--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:45:49 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2598/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -771.88 -774.91
2 -771.82 -775.09
--------------------------------------
TOTAL -771.85 -775.01
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.871841 0.087314 0.363610 1.491818 0.840720 1358.78 1429.89 1.000
r(A<->C){all} 0.149477 0.018691 0.000033 0.427651 0.106999 236.90 269.80 1.001
r(A<->G){all} 0.171693 0.020970 0.000009 0.454093 0.135379 282.35 288.04 1.007
r(A<->T){all} 0.173728 0.021312 0.000054 0.460789 0.133242 232.78 243.98 1.001
r(C<->G){all} 0.206965 0.024694 0.000029 0.512302 0.175238 239.62 261.25 1.015
r(C<->T){all} 0.149258 0.018095 0.000107 0.427759 0.110361 152.13 240.80 1.000
r(G<->T){all} 0.148879 0.017693 0.000022 0.423379 0.109521 70.98 244.09 1.001
pi(A){all} 0.211490 0.000302 0.178346 0.245948 0.211430 719.56 1026.87 1.000
pi(C){all} 0.295202 0.000357 0.259749 0.334807 0.295052 1290.12 1352.05 1.000
pi(G){all} 0.283839 0.000362 0.248819 0.323340 0.283073 1182.17 1271.97 1.000
pi(T){all} 0.209469 0.000286 0.175039 0.240427 0.209211 1164.01 1197.19 1.000
alpha{1,2} 0.321347 0.148539 0.000220 1.060694 0.204396 1289.74 1383.35 1.000
alpha{3} 0.397009 0.216032 0.000106 1.376974 0.224708 1225.87 1252.46 1.001
pinvar{all} 0.993724 0.000028 0.984290 0.999857 0.995073 1141.79 1151.32 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -735.366084
Model 2: PositiveSelection -735.03662
Model 0: one-ratio -735.036601
Model 7: beta -735.366082
Model 8: beta&w>1 -735.03662
Model 0 vs 1 0.658965999999964
Model 2 vs 1 0.6589280000000599
Model 8 vs 7 0.65892400000007
>C1
VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYVSGDFGAQYRKFVD
AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
>C2
VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD
AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
>C3
VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD
AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
>C4
VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD
AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
>C5
VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD
AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
>C6
VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD
AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=184
C1 VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
C2 VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
C3 VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
C4 VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
C5 VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
C6 VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
**************************************************
C1 VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYVSGDFGAQYRKFVD
C2 VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD
C3 VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD
C4 VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD
C5 VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD
C6 VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD
************************************:*************
C1 AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
C2 AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
C3 AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
C4 AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
C5 AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
C6 AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
**************************************************
C1 LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
C2 LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
C3 LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
C4 LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
C5 LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
C6 LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
**********************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 184 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 184 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5520]--->[5520]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.471 Mb, Max= 30.719 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
C2 VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
C3 VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
C4 VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
C5 VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
C6 VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
**************************************************
C1 VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYVSGDFGAQYRKFVD
C2 VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD
C3 VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD
C4 VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD
C5 VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD
C6 VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD
************************************:*************
C1 AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
C2 AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
C3 AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
C4 AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
C5 AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
C6 AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
**************************************************
C1 LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
C2 LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
C3 LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
C4 LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
C5 LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
C6 LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
**********************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 99.46 C1 C2 99.46
TOP 1 0 99.46 C2 C1 99.46
BOT 0 2 99.46 C1 C3 99.46
TOP 2 0 99.46 C3 C1 99.46
BOT 0 3 99.46 C1 C4 99.46
TOP 3 0 99.46 C4 C1 99.46
BOT 0 4 99.46 C1 C5 99.46
TOP 4 0 99.46 C5 C1 99.46
BOT 0 5 99.46 C1 C6 99.46
TOP 5 0 99.46 C6 C1 99.46
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 99.46
AVG 1 C2 * 99.89
AVG 2 C3 * 99.89
AVG 3 C4 * 99.89
AVG 4 C5 * 99.89
AVG 5 C6 * 99.89
TOT TOT * 99.82
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGGCAGCCGCTGAAGGCGGTGGTTCCTGGAGGAATCGACGAGCCGGTCA
C2 GTGGCAGCCGCTGAAGGCGGTGGTTCCTGGAGGAATCGACGAGCCGGTCA
C3 GTGGCAGCCGCTGAAGGCGGTGGTTCCTGGAGGAATCGACGAGCCGGTCA
C4 GTGGCAGCCGCTGAAGGCGGTGGTTCCTGGAGGAATCGACGAGCCGGTCA
C5 GTGGCAGCCGCTGAAGGCGGTGGTTCCTGGAGGAATCGACGAGCCGGTCA
C6 GTGGCAGCCGCTGAAGGCGGTGGTTCCTGGAGGAATCGACGAGCCGGTCA
**************************************************
C1 GAGGACGGCTATCGCCGTCGTGGTTGCCGCGGTGCTATTCGTTGGTTCCG
C2 GAGGACGGCTATCGCCGTCGTGGTTGCCGCGGTGCTATTCGTTGGTTCCG
C3 GAGGACGGCTATCGCCGTCGTGGTTGCCGCGGTGCTATTCGTTGGTTCCG
