 0:00:03
941500 -- (-780.451) (-773.624) [-776.138] (-775.704) * (-779.552) [-776.243] (-776.514) (-776.226) -- 0:00:03
942000 -- (-777.209) [-776.405] (-774.365) (-774.976) * (-776.460) (-776.256) [-777.717] (-776.429) -- 0:00:03
942500 -- (-777.653) (-776.643) [-777.859] (-777.920) * (-775.462) (-776.105) (-777.116) [-776.653] -- 0:00:03
943000 -- (-775.085) [-778.096] (-779.459) (-778.281) * (-775.041) (-779.781) (-776.799) [-774.088] -- 0:00:03
943500 -- (-775.070) (-781.177) (-776.211) [-775.604] * (-780.212) [-776.824] (-776.844) (-775.369) -- 0:00:03
944000 -- (-775.312) (-780.402) [-776.628] (-778.534) * [-776.876] (-776.604) (-780.379) (-776.389) -- 0:00:03
944500 -- (-776.880) (-773.142) (-775.410) [-776.844] * (-775.410) (-776.564) [-775.851] (-778.003) -- 0:00:03
945000 -- (-775.503) (-778.723) [-777.771] (-774.683) * (-776.955) (-774.363) (-781.083) [-776.184] -- 0:00:03
Average standard deviation of split frequencies: 0.005062
945500 -- (-777.481) (-780.415) (-775.107) [-775.804] * [-775.031] (-773.770) (-782.103) (-776.129) -- 0:00:03
946000 -- [-775.611] (-778.779) (-776.560) (-775.589) * (-776.169) [-777.493] (-776.247) (-777.382) -- 0:00:03
946500 -- (-775.000) (-775.904) [-776.409] (-775.033) * (-778.336) [-777.532] (-776.578) (-778.507) -- 0:00:03
947000 -- (-774.961) [-776.988] (-776.150) (-774.705) * (-775.868) [-777.627] (-774.502) (-779.258) -- 0:00:03
947500 -- (-776.691) (-776.502) [-776.939] (-774.275) * (-775.993) (-775.207) [-772.976] (-777.526) -- 0:00:03
948000 -- (-776.130) (-776.360) (-776.423) [-772.542] * (-773.849) [-774.906] (-775.710) (-775.654) -- 0:00:03
948500 -- (-776.321) [-777.538] (-775.126) (-776.255) * (-775.616) (-775.917) (-775.323) [-773.259] -- 0:00:03
949000 -- [-776.015] (-777.431) (-776.704) (-778.108) * (-777.603) (-776.314) (-775.321) [-775.046] -- 0:00:03
949500 -- (-774.610) (-783.005) [-773.945] (-774.306) * (-776.399) [-775.057] (-775.305) (-775.209) -- 0:00:03
950000 -- [-775.763] (-780.235) (-775.657) (-772.480) * (-775.590) [-773.514] (-778.843) (-775.054) -- 0:00:03
Average standard deviation of split frequencies: 0.004802
950500 -- [-776.893] (-776.142) (-776.057) (-777.574) * (-779.101) (-777.539) [-774.992] (-776.301) -- 0:00:03
951000 -- (-776.822) [-775.780] (-776.751) (-776.879) * [-777.688] (-776.290) (-775.175) (-777.579) -- 0:00:03
951500 -- (-775.541) (-778.178) (-776.452) [-773.427] * (-775.353) [-774.623] (-774.469) (-777.221) -- 0:00:03
952000 -- [-775.876] (-775.761) (-775.639) (-774.416) * (-771.855) [-776.104] (-776.194) (-777.573) -- 0:00:03
952500 -- (-774.191) (-773.509) (-779.961) [-773.742] * (-774.877) (-778.140) [-777.233] (-778.101) -- 0:00:03
953000 -- (-774.472) [-774.396] (-776.873) (-775.154) * (-776.693) (-781.309) (-777.685) [-776.741] -- 0:00:03
953500 -- (-775.228) (-777.082) (-776.714) [-775.355] * (-776.603) (-775.994) [-776.896] (-777.347) -- 0:00:03
954000 -- (-777.458) (-778.396) [-774.900] (-772.765) * (-775.548) [-774.793] (-776.408) (-775.495) -- 0:00:03
954500 -- (-776.121) (-777.952) (-775.023) [-773.969] * (-776.552) [-774.996] (-775.757) (-774.018) -- 0:00:03
955000 -- [-778.842] (-778.439) (-775.602) (-778.583) * (-777.037) (-776.454) [-779.766] (-775.503) -- 0:00:03
Average standard deviation of split frequencies: 0.004723
955500 -- (-777.210) (-775.696) [-780.529] (-776.925) * (-777.583) (-776.826) [-774.063] (-776.324) -- 0:00:02
956000 -- [-774.280] (-776.979) (-776.732) (-776.188) * (-778.174) (-778.738) (-776.809) [-773.718] -- 0:00:02
956500 -- (-773.925) (-779.661) (-776.477) [-775.551] * (-781.377) (-775.414) (-781.173) [-776.443] -- 0:00:02
957000 -- (-775.648) (-777.487) (-777.778) [-776.616] * [-776.206] (-778.128) (-776.717) (-776.412) -- 0:00:02
957500 -- [-780.332] (-777.663) (-776.065) (-777.028) * (-775.802) (-777.812) (-777.146) [-776.748] -- 0:00:02
958000 -- (-779.676) (-778.660) (-775.487) [-775.452] * (-775.555) [-776.858] (-776.144) (-778.362) -- 0:00:02
958500 -- (-777.316) (-775.432) (-775.323) [-775.382] * [-774.765] (-776.554) (-775.509) (-776.120) -- 0:00:02
959000 -- (-774.609) (-778.876) (-775.053) [-774.813] * (-776.237) (-775.452) [-776.668] (-776.397) -- 0:00:02
959500 -- (-779.487) (-776.586) (-776.020) [-777.369] * (-779.447) (-775.280) (-773.336) [-776.575] -- 0:00:02
960000 -- (-778.785) (-777.387) (-771.815) [-775.546] * (-774.852) (-775.338) [-776.951] (-776.317) -- 0:00:02
Average standard deviation of split frequencies: 0.004804
960500 -- (-778.692) [-777.592] (-778.704) (-775.190) * (-775.045) (-776.297) (-778.363) [-777.971] -- 0:00:02
961000 -- (-780.608) [-775.426] (-773.764) (-775.967) * [-775.216] (-776.809) (-777.869) (-779.468) -- 0:00:02
961500 -- [-776.213] (-777.210) (-776.126) (-775.161) * (-777.063) [-775.399] (-777.604) (-776.583) -- 0:00:02
962000 -- (-776.895) (-777.049) (-776.379) [-775.299] * (-775.246) (-777.125) [-773.422] (-772.945) -- 0:00:02
962500 -- (-779.064) [-775.832] (-777.093) (-775.036) * (-776.128) (-774.829) (-776.956) [-775.851] -- 0:00:02
963000 -- (-778.049) (-777.593) [-773.940] (-774.832) * (-779.909) (-774.387) [-775.964] (-775.419) -- 0:00:02
963500 -- (-774.468) (-779.697) (-774.627) [-774.259] * (-779.253) [-775.413] (-777.060) (-778.986) -- 0:00:02
964000 -- (-774.615) [-777.273] (-775.490) (-775.304) * (-777.267) (-777.794) (-778.002) [-775.882] -- 0:00:02
964500 -- (-773.693) (-776.716) (-782.022) [-778.215] * (-780.765) [-776.352] (-776.576) (-775.443) -- 0:00:02
965000 -- (-775.175) (-777.468) (-778.669) [-775.468] * (-779.391) (-780.516) [-775.983] (-773.960) -- 0:00:02
Average standard deviation of split frequencies: 0.004469
965500 -- (-777.045) (-777.947) [-776.513] (-778.504) * (-775.481) (-782.961) (-774.101) [-779.122] -- 0:00:02
966000 -- (-777.765) (-776.247) (-775.931) [-777.489] * (-775.936) (-778.975) [-775.193] (-777.496) -- 0:00:02
966500 -- (-776.964) (-775.281) (-775.396) [-779.600] * (-774.364) (-779.084) [-773.633] (-777.210) -- 0:00:02
967000 -- (-776.492) (-772.922) (-776.204) [-774.866] * (-775.843) (-776.439) [-774.793] (-777.275) -- 0:00:02
967500 -- [-774.284] (-776.543) (-776.759) (-774.645) * (-775.515) (-779.275) [-776.944] (-775.445) -- 0:00:02
968000 -- [-773.588] (-776.155) (-774.211) (-773.756) * (-775.619) [-775.926] (-779.348) (-775.808) -- 0:00:02
968500 -- (-775.098) [-772.501] (-778.969) (-772.550) * (-774.770) [-777.847] (-775.827) (-774.093) -- 0:00:02
969000 -- (-775.546) (-776.368) (-778.029) [-775.584] * (-775.261) (-775.826) (-778.380) [-776.958] -- 0:00:02
969500 -- [-774.170] (-774.545) (-776.474) (-775.428) * (-776.058) (-775.733) [-779.458] (-775.388) -- 0:00:02
970000 -- (-774.727) (-774.479) [-775.605] (-775.241) * [-777.147] (-775.759) (-779.277) (-776.946) -- 0:00:02
Average standard deviation of split frequencies: 0.004805
970500 -- (-777.176) (-776.167) [-775.056] (-775.951) * (-776.945) (-778.217) (-778.407) [-777.447] -- 0:00:01
971000 -- (-776.718) [-780.039] (-776.769) (-778.261) * [-776.727] (-776.587) (-775.403) (-774.741) -- 0:00:01
971500 -- (-776.292) (-775.101) [-776.448] (-773.967) * (-777.952) (-775.939) (-776.619) [-776.593] -- 0:00:01
972000 -- (-776.548) [-776.815] (-775.922) (-777.846) * (-776.736) (-775.349) [-774.490] (-776.373) -- 0:00:01
972500 -- (-776.964) (-774.586) (-775.075) [-774.894] * (-779.095) (-775.500) (-780.079) [-775.221] -- 0:00:01
973000 -- (-781.965) (-777.273) (-777.064) [-772.123] * (-774.893) (-775.850) (-777.465) [-775.913] -- 0:00:01