C4 GAGGACGGCTATCGCCGTCGTGGTTGCCGCGGTGCTATTCGTTGGTTCCG
C5 GAGGACGGCTATCGCCGTCGTGGTTGCCGCGGTGCTATTCGTTGGTTCCG
C6 GAGGACGGCTATCGCCGTCGTGGTTGCCGCGGTGCTATTCGTTGGTTCCG
**************************************************
C1 CAGCGTTTGCGGGCGCGGCCGTGCAGCCCTACCTGGCTGATCGCGCTACC
C2 CAGCGTTTGCGGGCGCGGCCGTGCAGCCCTACCTGGCTGATCGCGCTACC
C3 CAGCGTTTGCGGGCGCGGCCGTGCAGCCCTACCTGGCTGATCGCGCTACC
C4 CAGCGTTTGCGGGCGCGGCCGTGCAGCCCTACCTGGCTGATCGCGCTACC
C5 CAGCGTTTGCGGGCGCGGCCGTGCAGCCCTACCTGGCTGATCGCGCTACC
C6 CAGCGTTTGCGGGCGCGGCCGTGCAGCCCTACCTGGCTGATCGCGCTACC
**************************************************
C1 GTCGCAGTCAAGCTCGAAGTGGCGCGGACAGCGGCTAACGCGATCACGGT
C2 GTCGCAGTCAAGCTCGAAGTGGCGCGGACAGCGGCTAACGCGATCACGGT
C3 GTCGCAGTCAAGCTCGAAGTGGCGCGGACAGCGGCTAACGCGATCACGGT
C4 GTCGCAGTCAAGCTCGAAGTGGCGCGGACAGCGGCTAACGCGATCACGGT
C5 GTCGCAGTCAAGCTCGAAGTGGCGCGGACAGCGGCTAACGCGATCACGGT
C6 GTCGCAGTCAAGCTCGAAGTGGCGCGGACAGCGGCTAACGCGATCACGGT
**************************************************
C1 TCTGTGGACTTATACCCCGGAGAACATGGACACTCTAGCTGACCGTGCGG
C2 TCTGTGGACTTATACCCCGGAGAACATGGACACTCTAGCTGACCGTGCGG
C3 TCTGTGGACTTATACCCCGGAGAACATGGACACTCTAGCTGACCGTGCGG
C4 TCTGTGGACTTATACCCCGGAGAACATGGACACTCTAGCTGACCGTGCGG
C5 TCTGTGGACTTATACCCCGGAGAACATGGACACTCTAGCTGACCGTGCGG
C6 TCTGTGGACTTATACCCCGGAGAACATGGACACTCTAGCTGACCGTGCGG
**************************************************
C1 CGACCTACGTCAGCGGCGATTTTGGGGCCCAGTACCGCAAATTCGTCGAT
C2 CGACCTACCTCAGCGGCGATTTTGGGGCCCAGTACCGCAAATTCGTCGAT
C3 CGACCTACCTCAGCGGCGATTTTGGGGCCCAGTACCGCAAATTCGTCGAT
C4 CGACCTACCTCAGCGGCGATTTTGGGGCCCAGTACCGCAAATTCGTCGAT
C5 CGACCTACCTCAGCGGCGATTTTGGGGCCCAGTACCGCAAATTCGTCGAT
C6 CGACCTACCTCAGCGGCGATTTTGGGGCCCAGTACCGCAAATTCGTCGAT
******** *****************************************
C1 GCTATCGTCGGCCCCAACAAACAGGCCAAGATAACCAACAGCACTGAAGT
C2 GCTATCGTCGGCCCCAACAAACAGGCCAAGATAACCAACAGCACTGAAGT
C3 GCTATCGTCGGCCCCAACAAACAGGCCAAGATAACCAACAGCACTGAAGT
C4 GCTATCGTCGGCCCCAACAAACAGGCCAAGATAACCAACAGCACTGAAGT
C5 GCTATCGTCGGCCCCAACAAACAGGCCAAGATAACCAACAGCACTGAAGT
C6 GCTATCGTCGGCCCCAACAAACAGGCCAAGATAACCAACAGCACTGAAGT
**************************************************
C1 CACTGGCGTGGCAGTCGAATCGCTGGATGCTTCGAATGCCATCGCTATTG
C2 CACTGGCGTGGCAGTCGAATCGCTGGATGCTTCGAATGCCATCGCTATTG
C3 CACTGGCGTGGCAGTCGAATCGCTGGATGCTTCGAATGCCATCGCTATTG
C4 CACTGGCGTGGCAGTCGAATCGCTGGATGCTTCGAATGCCATCGCTATTG
C5 CACTGGCGTGGCAGTCGAATCGCTGGATGCTTCGAATGCCATCGCTATTG
C6 CACTGGCGTGGCAGTCGAATCGCTGGATGCTTCGAATGCCATCGCTATTG
**************************************************
C1 TGTATACCAACACCACATCCACCAGCCCGCTGACCAAAAACATTCCGGCA
C2 TGTATACCAACACCACATCCACCAGCCCGCTGACCAAAAACATTCCGGCA
C3 TGTATACCAACACCACATCCACCAGCCCGCTGACCAAAAACATTCCGGCA
C4 TGTATACCAACACCACATCCACCAGCCCGCTGACCAAAAACATTCCGGCA
C5 TGTATACCAACACCACATCCACCAGCCCGCTGACCAAAAACATTCCGGCA
C6 TGTATACCAACACCACATCCACCAGCCCGCTGACCAAAAACATTCCGGCA
**************************************************
C1 CTTAAATATCTGTCCTACCGGTTGTTTATGAAACGTAGTGCTGTCCGCTG
C2 CTTAAATATCTGTCCTACCGGTTGTTTATGAAACGTAGTGCTGTCCGCTG
C3 CTTAAATATCTGTCCTACCGGTTGTTTATGAAACGTAGTGCTGTCCGCTG
C4 CTTAAATATCTGTCCTACCGGTTGTTTATGAAACGTAGTGCTGTCCGCTG
C5 CTTAAATATCTGTCCTACCGGTTGTTTATGAAACGTAGTGCTGTCCGCTG
C6 CTTAAATATCTGTCCTACCGGTTGTTTATGAAACGTAGTGCTGTCCGCTG
**************************************************
C1 GTTGGTGACCAGAATGACGACCATCACTTCACTGGATTTGACGCCGCAGC
C2 GTTGGTGACCAGAATGACGACCATCACTTCACTGGATTTGACGCCGCAGC
C3 GTTGGTGACCAGAATGACGACCATCACTTCACTGGATTTGACGCCGCAGC
C4 GTTGGTGACCAGAATGACGACCATCACTTCACTGGATTTGACGCCGCAGC
C5 GTTGGTGACCAGAATGACGACCATCACTTCACTGGATTTGACGCCGCAGC
C6 GTTGGTGACCAGAATGACGACCATCACTTCACTGGATTTGACGCCGCAGC
**************************************************
C1 TA
C2 TA
C3 TA
C4 TA
C5 TA
C6 TA
**
>C1
GTGGCAGCCGCTGAAGGCGGTGGTTCCTGGAGGAATCGACGAGCCGGTCA
GAGGACGGCTATCGCCGTCGTGGTTGCCGCGGTGCTATTCGTTGGTTCCG
CAGCGTTTGCGGGCGCGGCCGTGCAGCCCTACCTGGCTGATCGCGCTACC
GTCGCAGTCAAGCTCGAAGTGGCGCGGACAGCGGCTAACGCGATCACGGT
TCTGTGGACTTATACCCCGGAGAACATGGACACTCTAGCTGACCGTGCGG
CGACCTACGTCAGCGGCGATTTTGGGGCCCAGTACCGCAAATTCGTCGAT
GCTATCGTCGGCCCCAACAAACAGGCCAAGATAACCAACAGCACTGAAGT
CACTGGCGTGGCAGTCGAATCGCTGGATGCTTCGAATGCCATCGCTATTG
TGTATACCAACACCACATCCACCAGCCCGCTGACCAAAAACATTCCGGCA
CTTAAATATCTGTCCTACCGGTTGTTTATGAAACGTAGTGCTGTCCGCTG
GTTGGTGACCAGAATGACGACCATCACTTCACTGGATTTGACGCCGCAGC
TA
>C2
GTGGCAGCCGCTGAAGGCGGTGGTTCCTGGAGGAATCGACGAGCCGGTCA
GAGGACGGCTATCGCCGTCGTGGTTGCCGCGGTGCTATTCGTTGGTTCCG
CAGCGTTTGCGGGCGCGGCCGTGCAGCCCTACCTGGCTGATCGCGCTACC
GTCGCAGTCAAGCTCGAAGTGGCGCGGACAGCGGCTAACGCGATCACGGT
TCTGTGGACTTATACCCCGGAGAACATGGACACTCTAGCTGACCGTGCGG
CGACCTACCTCAGCGGCGATTTTGGGGCCCAGTACCGCAAATTCGTCGAT
GCTATCGTCGGCCCCAACAAACAGGCCAAGATAACCAACAGCACTGAAGT
CACTGGCGTGGCAGTCGAATCGCTGGATGCTTCGAATGCCATCGCTATTG
TGTATACCAACACCACATCCACCAGCCCGCTGACCAAAAACATTCCGGCA
CTTAAATATCTGTCCTACCGGTTGTTTATGAAACGTAGTGCTGTCCGCTG
GTTGGTGACCAGAATGACGACCATCACTTCACTGGATTTGACGCCGCAGC
TA
>C3
GTGGCAGCCGCTGAAGGCGGTGGTTCCTGGAGGAATCGACGAGCCGGTCA
GAGGACGGCTATCGCCGTCGTGGTTGCCGCGGTGCTATTCGTTGGTTCCG
CAGCGTTTGCGGGCGCGGCCGTGCAGCCCTACCTGGCTGATCGCGCTACC
GTCGCAGTCAAGCTCGAAGTGGCGCGGACAGCGGCTAACGCGATCACGGT
TCTGTGGACTTATACCCCGGAGAACATGGACACTCTAGCTGACCGTGCGG
CGACCTACCTCAGCGGCGATTTTGGGGCCCAGTACCGCAAATTCGTCGAT
GCTATCGTCGGCCCCAACAAACAGGCCAAGATAACCAACAGCACTGAAGT
CACTGGCGTGGCAGTCGAATCGCTGGATGCTTCGAATGCCATCGCTATTG
TGTATACCAACACCACATCCACCAGCCCGCTGACCAAAAACATTCCGGCA
CTTAAATATCTGTCCTACCGGTTGTTTATGAAACGTAGTGCTGTCCGCTG
GTTGGTGACCAGAATGACGACCATCACTTCACTGGATTTGACGCCGCAGC
TA
>C4
GTGGCAGCCGCTGAAGGCGGTGGTTCCTGGAGGAATCGACGAGCCGGTCA
GAGGACGGCTATCGCCGTCGTGGTTGCCGCGGTGCTATTCGTTGGTTCCG
CAGCGTTTGCGGGCGCGGCCGTGCAGCCCTACCTGGCTGATCGCGCTACC
GTCGCAGTCAAGCTCGAAGTGGCGCGGACAGCGGCTAACGCGATCACGGT
TCTGTGGACTTATACCCCGGAGAACATGGACACTCTAGCTGACCGTGCGG
CGACCTACCTCAGCGGCGATTTTGGGGCCCAGTACCGCAAATTCGTCGAT
GCTATCGTCGGCCCCAACAAACAGGCCAAGATAACCAACAGCACTGAAGT
CACTGGCGTGGCAGTCGAATCGCTGGATGCTTCGAATGCCATCGCTATTG
TGTATACCAACACCACATCCACCAGCCCGCTGACCAAAAACATTCCGGCA
CTTAAATATCTGTCCTACCGGTTGTTTATGAAACGTAGTGCTGTCCGCTG
GTTGGTGACCAGAATGACGACCATCACTTCACTGGATTTGACGCCGCAGC
TA
>C5
GTGGCAGCCGCTGAAGGCGGTGGTTCCTGGAGGAATCGACGAGCCGGTCA
GAGGACGGCTATCGCCGTCGTGGTTGCCGCGGTGCTATTCGTTGGTTCCG
CAGCGTTTGCGGGCGCGGCCGTGCAGCCCTACCTGGCTGATCGCGCTACC
GTCGCAGTCAAGCTCGAAGTGGCGCGGACAGCGGCTAACGCGATCACGGT
TCTGTGGACTTATACCCCGGAGAACATGGACACTCTAGCTGACCGTGCGG
CGACCTACCTCAGCGGCGATTTTGGGGCCCAGTACCGCAAATTCGTCGAT
GCTATCGTCGGCCCCAACAAACAGGCCAAGATAACCAACAGCACTGAAGT
CACTGGCGTGGCAGTCGAATCGCTGGATGCTTCGAATGCCATCGCTATTG
TGTATACCAACACCACATCCACCAGCCCGCTGACCAAAAACATTCCGGCA
CTTAAATATCTGTCCTACCGGTTGTTTATGAAACGTAGTGCTGTCCGCTG
GTTGGTGACCAGAATGACGACCATCACTTCACTGGATTTGACGCCGCAGC
TA
>C6
GTGGCAGCCGCTGAAGGCGGTGGTTCCTGGAGGAATCGACGAGCCGGTCA
GAGGACGGCTATCGCCGTCGTGGTTGCCGCGGTGCTATTCGTTGGTTCCG
CAGCGTTTGCGGGCGCGGCCGTGCAGCCCTACCTGGCTGATCGCGCTACC
GTCGCAGTCAAGCTCGAAGTGGCGCGGACAGCGGCTAACGCGATCACGGT
TCTGTGGACTTATACCCCGGAGAACATGGACACTCTAGCTGACCGTGCGG
CGACCTACCTCAGCGGCGATTTTGGGGCCCAGTACCGCAAATTCGTCGAT
GCTATCGTCGGCCCCAACAAACAGGCCAAGATAACCAACAGCACTGAAGT
CACTGGCGTGGCAGTCGAATCGCTGGATGCTTCGAATGCCATCGCTATTG
TGTATACCAACACCACATCCACCAGCCCGCTGACCAAAAACATTCCGGCA
CTTAAATATCTGTCCTACCGGTTGTTTATGAAACGTAGTGCTGTCCGCTG
GTTGGTGACCAGAATGACGACCATCACTTCACTGGATTTGACGCCGCAGC
TA
>C1
VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYVSGDFGAQYRKFVD
AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
>C2
VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD
AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
>C3
VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD
AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
>C4
VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD
AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
>C5
VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD
AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
>C6
VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD
AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 552 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579859057
Setting output file names to "/data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 341627568
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5979260411
Seed = 1707122299
Swapseed = 1579859057
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 5 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1238.805327 -- -24.965149
Chain 2 -- -1238.803706 -- -24.965149
Chain 3 -- -1238.805327 -- -24.965149
Chain 4 -- -1238.805327 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1238.803706 -- -24.965149
Chain 2 -- -1238.805327 -- -24.965149
Chain 3 -- -1238.805327 -- -24.965149
Chain 4 -- -1238.805327 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1238.805] (-1238.804) (-1238.805) (-1238.805) * [-1238.804] (-1238.805) (-1238.805) (-1238.805)
500 -- (-775.585) (-777.011) (-777.438) [-785.282] * (-783.423) (-789.109) (-773.546) [-776.150] -- 0:00:00
1000 -- (-774.525) [-778.192] (-779.703) (-777.157) * (-780.128) (-777.996) (-778.602) [-778.109] -- 0:00:00
1500 -- (-778.175) (-781.156) (-772.448) [-778.586] * (-778.135) (-775.315) (-779.500) [-773.753] -- 0:00:00
2000 -- [-775.124] (-784.527) (-780.078) (-780.250) * [-782.781] (-777.719) (-781.477) (-778.327) -- 0:00:00
2500 -- [-773.078] (-785.610) (-774.422) (-777.758) * (-788.761) [-772.633] (-779.094) (-782.026) -- 0:00:00
3000 -- (-779.688) (-779.200) (-782.107) [-772.445] * [-780.656] (-779.473) (-774.174) (-788.662) -- 0:00:00
3500 -- (-777.400) (-780.130) [-778.777] (-776.969) * (-785.687) (-778.413) (-777.994) [-778.330] -- 0:00:00
4000 -- (-782.455) [-774.010] (-778.997) (-774.129) * (-777.389) [-775.614] (-781.771) (-771.528) -- 0:00:00
4500 -- (-777.938) [-781.200] (-777.023) (-777.050) * (-782.195) [-774.642] (-781.068) (-772.515) -- 0:00:00
5000 -- (-781.208) (-778.377) [-778.433] (-775.922) * (-780.348) (-777.504) (-775.834) [-775.590] -- 0:00:00
Average standard deviation of split frequencies: 0.068319
5500 -- (-782.002) (-779.189) (-777.961) [-780.708] * (-778.728) (-776.941) [-781.199] (-771.959) -- 0:00:00
6000 -- (-773.043) (-779.342) (-782.797) [-779.344] * [-773.397] (-779.947) (-776.829) (-773.286) -- 0:00:00
6500 -- [-777.482] (-782.523) (-779.486) (-781.877) * [-778.645] (-780.421) (-776.036) (-776.258) -- 0:00:00
7000 -- (-778.683) [-780.493] (-780.392) (-778.218) * (-774.385) (-777.648) [-790.344] (-774.901) -- 0:00:00
7500 -- (-778.415) [-774.805] (-778.950) (-771.276) * (-774.749) (-779.160) (-778.449) [-772.487] -- 0:00:00
8000 -- (-780.469) [-779.013] (-780.015) (-771.386) * [-774.173] (-782.374) (-775.987) (-772.597) -- 0:00:00
8500 -- [-781.003] (-773.911) (-777.033) (-772.800) * (-776.295) [-777.115] (-778.193) (-773.238) -- 0:00:00
9000 -- (-777.149) [-773.068] (-774.240) (-777.902) * (-776.838) [-776.865] (-784.762) (-772.177) -- 0:00:00
9500 -- [-788.580] (-781.650) (-773.315) (-777.387) * (-776.745) (-778.090) (-779.368) [-772.999] -- 0:00:00
10000 -- (-782.518) [-781.071] (-773.737) (-775.539) * [-777.814] (-783.313) (-775.729) (-773.485) -- 0:00:00
Average standard deviation of split frequencies: 0.101387
10500 -- (-783.144) (-771.419) [-775.764] (-770.823) * [-779.418] (-774.484) (-776.292) (-774.041) -- 0:00:00
11000 -- (-784.179) (-781.559) (-774.714) [-771.912] * [-776.624] (-774.865) (-780.520) (-773.374) -- 0:01:29
11500 -- (-781.088) [-775.883] (-777.639) (-771.852) * [-779.674] (-782.272) (-778.447) (-772.368) -- 0:01:25
12000 -- [-776.893] (-779.559) (-779.503) (-771.822) * [-775.565] (-777.158) (-778.096) (-773.002) -- 0:01:22
12500 -- (-773.558) (-776.256) (-772.217) [-771.520] * [-775.972] (-780.513) (-783.705) (-776.063) -- 0:01:19
13000 -- (-776.036) [-782.056] (-772.792) (-772.527) * [-778.550] (-774.295) (-776.170) (-773.360) -- 0:01:15
13500 -- [-781.183] (-792.949) (-772.616) (-773.932) * [-778.079] (-784.532) (-786.047) (-776.174) -- 0:01:13
14000 -- [-774.844] (-780.615) (-770.478) (-775.925) * [-773.354] (-778.031) (-780.267) (-775.121) -- 0:01:10
14500 -- (-775.172) [-775.715] (-773.878) (-773.909) * (-776.422) [-772.199] (-776.985) (-771.707) -- 0:01:07
15000 -- (-772.926) (-780.460) [-775.749] (-772.926) * (-774.694) (-773.742) (-779.507) [-773.743] -- 0:01:05
Average standard deviation of split frequencies: 0.072882
15500 -- [-775.882] (-775.379) (-772.349) (-772.996) * (-777.514) [-775.502] (-784.409) (-773.508) -- 0:01:03
16000 -- (-774.706) [-774.718] (-773.378) (-771.962) * (-776.153) (-777.194) [-774.954] (-772.932) -- 0:01:01
16500 -- (-774.043) (-783.054) [-774.209] (-774.135) * (-774.958) (-774.186) (-784.999) [-771.350] -- 0:00:59
17000 -- (-780.388) (-776.108) (-771.950) [-774.017] * (-777.303) (-777.988) [-779.933] (-773.019) -- 0:00:57
17500 -- (-784.279) (-778.424) [-773.831] (-772.015) * (-777.668) [-779.086] (-778.199) (-772.206) -- 0:00:56
18000 -- (-778.054) [-778.040] (-775.768) (-773.615) * [-774.117] (-776.646) (-782.013) (-772.472) -- 0:00:54
18500 -- (-780.040) (-772.154) (-772.796) [-772.676] * [-778.172] (-782.598) (-781.145) (-772.939) -- 0:00:53
19000 -- (-779.912) (-772.707) [-772.751] (-773.173) * (-779.453) [-774.123] (-781.962) (-772.901) -- 0:00:51
19500 -- [-774.811] (-773.572) (-773.881) (-772.584) * (-783.253) (-773.863) [-778.933] (-773.810) -- 0:00:50
20000 -- (-782.863) [-772.128] (-773.362) (-771.914) * [-777.462] (-780.219) (-775.998) (-774.431) -- 0:00:49
Average standard deviation of split frequencies: 0.050804
20500 -- (-784.078) (-773.514) (-773.585) [-776.055] * (-780.745) [-780.079] (-778.566) (-774.645) -- 0:00:47
21000 -- (-780.908) (-773.344) (-773.876) [-775.047] * (-777.471) [-777.839] (-782.520) (-773.259) -- 0:00:46
21500 -- [-776.131] (-773.002) (-774.186) (-775.543) * [-775.531] (-773.063) (-776.560) (-775.674) -- 0:00:45
22000 -- (-779.194) (-774.564) (-776.902) [-771.041] * (-775.824) [-774.882] (-780.217) (-771.130) -- 0:00:44
22500 -- [-776.685] (-771.979) (-774.474) (-771.278) * (-788.845) [-786.498] (-778.133) (-772.610) -- 0:00:43