973500 -- (-776.479) (-777.399) (-774.654) [-776.723] * (-774.883) [-777.411] (-777.087) (-773.965) -- 0:00:01
974000 -- (-776.332) (-775.831) (-775.628) [-776.098] * [-775.094] (-775.519) (-777.102) (-776.106) -- 0:00:01
974500 -- [-776.877] (-774.515) (-776.641) (-776.494) * [-773.186] (-775.983) (-776.954) (-777.399) -- 0:00:01
975000 -- (-779.192) (-776.072) (-774.529) [-776.645] * (-778.745) (-774.262) (-777.179) [-774.823] -- 0:00:01
Average standard deviation of split frequencies: 0.005211
975500 -- (-778.358) [-776.849] (-775.034) (-775.928) * (-775.184) (-777.195) [-778.627] (-774.323) -- 0:00:01
976000 -- [-777.494] (-775.743) (-776.732) (-780.512) * (-773.678) (-776.204) [-774.588] (-775.264) -- 0:00:01
976500 -- [-777.663] (-777.486) (-776.365) (-775.958) * (-775.143) (-775.338) [-774.849] (-776.084) -- 0:00:01
977000 -- (-778.025) [-773.316] (-786.660) (-779.968) * (-775.615) [-775.687] (-774.933) (-776.039) -- 0:00:01
977500 -- (-778.679) [-775.961] (-779.104) (-776.443) * (-775.998) (-775.062) [-776.630] (-775.920) -- 0:00:01
978000 -- (-776.048) [-777.164] (-775.839) (-777.899) * [-774.929] (-777.412) (-776.955) (-775.906) -- 0:00:01
978500 -- [-776.139] (-777.851) (-777.070) (-776.057) * (-776.485) (-777.167) (-776.283) [-776.990] -- 0:00:01
979000 -- (-777.730) [-776.448] (-775.006) (-774.591) * (-776.634) [-776.021] (-778.061) (-779.340) -- 0:00:01
979500 -- [-776.358] (-774.708) (-776.400) (-773.194) * (-775.280) [-775.353] (-776.476) (-775.344) -- 0:00:01
980000 -- [-777.255] (-774.732) (-774.209) (-773.369) * (-775.369) (-776.285) [-773.712] (-776.305) -- 0:00:01
Average standard deviation of split frequencies: 0.004984
980500 -- (-776.585) (-777.959) [-777.167] (-777.515) * (-774.061) (-775.699) [-775.790] (-777.837) -- 0:00:01
981000 -- [-775.977] (-776.292) (-779.718) (-777.104) * (-776.750) (-777.135) (-776.632) [-775.155] -- 0:00:01
981500 -- (-774.640) (-776.737) [-775.644] (-778.946) * (-776.746) [-775.873] (-774.500) (-775.750) -- 0:00:01
982000 -- [-777.731] (-775.682) (-774.711) (-777.031) * (-774.797) (-775.024) [-780.134] (-775.577) -- 0:00:01
982500 -- [-775.344] (-776.877) (-775.504) (-775.045) * (-775.707) [-775.348] (-774.615) (-776.814) -- 0:00:01
983000 -- [-777.417] (-777.167) (-774.479) (-776.020) * (-776.586) (-777.064) (-775.192) [-773.419] -- 0:00:01
983500 -- [-776.916] (-775.593) (-777.981) (-776.257) * (-776.286) (-776.988) [-774.328] (-776.827) -- 0:00:01
984000 -- [-774.469] (-776.078) (-776.827) (-776.447) * [-775.344] (-781.133) (-774.323) (-779.130) -- 0:00:01
984500 -- [-774.251] (-780.712) (-776.660) (-778.820) * [-776.022] (-780.913) (-775.495) (-775.047) -- 0:00:01
985000 -- (-777.745) (-777.816) (-778.079) [-774.058] * [-776.709] (-778.282) (-775.991) (-777.087) -- 0:00:01
Average standard deviation of split frequencies: 0.005083
985500 -- (-775.990) (-776.592) [-775.592] (-780.492) * [-777.003] (-775.925) (-775.180) (-778.395) -- 0:00:00
986000 -- [-775.642] (-774.295) (-776.198) (-777.437) * (-774.934) [-776.652] (-775.784) (-773.857) -- 0:00:00
986500 -- (-775.246) (-776.982) [-775.330] (-777.281) * (-775.575) (-777.264) [-773.650] (-775.119) -- 0:00:00
987000 -- (-777.969) [-780.859] (-775.659) (-775.555) * (-776.326) [-777.166] (-777.700) (-776.201) -- 0:00:00
987500 -- (-776.762) (-781.310) (-776.976) [-774.636] * [-776.494] (-780.435) (-777.659) (-776.032) -- 0:00:00
988000 -- (-777.910) (-780.404) (-775.539) [-774.833] * (-776.383) (-776.109) [-775.226] (-774.058) -- 0:00:00
988500 -- [-775.166] (-779.781) (-778.528) (-778.377) * (-775.734) (-776.156) [-774.426] (-776.382) -- 0:00:00
989000 -- (-780.732) [-778.211] (-776.215) (-777.407) * (-775.095) [-775.762] (-777.574) (-776.980) -- 0:00:00
989500 -- (-778.414) (-779.856) (-774.711) [-777.159] * [-773.961] (-778.071) (-776.201) (-776.965) -- 0:00:00
990000 -- (-776.974) (-777.679) [-775.728] (-776.400) * [-774.890] (-779.105) (-777.896) (-780.387) -- 0:00:00
Average standard deviation of split frequencies: 0.005109
990500 -- (-777.424) (-776.911) [-775.049] (-781.861) * (-778.662) [-779.785] (-776.795) (-777.178) -- 0:00:00
991000 -- (-774.137) [-775.356] (-777.688) (-780.419) * (-775.276) (-777.330) [-776.570] (-775.281) -- 0:00:00
991500 -- (-775.762) [-775.400] (-776.830) (-777.800) * (-774.306) (-774.736) (-776.068) [-775.009] -- 0:00:00
992000 -- [-776.031] (-777.513) (-776.403) (-776.654) * (-774.814) (-776.033) (-775.058) [-775.910] -- 0:00:00
992500 -- (-775.444) (-776.142) [-776.079] (-775.093) * (-775.046) (-779.698) (-776.014) [-775.915] -- 0:00:00
993000 -- (-775.202) (-777.129) (-776.504) [-776.186] * (-777.674) (-778.958) (-776.514) [-773.871] -- 0:00:00
993500 -- (-776.647) [-775.559] (-775.992) (-775.022) * (-776.787) (-774.280) (-775.438) [-775.120] -- 0:00:00
994000 -- (-775.942) [-775.270] (-779.081) (-774.489) * (-777.241) (-774.768) (-773.136) [-777.963] -- 0:00:00
994500 -- (-777.066) (-775.524) (-779.041) [-774.619] * (-776.528) [-774.739] (-776.493) (-779.850) -- 0:00:00
995000 -- (-777.837) (-773.225) (-775.415) [-773.677] * [-777.414] (-774.830) (-775.947) (-774.895) -- 0:00:00
Average standard deviation of split frequencies: 0.004982
995500 -- (-775.797) (-775.731) (-778.299) [-775.280] * (-777.026) (-775.923) (-776.387) [-773.371] -- 0:00:00
996000 -- [-776.431] (-778.453) (-781.388) (-779.021) * (-775.657) (-777.666) (-774.504) [-775.876] -- 0:00:00
996500 -- (-775.710) (-776.936) [-776.753] (-779.954) * (-776.038) [-775.115] (-776.853) (-774.853) -- 0:00:00
997000 -- (-777.325) (-776.496) [-774.864] (-776.179) * (-780.062) [-775.791] (-775.619) (-777.315) -- 0:00:00
997500 -- (-774.639) (-775.519) [-777.168] (-778.101) * (-775.212) (-774.683) [-776.085] (-777.947) -- 0:00:00
998000 -- (-781.375) [-776.283] (-776.488) (-775.428) * (-775.176) (-775.249) (-775.956) [-776.846] -- 0:00:00
998500 -- (-775.462) [-775.754] (-773.515) (-777.944) * (-776.415) (-775.486) (-778.237) [-780.158] -- 0:00:00
999000 -- [-775.713] (-777.963) (-775.250) (-774.706) * (-779.982) [-778.435] (-776.927) (-777.075) -- 0:00:00
999500 -- (-780.209) (-781.072) [-774.651] (-776.024) * [-781.211] (-777.358) (-776.290) (-780.679) -- 0:00:00
1000000 -- (-776.052) (-775.640) [-776.957] (-776.898) * (-774.738) [-776.185] (-778.557) (-776.761) -- 0:00:00
Average standard deviation of split frequencies: 0.005008
Analysis completed in 1 mins 7 seconds
Analysis used 65.99 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -770.47
Likelihood of best state for "cold" chain of run 2 was -770.47
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.6 % ( 65 %) Dirichlet(Revmat{all})
98.7 % (100 %) Slider(Revmat{all})
30.3 % ( 29 %) Dirichlet(Pi{all})
31.7 % ( 19 %) Slider(Pi{all})
71.5 % ( 44 %) Multiplier(Alpha{1,2})
79.3 % ( 54 %) Multiplier(Alpha{3})
27.1 % ( 31 %) Slider(Pinvar{all})
90.2 % ( 95 %) ExtSPR(Tau{all},V{all})
61.8 % ( 65 %) ExtTBR(Tau{all},V{all})
90.0 % ( 89 %) NNI(Tau{all},V{all})
79.4 % ( 86 %) ParsSPR(Tau{all},V{all})
28.1 % ( 18 %) Multiplier(V{all})
93.7 % ( 95 %) Nodeslider(V{all})
30.6 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 74 %) Dirichlet(Revmat{all})
98.7 % (100 %) Slider(Revmat{all})
30.0 % ( 25 %) Dirichlet(Pi{all})
32.2 % ( 29 %) Slider(Pi{all})
70.8 % ( 42 %) Multiplier(Alpha{1,2})
79.3 % ( 63 %) Multiplier(Alpha{3})
26.1 % ( 25 %) Slider(Pinvar{all})
90.1 % ( 94 %) ExtSPR(Tau{all},V{all})
61.5 % ( 62 %) ExtTBR(Tau{all},V{all})
89.8 % ( 87 %) NNI(Tau{all},V{all})
79.0 % ( 84 %) ParsSPR(Tau{all},V{all})
28.1 % ( 22 %) Multiplier(V{all})