23000 -- (-774.890) [-773.606] (-771.314) (-775.383) * (-780.033) [-775.383] (-776.376) (-771.483) -- 0:00:42
23500 -- (-783.180) (-772.678) (-771.903) [-773.138] * (-775.625) (-777.335) [-785.555] (-773.859) -- 0:00:41
24000 -- [-777.968] (-770.355) (-774.020) (-772.435) * (-775.421) (-777.108) [-774.987] (-773.399) -- 0:00:40
24500 -- (-789.304) (-773.582) (-772.710) [-774.846] * (-774.320) [-776.511] (-773.288) (-773.112) -- 0:00:39
25000 -- [-772.400] (-773.096) (-772.279) (-773.750) * [-774.634] (-779.573) (-773.035) (-773.058) -- 0:00:39
Average standard deviation of split frequencies: 0.031317
25500 -- (-786.405) (-772.880) (-772.155) [-772.837] * (-777.550) [-780.708] (-775.464) (-773.629) -- 0:00:38
26000 -- [-778.656] (-770.199) (-774.221) (-772.488) * [-770.305] (-785.344) (-776.605) (-774.590) -- 0:00:37
26500 -- (-779.767) (-774.018) (-771.335) [-772.818] * [-772.332] (-777.248) (-786.446) (-772.993) -- 0:01:13
27000 -- [-773.322] (-775.610) (-774.207) (-772.018) * (-776.863) [-778.789] (-770.947) (-772.644) -- 0:01:12
27500 -- (-792.939) [-770.314] (-773.126) (-774.076) * [-773.489] (-785.482) (-771.911) (-771.471) -- 0:01:10
28000 -- (-783.470) (-771.753) (-772.987) [-775.802] * (-772.038) (-778.395) (-773.560) [-770.824] -- 0:01:09
28500 -- (-784.331) (-771.777) (-773.126) [-776.564] * (-772.810) (-783.404) [-770.397] (-771.577) -- 0:01:08
29000 -- [-772.168] (-772.701) (-774.894) (-778.054) * (-774.965) [-775.509] (-772.163) (-770.669) -- 0:01:06
29500 -- [-773.299] (-774.676) (-777.859) (-771.183) * (-772.446) [-779.074] (-777.453) (-772.123) -- 0:01:05
30000 -- (-772.983) [-774.114] (-772.847) (-773.382) * (-773.539) [-774.023] (-772.962) (-774.521) -- 0:01:04
Average standard deviation of split frequencies: 0.033980
30500 -- (-772.231) (-774.576) (-775.137) [-775.183] * [-777.819] (-778.279) (-771.757) (-774.056) -- 0:01:03
31000 -- [-771.639] (-776.135) (-775.371) (-774.073) * (-782.616) [-776.867] (-771.443) (-775.047) -- 0:01:02
31500 -- (-772.485) (-773.236) [-771.691] (-771.071) * (-776.724) [-777.562] (-775.689) (-776.215) -- 0:01:01
32000 -- (-772.524) [-772.669] (-772.288) (-770.133) * (-778.943) (-778.214) (-773.487) [-773.001] -- 0:01:00
32500 -- (-773.245) [-771.331] (-774.204) (-773.447) * (-779.240) [-780.269] (-773.141) (-773.410) -- 0:00:59
33000 -- (-771.687) (-772.858) [-772.165] (-772.031) * (-777.587) [-778.123] (-772.256) (-772.895) -- 0:00:58
33500 -- (-773.635) (-771.812) (-771.741) [-771.401] * [-773.756] (-778.757) (-772.803) (-774.011) -- 0:00:57
34000 -- (-772.076) (-771.116) [-771.040] (-770.257) * (-771.023) [-776.234] (-772.074) (-772.580) -- 0:00:56
34500 -- (-771.468) (-770.597) [-772.254] (-773.944) * [-773.232] (-772.641) (-778.961) (-770.084) -- 0:00:55
35000 -- (-772.994) [-773.504] (-772.225) (-772.696) * (-782.924) (-777.638) (-774.257) [-770.919] -- 0:00:55
Average standard deviation of split frequencies: 0.035646
35500 -- [-771.434] (-769.994) (-774.948) (-772.231) * [-773.267] (-777.644) (-773.670) (-771.015) -- 0:00:54
36000 -- (-771.835) (-774.851) (-772.662) [-773.228] * (-776.992) [-780.084] (-772.379) (-770.587) -- 0:00:53
36500 -- (-771.803) (-772.738) (-775.007) [-773.436] * (-780.348) [-777.065] (-775.931) (-772.044) -- 0:00:52
37000 -- (-771.645) (-772.593) [-770.859] (-773.953) * (-774.029) (-776.168) (-774.926) [-771.778] -- 0:00:52
37500 -- (-774.511) (-773.032) (-776.843) [-773.279] * [-772.298] (-781.252) (-772.715) (-771.053) -- 0:00:51
38000 -- [-772.714] (-771.730) (-773.861) (-777.491) * (-778.681) (-776.843) (-772.597) [-770.420] -- 0:00:50
38500 -- (-775.505) (-773.017) (-771.533) [-771.525] * [-773.404] (-775.256) (-775.245) (-771.820) -- 0:00:49
39000 -- (-772.126) (-772.266) (-772.168) [-770.793] * (-777.518) (-776.723) [-777.413] (-775.087) -- 0:00:49
39500 -- (-779.087) (-773.634) (-771.906) [-770.530] * (-790.434) (-774.425) (-774.003) [-773.564] -- 0:00:48
40000 -- (-770.574) (-772.389) [-774.331] (-773.005) * [-784.990] (-773.089) (-775.963) (-773.220) -- 0:00:48
Average standard deviation of split frequencies: 0.031725
40500 -- [-769.404] (-771.554) (-770.175) (-772.173) * (-777.056) (-777.728) [-771.525] (-771.642) -- 0:00:47
41000 -- (-777.971) (-775.899) [-777.040] (-776.046) * (-770.727) [-776.289] (-773.449) (-769.286) -- 0:00:46
41500 -- (-771.577) (-777.326) (-774.023) [-771.761] * (-775.511) (-785.213) (-775.772) [-770.031] -- 0:01:09
42000 -- (-773.976) (-771.562) [-774.158] (-771.176) * [-771.582] (-780.720) (-774.858) (-771.262) -- 0:01:08
42500 -- (-772.520) [-771.687] (-774.582) (-770.669) * [-771.943] (-778.302) (-776.022) (-772.293) -- 0:01:07
43000 -- (-772.404) [-772.535] (-771.492) (-771.859) * (-777.922) [-772.798] (-774.554) (-773.052) -- 0:01:06
43500 -- (-772.945) [-772.244] (-772.843) (-771.807) * (-779.172) (-787.729) (-771.427) [-770.088] -- 0:01:05
44000 -- [-772.058] (-771.345) (-772.741) (-774.057) * (-772.577) (-783.928) (-771.725) [-770.929] -- 0:01:05
44500 -- [-773.102] (-776.652) (-773.989) (-771.901) * (-771.035) (-779.340) [-772.375] (-772.162) -- 0:01:04
45000 -- (-773.940) (-774.557) (-772.465) [-772.312] * (-769.590) [-779.580] (-775.221) (-769.805) -- 0:01:03
Average standard deviation of split frequencies: 0.025864
45500 -- (-777.485) (-771.402) [-774.592] (-773.355) * [-772.127] (-775.167) (-772.651) (-775.990) -- 0:01:02
46000 -- [-772.999] (-772.567) (-773.120) (-779.849) * [-774.563] (-772.420) (-774.166) (-773.374) -- 0:01:02
46500 -- (-771.158) (-773.900) (-773.761) [-776.791] * [-771.435] (-781.903) (-774.686) (-773.851) -- 0:01:01
47000 -- (-769.935) [-773.216] (-773.299) (-773.065) * (-773.965) (-787.633) (-771.209) [-772.061] -- 0:01:00
47500 -- (-775.086) (-771.589) [-774.233] (-772.076) * (-772.502) (-770.721) (-776.201) [-771.916] -- 0:01:00
48000 -- (-775.560) (-773.162) (-775.235) [-770.946] * (-777.431) [-777.269] (-771.771) (-770.871) -- 0:00:59
48500 -- (-771.249) (-776.877) (-776.059) [-773.081] * (-773.498) (-773.438) (-773.446) [-772.972] -- 0:00:58
49000 -- [-772.673] (-779.009) (-770.942) (-771.849) * (-776.445) (-775.562) [-771.724] (-771.642) -- 0:00:58
49500 -- (-774.134) [-771.092] (-772.783) (-772.820) * (-778.255) [-780.268] (-772.246) (-772.082) -- 0:00:57
50000 -- (-773.192) [-770.636] (-774.774) (-777.078) * (-778.451) (-772.016) (-774.847) [-772.423] -- 0:00:57
Average standard deviation of split frequencies: 0.031634
50500 -- (-770.804) [-771.275] (-773.963) (-775.239) * [-775.799] (-772.962) (-772.589) (-770.524) -- 0:00:56
51000 -- (-772.799) (-771.981) [-774.512] (-772.092) * (-772.576) [-773.628] (-772.103) (-777.261) -- 0:00:55
51500 -- [-772.005] (-770.922) (-771.955) (-772.907) * (-775.684) (-779.181) (-773.167) [-773.021] -- 0:00:55
52000 -- (-775.176) [-771.033] (-773.605) (-772.884) * (-771.895) (-775.207) [-775.136] (-776.066) -- 0:00:54