93.6 % ( 94 %) Nodeslider(V{all})
30.5 % ( 33 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.62 0.49
2 | 166925 0.82 0.66
3 | 166356 166965 0.83
4 | 166317 166182 167255
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.62 0.48
2 | 166905 0.82 0.66
3 | 166687 166675 0.83
4 | 167027 166057 166649
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -774.87
| 1 |
| |
| 1 1 2 1 |
| 2 2 |
| 1 1 1 2 22 1 1 |
|2 1 2 2 11 1 1 11 2 * 12 * 1 1 1|
| 1 *2 2 2 * *1 1 2 2 2 2 1 1 2 2 |
| 1 12 21 2 2 1 2 1 1 2 2 * * |
|1 12* 2 1 2 221221 2 1 2 2 |
| 2 1 1 22 11 22 1 1 1 12|
| 2 2 1 1 2 2 |
| 2 1 2 2 1 1 |
| 1 2 |
| |
| 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -777.13
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -774.75 -778.73
2 -774.79 -779.57
--------------------------------------
TOTAL -774.77 -779.24
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.879773 0.085655 0.364706 1.476927 0.845244 1252.48 1315.97 1.000
r(A<->C){all} 0.215161 0.027339 0.000178 0.549487 0.178947 92.43 117.93 1.000
r(A<->G){all} 0.158514 0.017693 0.000034 0.422680 0.121409 76.54 109.17 1.007
r(A<->T){all} 0.159559 0.018818 0.000184 0.440421 0.121461 120.03 211.53 1.000
r(C<->G){all} 0.147746 0.018187 0.000073 0.433683 0.107325 134.46 171.31 1.000
r(C<->T){all} 0.156657 0.018824 0.000048 0.431481 0.118020 300.04 329.18 1.001
r(G<->T){all} 0.162363 0.018986 0.000091 0.437445 0.123311 158.57 169.16 1.000
pi(A){all} 0.237426 0.000329 0.201026 0.270441 0.237503 1087.71 1253.96 1.000
pi(C){all} 0.270127 0.000351 0.234164 0.305977 0.269659 1360.34 1365.13 1.000
pi(G){all} 0.288938 0.000368 0.252900 0.327061 0.288708 1187.18 1229.39 1.001
pi(T){all} 0.203508 0.000279 0.172473 0.236869 0.203391 1314.10 1335.52 1.000
alpha{1,2} 0.398773 0.210979 0.000265 1.351137 0.238669 1105.59 1303.29 1.000
alpha{3} 0.410201 0.229376 0.000204 1.357471 0.244667 941.52 1022.18 1.000
pinvar{all} 0.994047 0.000028 0.984409 0.999921 0.995508 1472.70 1486.85 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*..*.
8 -- .**.**
9 -- .*.***
10 -- ..*..*
11 -- ...*.*
12 -- ..**..
13 -- .****.
14 -- ..**.*
15 -- .*..**
16 -- .*...*
17 -- .***.*
18 -- .**.*.
19 -- ....**
20 -- .*.**.
21 -- .**...
22 -- ...**.
23 -- .*.*..
24 -- ..*.*.
25 -- ..****
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 977 0.325450 0.008951 0.319121 0.331779 2
8 495 0.164890 0.005182 0.161226 0.168554 2
9 491 0.163558 0.003298 0.161226 0.165889 2
10 480 0.159893 0.000000 0.159893 0.159893 2
11 479 0.159560 0.003298 0.157229 0.161892 2
12 476 0.158561 0.004711 0.155230 0.161892 2
13 448 0.149234 0.007537 0.143904 0.154564 2
14 358 0.119254 0.004711 0.115923 0.122585 2
15 355 0.118254 0.007066 0.113258 0.123251 2
16 351 0.116922 0.008951 0.110593 0.123251 2
17 349 0.116256 0.008009 0.110593 0.121919 2
18 341 0.113591 0.004240 0.110593 0.116589 2
19 339 0.112925 0.000471 0.112592 0.113258 2
20 338 0.112592 0.003769 0.109927 0.115256 2
21 336 0.111925 0.011306 0.103931 0.119920 2
22 326 0.108594 0.001884 0.107262 0.109927 2
23 312 0.103931 0.004711 0.100600 0.107262 2
24 311 0.103598 0.002355 0.101932 0.105263 2
25 310 0.103264 0.004711 0.099933 0.106596 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.095173 0.009657 0.000031 0.299325 0.063900 1.000 2
length{all}[2] 0.097425 0.009246 0.000080 0.280840 0.068899 1.000 2
length{all}[3] 0.095235 0.009276 0.000006 0.285125 0.065525 1.000 2
length{all}[4] 0.095805 0.009686 0.000002 0.287114 0.065568 1.000 2
length{all}[5] 0.101542 0.010526 0.000029 0.306686 0.069570 1.000 2
length{all}[6] 0.092249 0.009067 0.000121 0.276790 0.063605 1.000 2
length{all}[7] 0.140766 0.014350 0.000049 0.375526 0.111187 0.999 2
length{all}[8] 0.087431 0.007430 0.000246 0.236593 0.065658 0.998 2
length{all}[9] 0.099204 0.007809 0.000532 0.277402 0.073376 1.008 2
length{all}[10] 0.087619 0.007076 0.000035 0.253637 0.061651 0.999 2
length{all}[11] 0.096085 0.008021 0.000013 0.265809 0.070808 0.998 2
length{all}[12] 0.096899 0.008075 0.000489 0.276028 0.075676 0.998 2
length{all}[13] 0.094840 0.009075 0.000036 0.289821 0.067965 0.999 2
length{all}[14] 0.097291 0.009027 0.000150 0.266224 0.068849 0.999 2
length{all}[15] 0.091577 0.007790 0.000050 0.278648 0.065498 0.998 2
length{all}[16] 0.098031 0.010731 0.000280 0.305042 0.065716 1.002 2
length{all}[17] 0.094812 0.009428 0.000002 0.305645 0.064149 0.997 2
length{all}[18] 0.107225 0.010746 0.000067 0.300761 0.075147 0.997 2
length{all}[19] 0.085860 0.007171 0.000157 0.274280 0.057236 0.999 2
length{all}[20] 0.097283 0.008677 0.000266 0.293243 0.064164 0.997 2
length{all}[21] 0.098015 0.009197 0.000157 0.266645 0.071973 0.997 2
length{all}[22] 0.101809 0.011438 0.000324 0.302042 0.065932 0.997 2
length{all}[23] 0.087094 0.007423 0.000473 0.235005 0.060109 0.997 2
length{all}[24] 0.100101 0.008724 0.000251 0.285208 0.075281 0.997 2
length{all}[25] 0.094188 0.009467 0.000090 0.280890 0.066305 1.007 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005008
Maximum standard deviation of split frequencies = 0.011306
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------ C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|-------------------------------------------------------------------- C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 32 trees
90 % credible set contains 86 trees
95 % credible set contains 95 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 552
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 53 patterns at 184 / 184 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 53 patterns at 184 / 184 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
51728 bytes for conP
4664 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.107558 0.072869 0.095137 0.032466 0.048205 0.102525 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -827.406906
Iterating by ming2
Initial: fx= 827.406906
x= 0.10756 0.07287 0.09514 0.03247 0.04821 0.10253 0.30000 1.30000
1 h-m-p 0.0000 0.0002 427.7980 +++ 795.027684 m 0.0002 14 | 1/8
2 h-m-p 0.0000 0.0001 1545.4317 ++ 756.711935 m 0.0001 25 | 2/8
3 h-m-p 0.0000 0.0000 1606.7592 ++ 753.889564 m 0.0000 36 | 3/8
4 h-m-p 0.0000 0.0000 1547.4364 ++ 752.912209 m 0.0000 47 | 4/8
5 h-m-p 0.0003 0.0631 1.1651 +++CYCYC 750.974770 4 0.0486 68 | 4/8
6 h-m-p 0.0580 0.2899 0.8950 ++ 750.735328 m 0.2899 79 | 5/8
7 h-m-p 0.1586 8.0000 0.4720 +CYC 750.693155 2 0.8092 98 | 5/8
8 h-m-p 0.8032 8.0000 0.4755 +YCC 750.577311 2 2.2507 116 | 5/8
9 h-m-p 1.6000 8.0000 0.4041 YCCC 750.526217 3 3.2165 135 | 5/8
10 h-m-p 1.6000 8.0000 0.6379 YCCC 750.482971 3 2.9971 154 | 5/8
11 h-m-p 1.6000 8.0000 0.8683 YCCC 750.455704 3 3.7302 173 | 5/8
12 h-m-p 1.6000 8.0000 1.4633 YCC 750.436398 2 2.8525 190 | 5/8
13 h-m-p 1.6000 8.0000 1.9521 YC 750.423715 1 3.8058 202 | 5/8
14 h-m-p 1.6000 8.0000 3.0676 YC 750.415352 1 2.7508 214 | 5/8
15 h-m-p 1.6000 8.0000 4.3551 +YC 750.409126 1 4.2786 227 | 5/8
16 h-m-p 1.6000 8.0000 6.8067 CC 750.405561 1 2.4918 240 | 5/8
17 h-m-p 1.6000 8.0000 9.3408 +YC 750.402624 1 4.8789 253 | 5/8
18 h-m-p 1.6000 8.0000 15.5131 CC 750.401101 1 2.2879 266 | 5/8
19 h-m-p 1.6000 8.0000 20.4481 +CC 750.399747 1 5.3823 280 | 5/8
20 h-m-p 1.6000 8.0000 35.8692 CC 750.399098 1 2.1894 293 | 5/8
21 h-m-p 1.6000 8.0000 46.0130 +C 750.398495 0 5.8792 305 | 5/8
22 h-m-p 0.9861 4.9306 79.8885 YC 750.398221 1 2.0408 317 | 5/8
23 h-m-p 0.4528 2.2642 101.9589 ++ 750.398051 m 2.2642 328 | 6/8
24 h-m-p 1.6000 8.0000 0.0000 Y 750.398051 0 1.0575 339 | 6/8
25 h-m-p 1.6000 8.0000 0.0000 C 750.398051 0 0.4629 352
Out..
lnL = -750.398051
353 lfun, 353 eigenQcodon, 2118 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.025443 0.019504 0.031766 0.041247 0.097982 0.056537 0.000100 0.751712 0.485341
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 13.193973
np = 9
lnL0 = -793.696500
Iterating by ming2
Initial: fx= 793.696500
x= 0.02544 0.01950 0.03177 0.04125 0.09798 0.05654 0.00011 0.75171 0.48534
1 h-m-p 0.0000 0.0000 411.3132 ++ 793.096649 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0000 9760.2297 ++ 771.040269 m 0.0000 26 | 2/9
3 h-m-p 0.0000 0.0000 2027.8039 ++ 765.660880 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0001 236.3629 ++ 761.487667 m 0.0001 50 | 4/9
5 h-m-p 0.0000 0.0000 5851.5927 ++ 757.119560 m 0.0000 62 | 5/9
6 h-m-p 0.0013 0.0104 13.4010 +CYYCYYCCC 753.513391 8 0.0087 87 | 5/9
7 h-m-p 0.0135 0.0673 2.9243 +YYCYCC 752.430675 5 0.0461 107 | 5/9
8 h-m-p 0.0246 0.1231 1.6661 +YYYCCC 750.978512 5 0.0902 127 | 5/9
9 h-m-p 0.6720 3.3598 0.1867 CC 750.886225 1 0.6720 141 | 5/9
10 h-m-p 0.2658 1.3288 0.1711 YCCC 750.859204 3 0.4985 162 | 5/9
11 h-m-p 0.1916 0.9580 0.1227 ++ 750.843581 m 0.9580 178 | 6/9
12 h-m-p 1.6000 8.0000 0.0031 YC 750.842892 1 0.9030 195 | 6/9
13 h-m-p 1.6000 8.0000 0.0007 C 750.842868 0 1.6699 210 | 6/9
14 h-m-p 1.6000 8.0000 0.0000 -Y 750.842868 0 0.0714 226 | 6/9
15 h-m-p 0.0732 8.0000 0.0000 Y 750.842868 0 0.0140 241 | 6/9
16 h-m-p 0.0160 8.0000 0.0000 ---Y 750.842868 0 0.0000 259
Out..
lnL = -750.842868
260 lfun, 780 eigenQcodon, 3120 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.028069 0.038707 0.105324 0.040073 0.050080 0.083700 0.000100 1.518396 0.560737 0.193359 1103.108795
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.087831
np = 11
lnL0 = -767.163749
Iterating by ming2
Initial: fx= 767.163749
x= 0.02807 0.03871 0.10532 0.04007 0.05008 0.08370 0.00011 1.51840 0.56074 0.19336 951.42857
1 h-m-p 0.0000 0.0000 46.7572 ++ 767.156490 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0021 50.3114 ++++ 764.663847 m 0.0021 32 | 2/11
3 h-m-p 0.0003 0.0013 28.6850 ++ 763.455910 m 0.0013 46 | 3/11
4 h-m-p 0.0002 0.0016 162.5726 ++ 759.018198 m 0.0016 60 | 4/11
5 h-m-p 0.0001 0.0003 170.6849 ++ 758.001271 m 0.0003 74 | 5/11
6 h-m-p 0.0023 0.0117 22.0803 +YYYYYCYCYC 755.744318 9 0.0097 100 | 5/11
7 h-m-p 0.0415 0.2073 3.2915 +YYCYYYCYCY 748.663029 10 0.1939 128 | 5/11
8 h-m-p 0.0072 0.0360 1.9752 YCYCCC 748.448821 5 0.0172 150 | 5/11
9 h-m-p 0.0107 0.0614 3.1824 +YYYYYCYCCC 747.403734 10 0.0455 178 | 5/11
10 h-m-p 0.3031 2.6081 0.4773 ++ 746.895228 m 2.6081 192 | 6/11
11 h-m-p 0.2985 8.0000 4.1487 CCCC 745.448674 3 0.3487 218 | 6/11
12 h-m-p 1.6000 8.0000 0.0492 ++ 745.289085 m 8.0000 232 | 6/11
13 h-m-p 0.0698 0.3491 2.4923 YCYCCC 745.040346 5 0.1983 260 | 6/11
14 h-m-p 0.4780 2.3901 0.2885 CYCCC 744.986232 4 0.7525 281 | 6/11
15 h-m-p 1.6000 8.0000 0.0824 CCC 744.950583 2 0.4098 304 | 6/11
16 h-m-p 0.8611 8.0000 0.0392 CC 744.949170 1 0.9692 325 | 6/11
17 h-m-p 1.6000 8.0000 0.0040 C 744.949144 0 2.5362 344 | 6/11
18 h-m-p 1.6000 8.0000 0.0013 C 744.949140 0 1.4363 363 | 6/11
19 h-m-p 1.6000 8.0000 0.0004 C 744.949140 0 2.2356 382 | 6/11
20 h-m-p 1.5903 8.0000 0.0005 ++ 744.949138 m 8.0000 401 | 6/11
21 h-m-p 0.0160 8.0000 2.2912 +++++ 744.946852 m 8.0000 423 | 6/11
22 h-m-p 1.1193 5.5964 7.6306 +C 744.942997 0 4.5499 438 | 6/11
23 h-m-p 0.0586 0.2928 27.2174 ++ 744.941950 m 0.2928 452 | 7/11
24 h-m-p 0.6710 7.8637 7.4316 CC 744.940678 1 1.0512 468 | 7/11
25 h-m-p 1.0468 6.7841 7.4626 C 744.940674 0 0.8526 482 | 7/11
26 h-m-p 1.6000 8.0000 0.1008 Y 744.940674 0 1.0225 496 | 7/11
27 h-m-p 1.5892 8.0000 0.0648 C 744.940674 0 0.4406 514 | 7/11
28 h-m-p 0.5301 8.0000 0.0539 C 744.940674 0 0.5301 532 | 7/11
29 h-m-p 0.7976 8.0000 0.0358 Y 744.940674 0 0.1405 550 | 7/11
30 h-m-p 0.1626 8.0000 0.0309 C 744.940674 0 0.0406 568 | 7/11
31 h-m-p 0.0424 8.0000 0.0297 ------Y 744.940674 0 0.0000 592 | 7/11
32 h-m-p 0.0160 8.0000 0.2228 C 744.940674 0 0.0160 610 | 7/11
33 h-m-p 0.1537 8.0000 0.0232 ----C 744.940674 0 0.0002 632 | 7/11
34 h-m-p 0.0160 8.0000 0.0243 C 744.940674 0 0.0040 650 | 7/11
35 h-m-p 0.0160 8.0000 0.0247 ----------N 744.940674 0 0.0000 678 | 7/11
36 h-m-p 0.0160 8.0000 0.0184 ++Y 744.940674 0 0.4767 698 | 7/11
37 h-m-p 1.6000 8.0000 0.0034 --Y 744.940674 0 0.0182 718 | 7/11
38 h-m-p 0.0160 8.0000 0.0040 ---Y 744.940674 0 0.0001 739 | 7/11
39 h-m-p 0.0160 8.0000 0.0046 ------C 744.940674 0 0.0000 763 | 7/11
40 h-m-p 0.0160 8.0000 0.0012 ---------C 744.940674 0 0.0000 790 | 7/11
41 h-m-p 0.0160 8.0000 0.0014 -------C 744.940674 0 0.0000 815 | 7/11
42 h-m-p 0.0160 8.0000 0.0006 ------------- | 7/11
43 h-m-p 0.0160 8.0000 0.0006 -------------
Out..