52500 -- (-771.754) (-774.816) [-771.244] (-770.397) * (-771.061) (-779.038) (-780.422) [-771.969] -- 0:00:54
53000 -- (-771.522) [-771.704] (-773.500) (-769.276) * (-771.656) (-786.583) (-772.889) [-771.916] -- 0:00:53
53500 -- (-773.178) (-776.198) [-772.752] (-772.418) * [-773.308] (-776.418) (-772.902) (-775.397) -- 0:00:53
54000 -- (-771.644) (-776.146) [-772.252] (-774.685) * (-772.371) [-780.697] (-773.902) (-773.764) -- 0:00:52
54500 -- (-771.367) (-773.466) [-773.652] (-771.607) * (-774.401) (-775.935) (-772.812) [-772.164] -- 0:00:52
55000 -- (-772.486) (-773.288) (-774.244) [-771.494] * (-775.493) (-774.109) [-772.625] (-771.911) -- 0:00:51
Average standard deviation of split frequencies: 0.033229
55500 -- (-773.203) [-774.170] (-772.983) (-776.132) * (-773.566) (-773.340) [-776.527] (-775.085) -- 0:00:51
56000 -- (-774.737) (-770.323) (-774.585) [-774.332] * (-772.400) [-773.860] (-773.494) (-774.316) -- 0:00:50
56500 -- [-771.151] (-775.341) (-773.095) (-773.689) * (-774.901) (-774.674) [-773.126] (-777.186) -- 0:00:50
57000 -- (-771.752) [-776.636] (-773.399) (-773.364) * (-774.076) [-771.825] (-774.412) (-783.119) -- 0:01:06
57500 -- (-772.672) (-773.397) [-773.970] (-772.621) * (-772.574) [-773.073] (-774.663) (-777.978) -- 0:01:05
58000 -- (-771.703) [-772.684] (-773.409) (-772.384) * (-776.210) (-773.337) (-773.010) [-774.959] -- 0:01:04
58500 -- (-769.527) [-770.231] (-773.769) (-774.120) * (-773.935) (-773.072) (-773.887) [-772.586] -- 0:01:04
59000 -- [-771.120] (-771.585) (-773.672) (-776.770) * (-774.924) (-778.972) (-774.268) [-775.056] -- 0:01:03
59500 -- [-771.442] (-773.767) (-774.330) (-771.624) * (-772.731) (-774.854) [-774.540] (-773.709) -- 0:01:03
60000 -- (-775.434) (-772.485) (-772.560) [-773.027] * (-773.930) (-773.762) (-774.581) [-774.259] -- 0:01:02
Average standard deviation of split frequencies: 0.032453
60500 -- [-772.903] (-772.476) (-776.715) (-771.539) * (-773.739) (-775.824) (-772.708) [-772.187] -- 0:01:02
61000 -- [-770.380] (-772.216) (-772.949) (-774.008) * (-776.710) (-775.840) (-774.428) [-772.841] -- 0:01:01
61500 -- [-772.762] (-772.439) (-772.684) (-772.283) * (-772.836) [-774.487] (-772.087) (-773.803) -- 0:01:01
62000 -- (-772.909) [-774.970] (-776.007) (-771.134) * (-773.107) (-774.742) (-772.497) [-774.645] -- 0:01:00
62500 -- (-774.019) [-774.368] (-771.425) (-775.327) * (-775.439) (-774.950) (-771.978) [-772.253] -- 0:01:00
63000 -- [-770.615] (-772.930) (-772.263) (-773.502) * (-773.034) [-773.208] (-777.022) (-771.577) -- 0:00:59
63500 -- [-776.619] (-770.325) (-772.443) (-772.307) * (-772.529) (-773.507) (-769.111) [-771.505] -- 0:00:58
64000 -- (-775.175) (-771.678) (-771.908) [-775.157] * (-773.381) (-774.185) [-774.380] (-774.369) -- 0:00:58
64500 -- (-775.806) (-772.505) (-773.168) [-773.079] * (-770.896) (-781.543) [-772.957] (-773.232) -- 0:00:58
65000 -- (-776.617) (-773.044) [-772.064] (-772.895) * [-771.832] (-769.810) (-774.337) (-777.943) -- 0:00:57
Average standard deviation of split frequencies: 0.030356
65500 -- [-772.880] (-774.636) (-773.764) (-777.396) * (-772.366) (-772.614) (-772.967) [-771.991] -- 0:00:57
66000 -- (-771.864) [-772.530] (-772.934) (-775.978) * (-773.396) (-772.959) [-772.094] (-771.524) -- 0:00:56
66500 -- (-771.371) (-772.396) (-773.012) [-773.321] * (-775.514) (-773.594) [-773.152] (-773.493) -- 0:00:56
67000 -- (-774.300) (-770.980) [-770.688] (-775.009) * [-772.386] (-773.107) (-773.678) (-773.408) -- 0:00:55
67500 -- (-773.546) (-774.451) [-772.080] (-773.239) * [-772.223] (-772.511) (-770.930) (-770.264) -- 0:00:55
68000 -- (-773.122) (-773.461) (-772.571) [-773.049] * (-773.653) [-773.403] (-771.954) (-771.109) -- 0:00:54
68500 -- (-770.930) (-772.315) (-771.931) [-772.876] * (-772.656) (-771.256) [-774.085] (-771.751) -- 0:00:54
69000 -- [-777.497] (-772.473) (-777.917) (-775.581) * [-772.817] (-772.039) (-770.942) (-776.630) -- 0:00:53
69500 -- [-773.707] (-771.912) (-773.539) (-771.915) * (-773.737) (-772.088) (-772.625) [-773.100] -- 0:00:53
70000 -- [-772.330] (-779.279) (-773.409) (-775.408) * (-773.213) (-771.669) [-771.310] (-772.583) -- 0:00:53
Average standard deviation of split frequencies: 0.027636
70500 -- (-774.659) [-772.981] (-772.753) (-780.249) * (-773.369) (-775.053) [-771.152] (-771.115) -- 0:00:52
71000 -- (-770.094) [-772.228] (-775.766) (-773.066) * (-776.858) (-772.437) [-774.057] (-770.798) -- 0:00:52
71500 -- [-770.767] (-772.779) (-771.757) (-775.818) * (-777.456) (-773.962) [-772.656] (-770.993) -- 0:00:51
72000 -- (-773.004) (-774.359) (-774.015) [-773.230] * (-774.558) (-771.085) [-773.540] (-770.721) -- 0:00:51
72500 -- (-773.894) [-770.482] (-774.125) (-773.773) * (-775.208) (-771.869) [-772.155] (-776.469) -- 0:01:03
73000 -- (-772.364) [-771.045] (-773.441) (-772.103) * [-772.861] (-771.218) (-771.215) (-773.041) -- 0:01:03
73500 -- (-771.673) (-772.206) [-772.556] (-773.726) * (-775.111) [-771.570] (-775.139) (-769.758) -- 0:01:03
74000 -- (-773.928) [-772.758] (-772.346) (-772.431) * (-772.558) [-775.489] (-770.401) (-774.898) -- 0:01:02
74500 -- (-779.458) [-774.370] (-772.398) (-772.804) * (-772.591) (-774.481) (-770.723) [-770.832] -- 0:01:02
75000 -- (-775.008) (-775.053) (-774.142) [-773.472] * (-771.640) (-773.171) (-773.559) [-773.446] -- 0:01:01
Average standard deviation of split frequencies: 0.025697
75500 -- [-772.905] (-776.856) (-772.261) (-773.910) * [-772.555] (-769.841) (-771.075) (-773.061) -- 0:01:01
76000 -- (-772.845) (-773.060) [-771.594] (-773.437) * (-775.338) (-771.386) (-774.094) [-772.472] -- 0:01:00
76500 -- (-772.808) (-777.267) (-773.188) [-774.409] * (-774.890) (-770.720) [-773.267] (-769.748) -- 0:01:00
77000 -- (-772.657) [-771.263] (-772.180) (-776.602) * [-773.095] (-771.512) (-771.580) (-770.536) -- 0:00:59
77500 -- (-777.261) (-771.717) [-773.785] (-775.289) * (-773.076) [-771.892] (-773.315) (-771.572) -- 0:00:59
78000 -- (-775.432) (-773.714) [-770.914] (-773.034) * (-775.582) (-771.633) [-771.787] (-771.533) -- 0:00:59
78500 -- [-774.428] (-772.723) (-771.679) (-770.939) * (-773.972) (-775.145) (-771.664) [-773.228] -- 0:00:58
79000 -- (-773.381) [-771.800] (-773.339) (-770.597) * (-773.847) (-771.321) [-770.439] (-772.360) -- 0:00:58
79500 -- (-773.318) (-770.431) [-774.506] (-772.293) * (-774.386) [-773.061] (-774.402) (-772.294) -- 0:00:57
80000 -- (-775.055) [-773.684] (-771.486) (-775.080) * [-771.835] (-773.405) (-771.151) (-772.238) -- 0:00:57
Average standard deviation of split frequencies: 0.020915
80500 -- (-773.737) [-772.116] (-770.924) (-775.622) * (-773.265) (-771.093) (-771.285) [-773.140] -- 0:00:57
81000 -- (-774.161) (-771.769) (-775.511) [-773.775] * (-774.527) [-772.952] (-774.256) (-778.675) -- 0:00:56
81500 -- (-771.606) [-772.757] (-779.387) (-773.785) * (-773.375) (-775.608) (-770.758) [-772.496] -- 0:00:56