lnL = -744.940674
874 lfun, 3496 eigenQcodon, 15732 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -750.240807 S = -746.156365 -5.281697
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:05
did 20 / 53 patterns 0:05
did 30 / 53 patterns 0:05
did 40 / 53 patterns 0:05
did 50 / 53 patterns 0:05
did 53 / 53 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.054127 0.087564 0.095180 0.022227 0.085999 0.055355 0.000100 0.633486 1.477352
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 20.675805
np = 9
lnL0 = -812.140879
Iterating by ming2
Initial: fx= 812.140879
x= 0.05413 0.08756 0.09518 0.02223 0.08600 0.05536 0.00011 0.63349 1.47735
1 h-m-p 0.0000 0.0000 387.7106 ++ 811.944382 m 0.0000 23 | 1/9
2 h-m-p 0.0000 0.0013 112.3348 ++++ 804.880062 m 0.0013 46 | 1/9
3 h-m-p 0.0000 0.0000 217.7174
h-m-p: 3.22872749e-18 1.61436375e-17 2.17717393e+02 804.880062
.. | 1/9
4 h-m-p 0.0000 0.0000 5836.8509 YCYYCCC 801.297690 6 0.0000 93 | 1/9
5 h-m-p 0.0000 0.0002 329.9062 ++ 775.832380 m 0.0002 113 | 2/9
6 h-m-p 0.0000 0.0000 94402.2953 ++ 759.920663 m 0.0000 133 | 3/9
7 h-m-p 0.0000 0.0000 4852.2718 ++ 759.523391 m 0.0000 152 | 4/9
8 h-m-p 0.0000 0.0001 487.6509 ++ 753.197131 m 0.0001 170 | 5/9
9 h-m-p 0.0068 0.3673 0.9840 ++CYCYC 751.266338 4 0.2795 196 | 5/9
10 h-m-p 0.1268 0.6340 1.1642 CCCC 751.097807 3 0.2020 218 | 5/9
11 h-m-p 0.4085 2.8279 0.5756 CCYC 750.978518 3 0.4131 239 | 5/9
12 h-m-p 0.5992 2.9960 0.3672 +YYCC 750.815596 3 2.0573 260 | 5/9
13 h-m-p 0.4570 2.2850 0.1629 YCCC 750.797303 3 0.9839 281 | 5/9
14 h-m-p 1.1562 7.1931 0.1386 CYC 750.783167 2 1.0411 300 | 5/9
15 h-m-p 0.5901 2.9503 0.1616 +YYYYCCC 750.676738 6 2.2492 325 | 5/9
16 h-m-p 0.0119 0.0595 1.9980 YCC 750.675306 2 0.0069 344 | 5/9
17 h-m-p 0.0851 1.5753 0.1620 +YCYCYC 750.536549 5 1.1494 369 | 5/9
18 h-m-p 0.0053 0.0263 3.3954 CYY 750.529147 2 0.0050 388 | 5/9
19 h-m-p 0.0397 0.2451 0.4275 ++ 750.407873 m 0.2451 404 | 6/9
20 h-m-p 1.6000 8.0000 0.0003 YC 750.405903 1 1.1819 421 | 6/9
21 h-m-p 1.2537 8.0000 0.0003 C 750.405894 0 1.2537 436 | 6/9
22 h-m-p 1.6000 8.0000 0.0001 Y 750.405893 0 3.6562 451 | 6/9
23 h-m-p 1.6000 8.0000 0.0001 C 750.405893 0 1.3721 466 | 6/9
24 h-m-p 1.6000 8.0000 0.0000 Y 750.405893 0 0.9413 481 | 6/9
25 h-m-p 1.6000 8.0000 0.0000 C 750.405893 0 0.4000 496 | 6/9
26 h-m-p 0.6694 8.0000 0.0000 --C 750.405893 0 0.0105 513 | 6/9
27 h-m-p 0.0160 8.0000 0.0000 -Y 750.405893 0 0.0010 529 | 6/9
28 h-m-p 0.0160 8.0000 0.0000 -----------N 750.405893 0 0.0000 555
Out..
lnL = -750.405893
556 lfun, 6116 eigenQcodon, 33360 P(t)
Time used: 0:14
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.030403 0.049390 0.034962 0.041662 0.074656 0.107110 0.000100 0.900000 0.441934 1.151157 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.119972
np = 11
lnL0 = -761.188139
Iterating by ming2
Initial: fx= 761.188139
x= 0.03040 0.04939 0.03496 0.04166 0.07466 0.10711 0.00011 0.90000 0.44193 1.15116 951.42857
1 h-m-p 0.0000 0.0000 149.4352 ++ 761.097893 m 0.0000 27 | 1/11
2 h-m-p 0.0000 0.0001 853.4298 ++ 752.299341 m 0.0001 52 | 2/11
3 h-m-p 0.0001 0.0003 22.8762 ++ 752.024451 m 0.0003 76 | 3/11
4 h-m-p 0.0001 0.0005 114.1655 +YCYYCCC 750.947925 6 0.0003 109 | 3/11
5 h-m-p 0.0003 0.0017 39.9955 +YYCYCC 749.652245 5 0.0011 139 | 3/11
6 h-m-p 0.0003 0.0013 52.3998 ++ 747.643528 m 0.0013 161 | 4/11
7 h-m-p 0.0036 0.0178 2.3164 ++ 745.929454 m 0.0178 183 | 5/11
8 h-m-p 0.0147 0.4217 1.1168 +YCCC 745.848346 3 0.1274 210 | 5/11
9 h-m-p 0.0255 0.1275 2.5525 ++ 745.560192 m 0.1275 230 | 6/11
10 h-m-p 0.8898 8.0000 0.1288 YCC 745.546987 2 0.5635 253 | 6/11
11 h-m-p 0.7882 8.0000 0.0921 ----------------.. | 6/11
12 h-m-p 0.0000 0.0023 30.9524 +CYC 745.521900 2 0.0001 309 | 6/11
13 h-m-p 0.0001 0.0015 31.9127 ++YYYYCYCYC 745.020948 8 0.0010 340 | 6/11
14 h-m-p 0.0015 0.0075 3.1742 YC 745.020016 1 0.0002 360 | 6/11
15 h-m-p 0.1479 3.5653 0.0041 +CYCCC 744.950313 4 1.0614 387 | 6/11
16 h-m-p 0.8119 8.0000 0.0053 YCC 744.948800 2 0.1458 409 | 6/11
17 h-m-p 1.6000 8.0000 0.0002 YC 744.948750 1 0.6583 429 | 6/11
18 h-m-p 0.8399 8.0000 0.0002 C 744.948750 0 0.8901 448 | 6/11
19 h-m-p 0.9633 8.0000 0.0002 C 744.948750 0 0.9247 467 | 6/11
20 h-m-p 0.2730 8.0000 0.0006 +C 744.948750 0 1.6457 487 | 6/11
21 h-m-p 0.6108 8.0000 0.0015 +Y 744.948749 0 4.4681 507 | 6/11
22 h-m-p 0.9988 8.0000 0.0069 ++ 744.948743 m 8.0000 526 | 6/11
23 h-m-p 0.2139 8.0000 0.2571 ++C 744.948690 0 3.0451 547 | 6/11
24 h-m-p 1.6000 8.0000 0.4208 ++ 744.948108 m 8.0000 566 | 6/11
25 h-m-p 0.0071 0.0919 471.8579 ++ 744.940808 m 0.0919 585 | 7/11
26 h-m-p 0.2203 1.1015 1.6171 YC 744.940721 1 0.4367 605 | 7/11
27 h-m-p 1.6000 8.0000 0.0985 YC 744.940675 1 0.8190 624 | 7/11
28 h-m-p 1.6000 8.0000 0.0025 Y 744.940675 0 0.8357 642 | 7/11
29 h-m-p 0.3069 8.0000 0.0067 Y 744.940675 0 0.5278 660 | 7/11
30 h-m-p 0.2250 8.0000 0.0157 +Y 744.940675 0 0.7555 679 | 7/11
31 h-m-p 0.3876 8.0000 0.0306 +Y 744.940675 0 1.2966 698 | 7/11
32 h-m-p 0.6884 8.0000 0.0576 +C 744.940675 0 3.2178 717 | 7/11
33 h-m-p 1.6000 8.0000 0.1115 +
QuantileBeta(0.15, 0.00500, 2.29122) = 1.134853e-160 2000 rounds
+ 744.940674 m 8.0000 735
QuantileBeta(0.15, 0.00500, 2.29122) = 1.134853e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29122) = 1.134853e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29122) = 1.134853e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29122) = 1.134853e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29122) = 1.134853e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29122) = 1.134853e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29122) = 1.134853e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29122) = 1.134853e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29122) = 1.134853e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29122) = 1.134853e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29122) = 1.134853e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29122) = 1.174471e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29134) = 1.134776e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29109) = 1.134930e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29122) = 1.134853e-160 2000 rounds
| 7/11
34 h-m-p 1.6000 8.0000 0.2984
QuantileBeta(0.15, 0.00500, 2.76871) = 9.003126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.20121) = 5.547674e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.67871) = 4.917270e-161 2000 rounds
+ 744.940673 m 8.0000 753
QuantileBeta(0.15, 0.00500, 4.67871) = 4.917270e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.67871) = 4.917270e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.67871) = 4.917270e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.67871) = 4.917270e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.67871) = 4.917270e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.67871) = 4.917270e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.67871) = 4.917270e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.67871) = 4.917270e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.67871) = 4.917270e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.67871) = 4.917270e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.67871) = 4.917270e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.67871) = 5.088930e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.67888) = 4.917060e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.67853) = 4.917480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.67871) = 4.917270e-161 2000 rounds
| 7/11
35 h-m-p 1.6000 8.0000 0.4654
QuantileBeta(0.15, 0.00500, 5.42333) = 4.176672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.65721) = 2.876094e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.30143) = 4.282284e-161 2000 rounds
C 744.940673 0 1.3381 771
QuantileBeta(0.15, 0.00500, 5.30143) = 4.282284e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.30143) = 4.282284e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.30143) = 4.282284e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.30143) = 4.282284e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.30143) = 4.282284e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.30143) = 4.282284e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.30143) = 4.282284e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.30143) = 4.282284e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.30143) = 4.282284e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.30143) = 4.282284e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.30143) = 4.282284e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.30143) = 4.431777e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.30162) = 4.282113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.30124) = 4.282455e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.30143) = 4.282284e-161 2000 rounds
| 7/11
36 h-m-p 1.0011 8.0000 0.6221
QuantileBeta(0.15, 0.00500, 5.92416) = 3.792340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79233) = 2.822904e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.72371) = 3.306451e-161 2000 rounds
Y 744.940673 0 2.2864 789