82000 -- (-778.387) (-773.562) (-772.204) [-773.265] * (-774.280) (-772.435) [-772.202] (-774.253) -- 0:00:55
82500 -- (-772.459) (-772.258) (-773.939) [-771.607] * (-780.686) (-772.313) [-770.348] (-777.462) -- 0:00:55
83000 -- (-773.254) (-772.363) [-771.036] (-775.226) * (-775.908) [-771.781] (-769.498) (-770.272) -- 0:00:55
83500 -- (-771.426) (-776.812) [-774.479] (-772.697) * (-773.855) [-771.165] (-770.222) (-772.452) -- 0:00:54
84000 -- [-775.533] (-774.194) (-776.030) (-771.203) * (-773.600) (-771.718) (-772.690) [-773.278] -- 0:00:54
84500 -- [-775.442] (-770.814) (-777.521) (-774.140) * (-776.819) (-771.361) (-771.527) [-772.161] -- 0:00:54
85000 -- [-773.694] (-772.549) (-770.782) (-771.883) * (-776.659) (-775.394) [-773.072] (-774.160) -- 0:00:53
Average standard deviation of split frequencies: 0.019316
85500 -- (-772.528) (-771.554) [-774.216] (-771.814) * [-775.361] (-773.648) (-773.292) (-774.970) -- 0:00:53
86000 -- (-775.467) (-773.133) (-777.605) [-775.746] * (-772.786) (-777.562) [-774.355] (-772.789) -- 0:00:53
86500 -- (-774.191) (-773.898) (-773.854) [-774.043] * [-775.894] (-771.338) (-775.334) (-774.072) -- 0:00:52
87000 -- (-772.275) (-774.812) (-772.140) [-776.608] * [-772.298] (-772.738) (-773.423) (-773.509) -- 0:00:52
87500 -- (-772.266) (-770.994) (-774.122) [-777.033] * (-772.593) [-773.075] (-777.077) (-773.377) -- 0:00:52
88000 -- (-773.653) [-770.467] (-773.796) (-772.414) * (-773.876) (-774.852) [-773.619] (-773.641) -- 0:01:02
88500 -- (-773.378) [-772.438] (-772.909) (-772.566) * [-777.454] (-773.278) (-772.126) (-774.103) -- 0:01:01
89000 -- (-775.189) (-773.215) [-772.897] (-774.262) * (-774.563) (-773.163) (-770.828) [-770.863] -- 0:01:01
89500 -- [-775.300] (-772.286) (-772.198) (-771.608) * (-774.595) (-775.032) [-770.887] (-773.327) -- 0:01:01
90000 -- (-773.069) (-773.451) [-772.664] (-775.876) * (-774.361) (-771.718) [-774.369] (-773.124) -- 0:01:00
Average standard deviation of split frequencies: 0.022283
90500 -- (-777.915) (-775.552) (-775.205) [-775.469] * (-772.879) (-774.956) (-772.663) [-772.025] -- 0:01:00
91000 -- (-773.816) [-771.366] (-777.010) (-775.159) * (-774.187) (-772.276) [-774.107] (-772.581) -- 0:00:59
91500 -- (-774.820) (-770.254) [-771.696] (-778.105) * [-774.347] (-770.842) (-773.251) (-771.956) -- 0:00:59
92000 -- (-774.733) (-773.030) [-772.892] (-772.565) * [-772.460] (-771.884) (-772.322) (-774.727) -- 0:00:59
92500 -- [-778.460] (-775.908) (-770.914) (-773.614) * [-772.964] (-771.456) (-772.864) (-773.143) -- 0:00:58
93000 -- [-774.885] (-775.468) (-772.068) (-773.285) * [-772.439] (-771.702) (-773.845) (-771.539) -- 0:00:58
93500 -- (-772.353) (-772.315) (-775.062) [-773.056] * (-775.271) [-772.665] (-771.048) (-772.380) -- 0:00:58
94000 -- (-772.490) [-774.751] (-772.105) (-774.967) * (-775.980) (-776.437) (-770.654) [-773.362] -- 0:00:57
94500 -- (-773.830) (-772.169) [-772.767] (-773.005) * (-775.541) (-771.742) [-771.225] (-774.277) -- 0:00:57
95000 -- (-774.952) (-773.231) (-773.110) [-772.059] * (-770.983) (-775.669) (-775.080) [-773.088] -- 0:00:57
Average standard deviation of split frequencies: 0.022097
95500 -- (-773.613) (-770.759) [-772.774] (-773.501) * [-770.857] (-775.756) (-774.371) (-777.924) -- 0:00:56
96000 -- (-771.970) [-771.698] (-773.789) (-775.266) * [-775.760] (-774.649) (-777.011) (-773.603) -- 0:00:56
96500 -- (-774.905) [-772.373] (-776.007) (-773.803) * (-777.134) (-773.994) (-774.987) [-771.680] -- 0:00:56
97000 -- (-772.785) (-773.757) [-771.576] (-771.968) * (-774.713) (-774.896) (-774.805) [-775.927] -- 0:00:55
97500 -- (-774.355) (-772.495) (-774.786) [-773.382] * (-771.422) [-773.707] (-772.092) (-774.293) -- 0:00:55
98000 -- (-773.225) (-771.562) [-776.162] (-774.167) * (-772.316) (-775.938) [-775.855] (-772.781) -- 0:00:55
98500 -- (-772.741) (-771.705) (-773.741) [-772.037] * (-774.407) (-775.242) [-769.924] (-772.779) -- 0:00:54
99000 -- (-772.274) [-772.910] (-774.169) (-777.216) * (-775.986) (-772.746) [-772.320] (-774.821) -- 0:00:54
99500 -- [-773.118] (-770.780) (-772.355) (-776.509) * (-774.940) (-773.988) [-773.029] (-772.377) -- 0:00:54
100000 -- (-773.581) (-770.535) (-773.970) [-777.046] * (-774.366) (-774.566) [-770.362] (-773.764) -- 0:00:54
Average standard deviation of split frequencies: 0.022522
100500 -- (-773.622) (-772.087) (-773.321) [-773.384] * (-775.002) (-772.393) (-772.225) [-771.235] -- 0:00:53
101000 -- (-774.015) (-775.025) (-772.085) [-774.843] * (-773.282) [-774.986] (-772.242) (-771.583) -- 0:00:53
101500 -- (-772.804) [-774.199] (-772.039) (-772.270) * (-770.399) (-772.837) (-772.002) [-772.638] -- 0:00:53
102000 -- (-774.673) (-773.898) (-774.106) [-772.531] * (-774.278) [-771.713] (-774.449) (-780.703) -- 0:00:52
102500 -- (-775.151) [-772.325] (-774.379) (-774.408) * (-776.376) [-771.830] (-774.029) (-771.593) -- 0:00:52
103000 -- (-774.523) (-771.331) [-773.666] (-771.672) * [-774.619] (-771.018) (-772.653) (-778.222) -- 0:01:00
103500 -- (-773.096) (-770.587) (-772.519) [-770.230] * [-772.691] (-772.419) (-773.716) (-771.677) -- 0:01:00
104000 -- (-774.103) [-776.120] (-772.884) (-772.623) * [-771.869] (-772.462) (-772.328) (-774.244) -- 0:01:00
104500 -- [-774.313] (-773.507) (-772.517) (-769.800) * (-773.029) (-774.007) (-773.253) [-775.114] -- 0:00:59
105000 -- [-774.099] (-772.520) (-775.525) (-771.266) * (-772.788) [-776.935] (-779.818) (-774.846) -- 0:00:59
Average standard deviation of split frequencies: 0.021630
105500 -- (-773.849) (-771.278) (-772.731) [-770.711] * (-772.596) (-773.066) (-773.065) [-775.518] -- 0:00:59
106000 -- (-782.536) (-773.092) (-774.060) [-769.622] * (-772.304) [-772.649] (-772.065) (-774.201) -- 0:00:59
106500 -- [-772.834] (-777.911) (-771.923) (-776.861) * (-772.710) [-772.722] (-771.317) (-773.657) -- 0:00:58
107000 -- (-773.309) (-774.974) (-774.979) [-775.517] * (-775.728) (-773.343) [-771.370] (-772.745) -- 0:00:58
107500 -- (-778.134) (-774.642) (-772.625) [-770.542] * (-775.263) (-772.882) (-771.397) [-772.747] -- 0:00:58
108000 -- (-773.405) (-776.468) (-773.696) [-771.198] * [-774.394] (-771.698) (-771.060) (-773.327) -- 0:00:57
108500 -- (-775.153) [-773.467] (-772.726) (-769.707) * (-772.159) (-777.618) [-772.749] (-772.051) -- 0:00:57
109000 -- (-774.067) (-773.692) (-772.207) [-771.180] * (-779.411) [-774.514] (-772.241) (-775.631) -- 0:00:57
109500 -- (-774.512) (-772.341) (-772.672) [-769.313] * (-772.324) (-774.431) [-771.602] (-772.582) -- 0:00:56
110000 -- (-772.678) (-776.448) (-775.568) [-773.105] * (-774.799) (-771.444) (-773.848) [-773.181] -- 0:00:56
Average standard deviation of split frequencies: 0.021298
110500 -- (-774.016) (-772.679) (-772.224) [-771.569] * (-773.867) (-773.978) [-772.547] (-772.764) -- 0:00:56
111000 -- [-773.468] (-770.957) (-775.507) (-777.647) * (-775.962) (-772.937) [-770.860] (-776.325) -- 0:00:56
111500 -- (-771.641) [-773.379] (-773.862) (-770.776) * (-772.390) (-773.524) (-775.456) [-771.377] -- 0:00:55
112000 -- (-773.571) (-773.774) [-773.486] (-770.589) * (-775.060) (-772.439) [-773.309] (-774.932) -- 0:00:55
112500 -- [-772.978] (-774.860) (-774.374) (-771.365) * (-771.426) (-772.277) [-773.087] (-777.295) -- 0:00:55
113000 -- (-772.834) (-778.373) [-770.953] (-774.471) * (-774.513) [-773.110] (-772.414) (-774.456) -- 0:00:54
113500 -- (-771.410) [-772.284] (-773.406) (-771.412) * (-770.595) (-773.036) (-773.475) [-769.940] -- 0:00:54
114000 -- (-773.712) (-772.961) (-773.239) [-773.719] * (-771.651) [-770.759] (-771.676) (-772.502) -- 0:00:54
114500 -- (-772.879) [-770.100] (-773.974) (-771.270) * (-771.298) (-772.798) [-773.121] (-775.174) -- 0:00:54
115000 -- (-772.421) (-769.411) [-773.216] (-773.668) * (-772.746) (-774.104) [-775.093] (-772.660) -- 0:00:53
Average standard deviation of split frequencies: 0.019158
115500 -- [-773.487] (-779.942) (-773.224) (-770.262) * (-770.297) [-773.313] (-777.740) (-773.303) -- 0:00:53
116000 -- (-773.801) [-774.730] (-772.887) (-772.501) * (-773.482) (-772.718) [-771.458] (-774.313) -- 0:00:53
116500 -- (-771.769) [-771.888] (-771.564) (-774.786) * (-771.784) (-773.168) (-776.787) [-772.911] -- 0:00:53
117000 -- [-772.041] (-769.869) (-772.900) (-775.797) * [-771.198] (-773.269) (-772.156) (-777.857) -- 0:00:52
117500 -- (-772.645) (-771.210) (-771.807) [-775.861] * (-771.054) [-772.669] (-771.990) (-774.047) -- 0:00:52
118000 -- [-770.411] (-769.930) (-771.641) (-771.920) * (-770.981) [-773.918] (-772.772) (-772.020) -- 0:00:52
118500 -- (-775.311) (-771.052) (-771.766) [-773.212] * [-770.886] (-770.687) (-773.679) (-772.108) -- 0:00:59
119000 -- [-772.029] (-772.180) (-771.925) (-775.160) * [-772.014] (-773.520) (-773.743) (-774.060) -- 0:00:59
119500 -- (-774.470) [-773.419] (-773.710) (-776.912) * [-770.125] (-770.962) (-772.622) (-775.647) -- 0:00:58
120000 -- [-771.062] (-771.710) (-773.485) (-771.279) * (-773.719) (-771.664) [-773.161] (-773.698) -- 0:00:58
Average standard deviation of split frequencies: 0.018361
120500 -- [-773.876] (-772.773) (-774.296) (-774.228) * (-771.746) [-772.699] (-776.023) (-775.814) -- 0:00:58
121000 -- (-770.926) (-773.039) [-771.674] (-772.720) * (-772.280) [-772.445] (-772.914) (-775.049) -- 0:00:58
121500 -- (-777.409) (-770.477) [-775.414] (-773.301) * (-773.845) (-771.549) (-771.997) [-774.046] -- 0:00:57
122000 -- (-777.855) [-774.232] (-774.066) (-772.590) * (-771.463) [-771.423] (-773.315) (-772.789) -- 0:00:57
122500 -- (-773.738) (-777.178) (-775.310) [-770.628] * (-772.125) (-774.846) [-772.977] (-772.742) -- 0:00:57
123000 -- [-776.258] (-772.623) (-780.748) (-772.797) * (-770.469) [-771.779] (-772.921) (-772.620) -- 0:00:57
123500 -- (-774.864) [-770.861] (-771.360) (-774.935) * (-771.945) (-770.733) [-773.035] (-771.814) -- 0:00:56
124000 -- [-772.432] (-777.415) (-771.241) (-776.238) * (-772.679) (-771.645) [-772.048] (-771.924) -- 0:00:56
124500 -- [-769.376] (-775.308) (-773.141) (-773.469) * (-774.098) [-772.579] (-774.884) (-772.501) -- 0:00:56
125000 -- (-770.597) [-772.356] (-775.878) (-772.382) * (-775.614) [-774.381] (-778.465) (-775.125) -- 0:00:56
Average standard deviation of split frequencies: 0.015339
125500 -- (-771.468) (-776.164) [-771.955] (-771.719) * (-774.590) (-770.905) [-772.069] (-776.188) -- 0:00:55
126000 -- (-771.505) (-773.009) (-772.639) [-771.131] * [-774.954] (-771.792) (-771.920) (-775.661) -- 0:00:55
126500 -- [-774.229] (-773.312) (-772.947) (-773.584) * (-773.153) (-774.533) (-774.257) [-771.130] -- 0:00:55
127000 -- (-771.048) (-773.231) (-774.498) [-771.962] * (-774.684) (-771.259) [-772.970] (-775.194) -- 0:00:54
127500 -- (-775.639) (-779.427) (-773.507) [-773.588] * (-773.934) (-774.844) [-772.610] (-775.169) -- 0:00:54
128000 -- (-773.888) [-771.724] (-773.363) (-774.432) * (-775.236) (-772.655) [-776.293] (-773.074) -- 0:00:54
128500 -- (-772.656) [-774.360] (-774.783) (-772.010) * (-772.585) (-771.287) [-773.090] (-773.840) -- 0:00:54
129000 -- (-770.620) [-775.925] (-773.593) (-772.659) * (-774.614) [-771.602] (-775.394) (-772.784) -- 0:00:54
129500 -- [-773.305] (-772.478) (-772.239) (-772.402) * [-773.534] (-771.694) (-776.372) (-774.804) -- 0:00:53
130000 -- [-773.032] (-770.455) (-772.210) (-772.827) * (-773.698) (-770.265) [-774.115] (-774.505) -- 0:00:53
Average standard deviation of split frequencies: 0.017317
130500 -- (-772.041) (-772.132) [-772.707] (-773.281) * (-775.301) (-772.943) [-774.679] (-774.081) -- 0:00:53
131000 -- [-774.669] (-773.517) (-773.238) (-773.255) * (-772.992) (-770.845) (-773.018) [-773.772] -- 0:00:53
131500 -- [-781.979] (-774.000) (-776.600) (-774.161) * [-775.112] (-772.299) (-774.320) (-778.232) -- 0:00:52
132000 -- (-770.724) (-773.594) [-773.007] (-776.777) * [-772.177] (-770.538) (-772.561) (-772.123) -- 0:00:52
132500 -- (-772.419) [-772.978] (-773.035) (-773.896) * (-774.839) (-772.082) (-772.084) [-771.223] -- 0:00:52
133000 -- (-774.951) (-772.065) (-775.199) [-772.691] * (-773.138) (-770.518) [-771.623] (-773.516) -- 0:00:52
133500 -- (-774.685) [-770.177] (-772.385) (-772.545) * [-772.569] (-775.168) (-773.470) (-783.583) -- 0:00:51
134000 -- (-774.573) (-770.754) [-773.304] (-772.192) * (-773.034) (-775.143) (-772.354) [-773.423] -- 0:00:58
134500 -- (-774.631) (-772.196) [-773.107] (-774.527) * (-771.402) (-771.560) (-780.370) [-772.053] -- 0:00:57
135000 -- (-778.048) [-773.258] (-775.023) (-775.367) * (-773.017) (-770.202) (-774.856) [-770.434] -- 0:00:57
Average standard deviation of split frequencies: 0.015142
135500 -- (-774.740) [-771.826] (-773.545) (-775.949) * [-771.146] (-771.735) (-772.952) (-771.717) -- 0:00:57
136000 -- (-772.708) [-771.785] (-773.473) (-774.557) * (-772.612) (-772.666) [-773.238] (-777.210) -- 0:00:57
136500 -- [-775.149] (-776.388) (-772.079) (-773.147) * (-775.911) (-781.450) (-773.214) [-773.154] -- 0:00:56
137000 -- [-772.230] (-772.764) (-773.963) (-773.044) * (-773.413) (-787.371) [-773.107] (-771.745) -- 0:00:56
137500 -- (-772.427) (-773.703) (-773.803) [-772.498] * (-774.128) [-783.377] (-771.867) (-772.506) -- 0:00:56
138000 -- [-773.434] (-770.469) (-774.350) (-772.923) * (-771.659) [-774.653] (-773.776) (-773.787) -- 0:00:56
138500 -- (-771.721) (-772.030) [-773.529] (-772.760) * (-775.354) (-776.085) (-772.818) [-770.215] -- 0:00:55
139000 -- (-777.078) (-772.394) (-774.376) [-773.562] * (-771.905) (-774.010) [-775.704] (-773.799) -- 0:00:55
139500 -- (-774.121) [-771.608] (-779.428) (-773.195) * [-771.525] (-772.677) (-773.906) (-771.283) -- 0:00:55
140000 -- (-775.146) (-771.887) (-770.505) [-774.262] * (-772.110) (-772.122) [-773.010] (-774.575) -- 0:00:55
Average standard deviation of split frequencies: 0.016756