QuantileBeta(0.15, 0.00500, 6.72371) = 3.306451e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.72371) = 3.306451e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.72371) = 3.306451e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.72371) = 3.306451e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.72371) = 3.306451e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.72371) = 3.306451e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.72371) = 3.306451e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.72371) = 3.306451e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.72371) = 3.306451e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.72371) = 3.306451e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.72371) = 3.306451e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.72371) = 3.421878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.72393) = 3.306335e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.72349) = 3.306568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.72371) = 3.306451e-161 2000 rounds
| 7/11
37 h-m-p 1.0536 8.0000 1.3500
QuantileBeta(0.15, 0.00500, 8.14599) = 2.692567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.41282) = 1.729090e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 17.52353) = 1.210249e-161 2000 rounds
+ 744.940673 m 8.0000 807
QuantileBeta(0.15, 0.00500, 17.52353) = 1.210249e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.52353) = 1.210249e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.52353) = 1.210249e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.52353) = 1.210249e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.52353) = 1.210249e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.52353) = 1.210249e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.52353) = 1.210249e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.52353) = 1.210249e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.52353) = 1.210249e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.52353) = 1.210249e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.52353) = 1.210249e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.52353) = 1.252498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.52392) = 1.210221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.52313) = 1.210277e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.52353) = 1.210249e-161 2000 rounds
| 7/11
38 h-m-p 1.6000 8.0000 0.8837
QuantileBeta(0.15, 0.00500, 18.93746) = 1.117474e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 23.17925) = 9.085288e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 18.89643) = 1.119965e-161 2000 rounds
C 744.940673 0 1.5536 825
QuantileBeta(0.15, 0.00500, 18.89643) = 1.119965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.89643) = 1.119965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.89643) = 1.119965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.89643) = 1.119965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.89643) = 1.119965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.89643) = 1.119965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.89643) = 1.119965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.89643) = 1.119965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.89643) = 1.119965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.89643) = 1.119965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.89643) = 1.119965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.89643) = 1.159063e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.89685) = 1.119940e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.89602) = 1.119990e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.89643) = 1.119965e-161 2000 rounds
| 7/11
39 h-m-p 1.0686 8.0000 1.2848
QuantileBeta(0.15, 0.00500, 20.26934) = 1.042215e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 24.38805) = 8.625666e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 29.17466) = 7.186085e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.00202) = 9.156827e-162 2000 rounds
Y 744.940673 0 3.1956 844
QuantileBeta(0.15, 0.00500, 23.00202) = 9.156827e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.00202) = 9.156827e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.00202) = 9.156827e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.00202) = 9.156827e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.00202) = 9.156827e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.00202) = 9.156827e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.00202) = 9.156827e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.00202) = 9.156827e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.00202) = 9.156827e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.00202) = 9.156827e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.00202) = 9.156827e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.00202) = 9.476489e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.00249) = 9.156635e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.00155) = 9.157018e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 23.00202) = 9.156827e-162 2000 rounds
| 7/11
40 h-m-p 0.7043 8.0000 5.8294
QuantileBeta(0.15, 0.00500, 27.10761) = 7.744231e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 39.42437) = 4.265149e-162 2000 rounds
++ 744.940673 m 8.0000 862 | 7/11
41 h-m-p 1.2081 6.0403 4.8612 Y 744.940673 0 2.6856 880 | 7/11
42 h-m-p 1.6000 8.0000 1.1788 -Y 744.940673 0 0.1675 899 | 7/11
43 h-m-p 0.0093 0.7741 21.3207 +C 744.940673 0 0.0572 918 | 7/11
44 h-m-p 0.9554 8.0000 1.2759 ------Y 744.940673 0 0.0001 942 | 7/11
45 h-m-p 0.0160 8.0000 0.0357 ------Y 744.940673 0 0.0000 966 | 7/11
46 h-m-p 0.0160 8.0000 0.4358 --Y 744.940673 0 0.0002 986 | 7/11
47 h-m-p 0.1414 8.0000 0.0006 --Y 744.940673 0 0.0022 1006 | 7/11
48 h-m-p 0.0160 8.0000 0.0006 ---Y 744.940673 0 0.0001 1027
Out..
lnL = -744.940673
1028 lfun, 12336 eigenQcodon, 67848 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -750.318915 S = -746.156531 -4.822727
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:35
did 20 / 53 patterns 0:35
did 30 / 53 patterns 0:35
did 40 / 53 patterns 0:35
did 50 / 53 patterns 0:35
did 53 / 53 patterns 0:35
Time used: 0:35
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=184
NC_011896_1_WP_012634449_1_2779_MLBR_RS13225 MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
NC_002677_1_NP_302664_1_1536_ML2597 MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
NZ_LVXE01000045_1_WP_012634449_1_1928_A3216_RS10875 MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
NZ_LYPH01000051_1_WP_012634449_1_1947_A8144_RS09305 MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
NZ_CP029543_1_WP_010908983_1_2808_DIJ64_RS14295 MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
NZ_AP014567_1_WP_012634449_1_2876_JK2ML_RS14635 MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS
**************************************************
NC_011896_1_WP_012634449_1_2779_MLBR_RS13225 ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
NC_002677_1_NP_302664_1_1536_ML2597 ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
NZ_LVXE01000045_1_WP_012634449_1_1928_A3216_RS10875 ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
NZ_LYPH01000051_1_WP_012634449_1_1947_A8144_RS09305 ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
NZ_CP029543_1_WP_010908983_1_2808_DIJ64_RS14295 ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
NZ_AP014567_1_WP_012634449_1_2876_JK2ML_RS14635 ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF
**************************************************
NC_011896_1_WP_012634449_1_2779_MLBR_RS13225 AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
NC_002677_1_NP_302664_1_1536_ML2597 AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
NZ_LVXE01000045_1_WP_012634449_1_1928_A3216_RS10875 AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
NZ_LYPH01000051_1_WP_012634449_1_1947_A8144_RS09305 AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
NZ_CP029543_1_WP_010908983_1_2808_DIJ64_RS14295 AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
NZ_AP014567_1_WP_012634449_1_2876_JK2ML_RS14635 AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK
**************************************************
NC_011896_1_WP_012634449_1_2779_MLBR_RS13225 SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
NC_002677_1_NP_302664_1_1536_ML2597 YPDEKQVLENTNRWTATATREGNQWKISNLLQVI
NZ_LVXE01000045_1_WP_012634449_1_1928_A3216_RS10875 SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
NZ_LYPH01000051_1_WP_012634449_1_1947_A8144_RS09305 SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
NZ_CP029543_1_WP_010908983_1_2808_DIJ64_RS14295 YPDEKQVLENTNRWTATATREGNQWKISNLLQVI
NZ_AP014567_1_WP_012634449_1_2876_JK2ML_RS14635 SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
*********************************
>NC_011896_1_WP_012634449_1_2779_MLBR_RS13225 ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG TCTCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA TC >NC_002677_1_NP_302664_1_1536_ML2597 ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG TATCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA TC >NZ_LVXE01000045_1_WP_012634449_1_1928_A3216_RS10875 ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG TCTCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA TC >NZ_LYPH01000051_1_WP_012634449_1_1947_A8144_RS09305 ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG TCTCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA TC >NZ_CP029543_1_WP_010908983_1_2808_DIJ64_RS14295 ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG TATCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA TC >NZ_AP014567_1_WP_012634449_1_2876_JK2ML_RS14635 ATGAGTCCCCGCCGCAAGTTTCAAGCCGGCGAGGGATTACTGCTTGTCTC GCACACGGTGGCGTCGCAGCGACGATGGGGGTTACCGCTTGCTGCTACGT TTGCCGCGTTGGTCATGGTAGCGGCAATCACGGCATCCACCTTGATGTCG ATCTCCCATGCATCCCGTGAACTTGCTGTGGCAAAAGACCAGCAGGTGCT CAGCTACGTGAAATGGTTCATGACGCAGTTCACGACCCTTGATCCGTATC ACGCTAATGACTATGTAGCGCGGATATTGGCGCAAGCGACCGGTGACTTC GCTAAGCAGTACAACGAGAAGGTGAACGAGATCCTCCTCCAGGTCGCTCA AGCTGAACCTGCCACTGGCACCGTGCTCGACGCCGGTGTGGAAAGGTGGA ACGACGATGGCAGCGCCAATGTGTTGGTGGCCACTGAAGTCACCTCCAAG TCTCCGGATGAAAAACAGGTGTTAGAGAACACAAATCGTTGGACAGCAAC CGCGACTCGGGAAGGCAATCAGTGGAAGATCAGCAACCTGTTGCAGGTGA TC
>NC_011896_1_WP_012634449_1_2779_MLBR_RS13225 MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK SPDEKQVLENTNRWTATATREGNQWKISNLLQVI >NC_002677_1_NP_302664_1_1536_ML2597 MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK YPDEKQVLENTNRWTATATREGNQWKISNLLQVI >NZ_LVXE01000045_1_WP_012634449_1_1928_A3216_RS10875 MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK SPDEKQVLENTNRWTATATREGNQWKISNLLQVI >NZ_LYPH01000051_1_WP_012634449_1_1947_A8144_RS09305 MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK SPDEKQVLENTNRWTATATREGNQWKISNLLQVI >NZ_CP029543_1_WP_010908983_1_2808_DIJ64_RS14295 MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK YPDEKQVLENTNRWTATATREGNQWKISNLLQVI >NZ_AP014567_1_WP_012634449_1_2876_JK2ML_RS14635 MSPRRKFQAGEGLLLVSHTVASQRRWGLPLAATFAALVMVAAITASTLMS ISHASRELAVAKDQQVLSYVKWFMTQFTTLDPYHANDYVARILAQATGDF AKQYNEKVNEILLQVAQAEPATGTVLDAGVERWNDDGSANVLVATEVTSK SPDEKQVLENTNRWTATATREGNQWKISNLLQVI
#NEXUS
[ID: 5286680284]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_012634449_1_2779_MLBR_RS13225
NC_002677_1_NP_302664_1_1536_ML2597
NZ_LVXE01000045_1_WP_012634449_1_1928_A3216_RS10875
NZ_LYPH01000051_1_WP_012634449_1_1947_A8144_RS09305
NZ_CP029543_1_WP_010908983_1_2808_DIJ64_RS14295
NZ_AP014567_1_WP_012634449_1_2876_JK2ML_RS14635
;
end;
begin trees;
translate
1 NC_011896_1_WP_012634449_1_2779_MLBR_RS13225,
2 NC_002677_1_NP_302664_1_1536_ML2597,
3 NZ_LVXE01000045_1_WP_012634449_1_1928_A3216_RS10875,
4 NZ_LYPH01000051_1_WP_012634449_1_1947_A8144_RS09305,
5 NZ_CP029543_1_WP_010908983_1_2808_DIJ64_RS14295,
6 NZ_AP014567_1_WP_012634449_1_2876_JK2ML_RS14635
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06390029,2:0.06889946,3:0.06552485,4:0.06556796,5:0.0695699,6:0.06360546);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06390029,2:0.06889946,3:0.06552485,4:0.06556796,5:0.0695699,6:0.06360546);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -774.75 -778.73
2 -774.79 -779.57
--------------------------------------
TOTAL -774.77 -779.24
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2597/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.879773 0.085655 0.364706 1.476927 0.845244 1252.48 1315.97 1.000
r(A<->C){all} 0.215161 0.027339 0.000178 0.549487 0.178947 92.43 117.93 1.000
r(A<->G){all} 0.158514 0.017693 0.000034 0.422680 0.121409 76.54 109.17 1.007
r(A<->T){all} 0.159559 0.018818 0.000184 0.440421 0.121461 120.03 211.53 1.000
r(C<->G){all} 0.147746 0.018187 0.000073 0.433683 0.107325 134.46 171.31 1.000
r(C<->T){all} 0.156657 0.018824 0.000048 0.431481 0.118020 300.04 329.18 1.001
r(G<->T){all} 0.162363 0.018986 0.000091 0.437445 0.123311 158.57 169.16 1.000
pi(A){all} 0.237426 0.000329 0.201026 0.270441 0.237503 1087.71 1253.96 1.000
pi(C){all} 0.270127 0.000351 0.234164 0.305977 0.269659 1360.34 1365.13 1.000
pi(G){all} 0.288938 0.000368 0.252900 0.327061 0.288708 1187.18 1229.39 1.001
pi(T){all} 0.203508 0.000279 0.172473 0.236869 0.203391 1314.10 1335.52 1.000
alpha{1,2} 0.398773 0.210979 0.000265 1.351137 0.238669 1105.59 1303.29 1.000
alpha{3} 0.410201 0.229376 0.000204 1.357471 0.244667 941.52 1022.18 1.000
pinvar{all} 0.994047 0.000028 0.984409 0.999921 0.995508 1472.70 1486.85 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2597/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 184
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 1 0 1 1 0 1 | Tyr TAT 2 3 2 2 3 2 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 4 4 4 4 4 4 | TAC 2 2 2 2 2 2 | TGC 0 0 0 0 0 0
Leu TTA 3 3 3 3 3 3 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 5 5 5 5 5 5 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 4 4 4 4 4 4 | Pro CCT 1 1 1 1 1 1 | His CAT 1 1 1 1 1 1 | Arg CGT 2 2 2 2 2 2
CTC 4 4 4 4 4 4 | CCC 1 1 1 1 1 1 | CAC 2 2 2 2 2 2 | CGC 2 2 2 2 2 2
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 3 3 3 3 3 3 | CGA 2 2 2 2 2 2
CTG 2 2 2 2 2 2 | CCG 3 3 3 3 3 3 | CAG 9 9 9 9 9 9 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 3 3 3 3 3 3 | Asn AAT 4 4 4 4 4 4 | Ser AGT 1 1 1 1 1 1
ATC 5 5 5 5 5 5 | ACC 6 6 6 6 6 6 | AAC 5 5 5 5 5 5 | AGC 3 3 3 3 3 3
ATA 1 1 1 1 1 1 | ACA 2 2 2 2 2 2 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 4 4 4 4 4 4 | ACG 5 5 5 5 5 5 | AAG 5 5 5 5 5 5 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 7 7 7 7 7 7 | Asp GAT 3 3 3 3 3 3 | Gly GGT 2 2 2 2 2 2
GTC 4 4 4 4 4 4 | GCC 6 6 6 6 6 6 | GAC 5 5 5 5 5 5 | GGC 4 4 4 4 4 4
GTA 2 2 2 2 2 2 | GCA 5 5 5 5 5 5 | Glu GAA 6 6 6 6 6 6 | GGA 1 1 1 1 1 1
GTG 11 11 11 11 11 11 | GCG 7 7 7 7 7 7 | GAG 4 4 4 4 4 4 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_012634449_1_2779_MLBR_RS13225
position 1: T:0.16304 C:0.20652 A:0.26087 G:0.36957
position 2: T:0.27174 C:0.29348 A:0.29348 G:0.14130
position 3: T:0.17935 C:0.30435 A:0.15217 G:0.36413
Average T:0.20471 C:0.26812 A:0.23551 G:0.29167
#2: NC_002677_1_NP_302664_1_1536_ML2597
position 1: T:0.16304 C:0.20652 A:0.26087 G:0.36957
position 2: T:0.27174 C:0.28804 A:0.29891 G:0.14130
position 3: T:0.17935 C:0.30435 A:0.15217 G:0.36413
Average T:0.20471 C:0.26630 A:0.23732 G:0.29167
#3: NZ_LVXE01000045_1_WP_012634449_1_1928_A3216_RS10875
position 1: T:0.16304 C:0.20652 A:0.26087 G:0.36957
position 2: T:0.27174 C:0.29348 A:0.29348 G:0.14130
position 3: T:0.17935 C:0.30435 A:0.15217 G:0.36413
Average T:0.20471 C:0.26812 A:0.23551 G:0.29167
#4: NZ_LYPH01000051_1_WP_012634449_1_1947_A8144_RS09305
position 1: T:0.16304 C:0.20652 A:0.26087 G:0.36957
position 2: T:0.27174 C:0.29348 A:0.29348 G:0.14130
position 3: T:0.17935 C:0.30435 A:0.15217 G:0.36413
Average T:0.20471 C:0.26812 A:0.23551 G:0.29167
#5: NZ_CP029543_1_WP_010908983_1_2808_DIJ64_RS14295
position 1: T:0.16304 C:0.20652 A:0.26087 G:0.36957
position 2: T:0.27174 C:0.28804 A:0.29891 G:0.14130
position 3: T:0.17935 C:0.30435 A:0.15217 G:0.36413
Average T:0.20471 C:0.26630 A:0.23732 G:0.29167
#6: NZ_AP014567_1_WP_012634449_1_2876_JK2ML_RS14635
position 1: T:0.16304 C:0.20652 A:0.26087 G:0.36957
position 2: T:0.27174 C:0.29348 A:0.29348 G:0.14130
position 3: T:0.17935 C:0.30435 A:0.15217 G:0.36413
Average T:0.20471 C:0.26812 A:0.23551 G:0.29167
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 4 | Tyr Y TAT 14 | Cys C TGT 0
TTC 18 | TCC 24 | TAC 12 | TGC 0
Leu L TTA 18 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 30 | TCG 18 | TAG 0 | Trp W TGG 30
------------------------------------------------------------------------------
Leu L CTT 24 | Pro P CCT 6 | His H CAT 6 | Arg R CGT 12
CTC 24 | CCC 6 | CAC 12 | CGC 12
CTA 0 | CCA 0 | Gln Q CAA 18 | CGA 12
CTG 12 | CCG 18 | CAG 54 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 18 | Asn N AAT 24 | Ser S AGT 6
ATC 30 | ACC 36 | AAC 30 | AGC 18
ATA 6 | ACA 12 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 24 | ACG 30 | AAG 30 | AGG 6
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 42 | Asp D GAT 18 | Gly G GGT 12
GTC 24 | GCC 36 | GAC 30 | GGC 24
GTA 12 | GCA 30 | Glu E GAA 36 | GGA 6
GTG 66 | GCG 42 | GAG 24 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.16304 C:0.20652 A:0.26087 G:0.36957
position 2: T:0.27174 C:0.29167 A:0.29529 G:0.14130
position 3: T:0.17935 C:0.30435 A:0.15217 G:0.36413
Average T:0.20471 C:0.26751 A:0.23611 G:0.29167
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
lnL(ntime: 6 np: 8): -750.398051 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.005446 0.000004 0.000004 0.005446 0.000004 0.000100 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.010908
(1: 0.000004, 2: 0.005446, 3: 0.000004, 4: 0.000004, 5: 0.005446, 6: 0.000004);
(NC_011896_1_WP_012634449_1_2779_MLBR_RS13225: 0.000004, NC_002677_1_NP_302664_1_1536_ML2597: 0.005446, NZ_LVXE01000045_1_WP_012634449_1_1928_A3216_RS10875: 0.000004, NZ_LYPH01000051_1_WP_012634449_1_1947_A8144_RS09305: 0.000004, NZ_CP029543_1_WP_010908983_1_2808_DIJ64_RS14295: 0.005446, NZ_AP014567_1_WP_012634449_1_2876_JK2ML_RS14635: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 439.3 112.7 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.005 439.3 112.7 999.0000 0.0023 0.0000 1.0 0.0
7..3 0.000 439.3 112.7 999.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 439.3 112.7 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.005 439.3 112.7 999.0000 0.0023 0.0000 1.0 0.0
7..6 0.000 439.3 112.7 999.0000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0046
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
lnL(ntime: 6 np: 9): -750.842868 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.005477 0.000004 0.000004 0.005477 0.000004 0.000100 0.375610 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.010970
(1: 0.000004, 2: 0.005477, 3: 0.000004, 4: 0.000004, 5: 0.005477, 6: 0.000004);
(NC_011896_1_WP_012634449_1_2779_MLBR_RS13225: 0.000004, NC_002677_1_NP_302664_1_1536_ML2597: 0.005477, NZ_LVXE01000045_1_WP_012634449_1_1928_A3216_RS10875: 0.000004, NZ_LYPH01000051_1_WP_012634449_1_1947_A8144_RS09305: 0.000004, NZ_CP029543_1_WP_010908983_1_2808_DIJ64_RS14295: 0.005477, NZ_AP014567_1_WP_012634449_1_2876_JK2ML_RS14635: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.37561 0.62439
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 439.3 112.7 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.005 439.3 112.7 1.0000 0.0018 0.0018 0.8 0.2
7..3 0.000 439.3 112.7 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 439.3 112.7 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.005 439.3 112.7 1.0000 0.0018 0.0018 0.8 0.2
7..6 0.000 439.3 112.7 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
check convergence..
lnL(ntime: 6 np: 11): -744.940674 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.010970 0.000004 0.000004 0.010970 0.000004 0.000100 0.994045 0.000000 0.000001 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.021957
(1: 0.000004, 2: 0.010970, 3: 0.000004, 4: 0.000004, 5: 0.010970, 6: 0.000004);
(NC_011896_1_WP_012634449_1_2779_MLBR_RS13225: 0.000004, NC_002677_1_NP_302664_1_1536_ML2597: 0.010970, NZ_LVXE01000045_1_WP_012634449_1_1928_A3216_RS10875: 0.000004, NZ_LYPH01000051_1_WP_012634449_1_1947_A8144_RS09305: 0.000004, NZ_CP029543_1_WP_010908983_1_2808_DIJ64_RS14295: 0.010970, NZ_AP014567_1_WP_012634449_1_2876_JK2ML_RS14635: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.99404 0.00000 0.00596
w: 0.00000 1.00000 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 439.3 112.7 5.9495 0.0000 0.0000 0.0 0.0
7..2 0.011 439.3 112.7 5.9495 0.0044 0.0007 1.9 0.1
7..3 0.000 439.3 112.7 5.9495 0.0000 0.0000 0.0 0.0
7..4 0.000 439.3 112.7 5.9495 0.0000 0.0000 0.0 0.0
7..5 0.011 439.3 112.7 5.9495 0.0044 0.0007 1.9 0.1
7..6 0.000 439.3 112.7 5.9495 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634449_1_2779_MLBR_RS13225)
Pr(w>1) post mean +- SE for w
151 S 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634449_1_2779_MLBR_RS13225)
Pr(w>1) post mean +- SE for w
151 S 0.918 6.617 +- 2.947
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.108 0.106 0.104 0.102 0.100 0.099 0.097 0.096 0.095 0.093
w2: 0.034 0.054 0.074 0.090 0.104 0.115 0.123 0.130 0.136 0.141
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.006
0.011 0.009 0.006
0.012 0.012 0.012 0.009 0.006
0.011 0.012 0.012 0.012 0.012 0.009 0.006
0.010 0.011 0.012 0.012 0.013 0.012 0.012 0.009 0.006
0.008 0.009 0.010 0.011 0.012 0.013 0.013 0.013 0.012 0.009 0.006
0.007 0.008 0.009 0.010 0.010 0.011 0.012 0.013 0.013 0.013 0.013 0.009 0.006
0.006 0.007 0.007 0.008 0.009 0.010 0.011 0.012 0.012 0.013 0.014 0.013 0.013 0.009 0.006
0.005 0.006 0.006 0.007 0.007 0.008 0.009 0.010 0.011 0.012 0.013 0.014 0.014 0.014 0.013 0.009 0.006
0.004 0.005 0.005 0.006 0.006 0.007 0.008 0.009 0.009 0.010 0.011 0.012 0.013 0.014 0.014 0.014 0.013 0.010 0.006
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
lnL(ntime: 6 np: 9): -750.405893 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.005569 0.000004 0.000004 0.005569 0.000004 0.000100 0.005000 0.020197
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.011155
(1: 0.000004, 2: 0.005569, 3: 0.000004, 4: 0.000004, 5: 0.005569, 6: 0.000004);
(NC_011896_1_WP_012634449_1_2779_MLBR_RS13225: 0.000004, NC_002677_1_NP_302664_1_1536_ML2597: 0.005569, NZ_LVXE01000045_1_WP_012634449_1_1928_A3216_RS10875: 0.000004, NZ_LYPH01000051_1_WP_012634449_1_1947_A8144_RS09305: 0.000004, NZ_CP029543_1_WP_010908983_1_2808_DIJ64_RS14295: 0.005569, NZ_AP014567_1_WP_012634449_1_2876_JK2ML_RS14635: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 0.02020
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 439.3 112.7 0.2000 0.0000 0.0000 0.0 0.0
7..2 0.006 439.3 112.7 0.2000 0.0010 0.0051 0.4 0.6
7..3 0.000 439.3 112.7 0.2000 0.0000 0.0000 0.0 0.0
7..4 0.000 439.3 112.7 0.2000 0.0000 0.0000 0.0 0.0
7..5 0.006 439.3 112.7 0.2000 0.0010 0.0051 0.4 0.6
7..6 0.000 439.3 112.7 0.2000 0.0000 0.0000 0.0 0.0
Time used: 0:14
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
lnL(ntime: 6 np: 11): -744.940673 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.010972 0.000004 0.000004 0.010972 0.000004 0.000100 0.994043 0.005000 83.714095 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.021959
(1: 0.000004, 2: 0.010972, 3: 0.000004, 4: 0.000004, 5: 0.010972, 6: 0.000004);
(NC_011896_1_WP_012634449_1_2779_MLBR_RS13225: 0.000004, NC_002677_1_NP_302664_1_1536_ML2597: 0.010972, NZ_LVXE01000045_1_WP_012634449_1_1928_A3216_RS10875: 0.000004, NZ_LYPH01000051_1_WP_012634449_1_1947_A8144_RS09305: 0.000004, NZ_CP029543_1_WP_010908983_1_2808_DIJ64_RS14295: 0.010972, NZ_AP014567_1_WP_012634449_1_2876_JK2ML_RS14635: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99404 p = 0.00500 q = 83.71410
(p1 = 0.00596) w = 999.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09940 0.09940 0.09940 0.09940 0.09940 0.09940 0.09940 0.09940 0.09940 0.09940 0.00596
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 439.3 112.7 5.9509 0.0000 0.0000 0.0 0.0
7..2 0.011 439.3 112.7 5.9509 0.0044 0.0007 1.9 0.1
7..3 0.000 439.3 112.7 5.9509 0.0000 0.0000 0.0 0.0
7..4 0.000 439.3 112.7 5.9509 0.0000 0.0000 0.0 0.0
7..5 0.011 439.3 112.7 5.9509 0.0044 0.0007 1.9 0.1
7..6 0.000 439.3 112.7 5.9509 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634449_1_2779_MLBR_RS13225)
Pr(w>1) post mean +- SE for w
151 S 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634449_1_2779_MLBR_RS13225)
Pr(w>1) post mean +- SE for w
151 S 0.965* 6.516 +- 2.779
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.046 0.055 0.067 0.081 0.098 0.119 0.140 0.156 0.150 0.088
p : 0.110 0.106 0.103 0.101 0.099 0.098 0.097 0.096 0.095 0.095
q : 0.092 0.095 0.097 0.099 0.100 0.102 0.103 0.103 0.104 0.105
ws: 0.039 0.067 0.088 0.102 0.111 0.116 0.118 0.120 0.120 0.120
Time used: 0:35
Model 1: NearlyNeutral -750.842868
Model 2: PositiveSelection -744.940674
Model 0: one-ratio -750.398051
Model 7: beta -750.405893
Model 8: beta&w>1 -744.940673
Model 0 vs 1 0.8896339999998872
Model 2 vs 1 11.804388000000017
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634449_1_2779_MLBR_RS13225)
Pr(w>1) post mean +- SE for w
151 S 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634449_1_2779_MLBR_RS13225)
Pr(w>1) post mean +- SE for w
151 S 0.918 6.617 +- 2.947
Model 8 vs 7 10.93044000000009
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634449_1_2779_MLBR_RS13225)
Pr(w>1) post mean +- SE for w
151 S 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634449_1_2779_MLBR_RS13225)
Pr(w>1) post mean +- SE for w
151 S 0.965* 6.516 +- 2.779
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