140500 -- (-775.421) (-774.660) [-772.031] (-772.092) * (-770.756) (-774.296) [-772.479] (-775.973) -- 0:00:55
141000 -- [-773.358] (-772.186) (-771.109) (-774.349) * (-772.212) (-771.640) (-773.888) [-773.044] -- 0:00:54
141500 -- (-774.436) (-772.051) [-771.996] (-774.472) * (-771.835) (-770.140) [-773.949] (-772.336) -- 0:00:54
142000 -- (-773.235) [-772.308] (-774.657) (-773.543) * (-770.772) (-773.153) (-772.852) [-771.685] -- 0:00:54
142500 -- (-775.253) [-772.408] (-771.233) (-775.477) * (-771.005) [-771.405] (-771.480) (-771.958) -- 0:00:54
143000 -- [-774.933] (-771.803) (-773.242) (-775.331) * (-773.239) (-774.827) (-774.498) [-773.641] -- 0:00:53
143500 -- (-773.376) (-772.492) (-772.486) [-772.723] * (-772.368) [-772.556] (-774.671) (-774.314) -- 0:00:53
144000 -- (-774.330) (-773.358) [-770.174] (-777.323) * [-772.410] (-776.771) (-772.025) (-776.224) -- 0:00:53
144500 -- (-772.075) (-775.179) [-774.117] (-772.166) * [-769.894] (-777.615) (-776.829) (-774.104) -- 0:00:53
145000 -- (-775.285) (-775.710) (-771.556) [-772.828] * (-772.342) [-774.637] (-774.292) (-772.657) -- 0:00:53
Average standard deviation of split frequencies: 0.015983
145500 -- (-772.311) (-772.223) (-772.586) [-773.525] * (-775.014) (-772.666) (-772.277) [-772.256] -- 0:00:52
146000 -- (-776.971) [-772.496] (-772.025) (-773.937) * [-773.906] (-774.255) (-776.833) (-775.665) -- 0:00:52
146500 -- (-772.229) (-773.794) [-769.786] (-774.992) * (-773.597) (-773.161) (-773.309) [-772.225] -- 0:00:52
147000 -- [-773.174] (-772.846) (-771.116) (-776.962) * (-771.962) (-775.060) [-773.757] (-769.977) -- 0:00:52
147500 -- (-772.904) (-776.249) [-771.438] (-775.577) * [-774.099] (-774.561) (-770.366) (-774.208) -- 0:00:52
148000 -- (-772.787) (-771.442) (-770.827) [-772.607] * (-772.490) (-772.183) [-771.224] (-772.850) -- 0:00:51
148500 -- (-772.264) (-771.811) (-771.377) [-775.102] * (-771.030) (-771.195) [-774.048] (-773.369) -- 0:00:51
149000 -- [-772.240] (-774.133) (-772.436) (-776.180) * (-772.165) [-771.725] (-772.932) (-774.934) -- 0:00:57
149500 -- (-772.416) (-776.738) [-770.793] (-774.037) * (-773.485) [-771.724] (-776.753) (-771.459) -- 0:00:56
150000 -- (-773.104) [-772.959] (-770.452) (-774.796) * (-771.490) (-772.709) (-775.597) [-773.329] -- 0:00:56
Average standard deviation of split frequencies: 0.013833
150500 -- (-773.217) [-773.944] (-775.562) (-776.839) * (-774.089) [-772.430] (-776.054) (-774.351) -- 0:00:56
151000 -- (-773.205) (-773.715) [-772.525] (-774.781) * (-772.363) (-774.530) (-770.895) [-774.343] -- 0:00:56
151500 -- [-773.847] (-776.005) (-776.322) (-774.519) * [-771.061] (-773.045) (-772.003) (-775.422) -- 0:00:56
152000 -- (-772.790) [-773.799] (-773.406) (-772.570) * [-773.086] (-772.412) (-772.830) (-771.542) -- 0:00:55
152500 -- (-771.116) (-780.310) (-771.842) [-773.138] * [-772.479] (-772.832) (-770.798) (-772.421) -- 0:00:55
153000 -- (-771.466) (-779.416) [-772.632] (-773.706) * [-774.240] (-776.060) (-774.651) (-774.046) -- 0:00:55
153500 -- (-773.866) [-771.675] (-770.568) (-777.400) * (-773.814) (-773.821) (-774.728) [-773.186] -- 0:00:55
154000 -- (-771.946) (-772.754) (-769.869) [-774.293] * (-771.417) [-773.142] (-771.410) (-770.915) -- 0:00:54
154500 -- (-772.443) (-773.616) (-771.850) [-773.901] * (-772.248) (-773.678) [-771.636] (-775.048) -- 0:00:54
155000 -- [-774.333] (-774.066) (-775.985) (-779.385) * (-772.813) [-772.296] (-772.117) (-774.269) -- 0:00:54
Average standard deviation of split frequencies: 0.013678
155500 -- (-773.207) (-773.183) (-770.815) [-771.329] * (-772.058) [-773.134] (-772.603) (-772.936) -- 0:00:54
156000 -- (-774.914) (-773.185) [-771.059] (-775.931) * [-771.769] (-774.900) (-773.087) (-776.314) -- 0:00:54
156500 -- (-771.850) (-772.966) [-771.405] (-773.564) * (-773.727) [-773.995] (-776.919) (-773.219) -- 0:00:53
157000 -- (-773.141) (-772.767) (-772.612) [-771.782] * (-775.249) (-773.941) [-773.369] (-771.751) -- 0:00:53
157500 -- [-773.653] (-774.752) (-772.266) (-773.492) * (-774.403) [-773.748] (-772.515) (-771.790) -- 0:00:53
158000 -- (-772.443) (-773.151) (-773.079) [-773.709] * (-774.846) [-773.207] (-782.688) (-770.362) -- 0:00:53
158500 -- (-772.597) (-773.201) (-774.033) [-774.115] * [-771.888] (-772.546) (-773.268) (-773.754) -- 0:00:53
159000 -- [-771.688] (-771.603) (-775.604) (-773.818) * (-772.010) [-773.003] (-770.593) (-771.287) -- 0:00:52
159500 -- [-773.396] (-771.974) (-773.699) (-776.282) * (-776.042) (-772.991) [-774.248] (-770.115) -- 0:00:52
160000 -- (-771.056) [-773.488] (-771.195) (-776.714) * [-774.545] (-771.804) (-772.500) (-772.833) -- 0:00:52
Average standard deviation of split frequencies: 0.012045
160500 -- [-774.683] (-772.258) (-774.405) (-777.444) * (-771.737) [-772.394] (-772.830) (-774.124) -- 0:00:52
161000 -- (-771.852) (-776.877) [-772.345] (-774.450) * (-775.664) [-769.897] (-774.419) (-772.108) -- 0:00:52
161500 -- (-773.376) [-773.232] (-771.663) (-772.675) * (-776.310) (-772.736) (-775.561) [-777.053] -- 0:00:51
162000 -- [-775.137] (-773.445) (-771.523) (-773.542) * [-777.093] (-773.425) (-770.565) (-774.198) -- 0:00:51
162500 -- (-773.630) [-775.811] (-772.273) (-772.050) * (-773.378) [-772.366] (-771.053) (-771.056) -- 0:00:51
163000 -- (-772.777) (-772.800) (-778.707) [-772.431] * (-772.613) (-773.564) (-777.187) [-770.406] -- 0:00:51
163500 -- [-772.423] (-772.532) (-775.886) (-774.400) * (-772.584) (-771.758) (-772.255) [-771.883] -- 0:00:51
164000 -- (-772.446) [-773.784] (-773.794) (-773.330) * (-771.349) (-773.378) [-773.599] (-773.420) -- 0:00:56
164500 -- (-772.216) [-772.343] (-775.291) (-774.702) * (-774.561) (-771.928) (-781.531) [-770.825] -- 0:00:55
165000 -- (-772.481) (-771.086) (-770.833) [-775.946] * (-775.747) (-772.586) (-772.575) [-773.718] -- 0:00:55
Average standard deviation of split frequencies: 0.011658
165500 -- [-773.335] (-776.275) (-771.062) (-777.853) * [-772.965] (-773.772) (-774.218) (-771.588) -- 0:00:55
166000 -- (-773.074) (-771.562) [-770.047] (-777.587) * [-775.693] (-776.777) (-772.253) (-770.691) -- 0:00:55
166500 -- [-770.242] (-774.613) (-771.999) (-776.482) * (-770.805) (-775.510) [-773.480] (-770.956) -- 0:00:55
167000 -- (-772.889) (-772.635) (-775.236) [-770.641] * (-775.583) (-772.239) (-773.281) [-774.677] -- 0:00:54
167500 -- (-776.621) [-774.442] (-773.255) (-776.357) * (-773.737) [-773.518] (-771.851) (-772.810) -- 0:00:54
168000 -- (-772.775) [-773.687] (-772.905) (-774.041) * (-773.551) (-773.618) [-772.250] (-771.750) -- 0:00:54
168500 -- (-771.256) (-774.221) [-770.895] (-773.228) * (-772.293) (-770.966) (-775.213) [-770.871] -- 0:00:54
169000 -- [-773.976] (-771.393) (-775.687) (-772.620) * (-773.719) (-774.516) [-771.090] (-771.680) -- 0:00:54
169500 -- (-772.527) (-772.559) (-775.632) [-775.420] * (-771.669) (-783.179) [-773.399] (-772.235) -- 0:00:53
170000 -- (-772.171) (-772.135) (-775.222) [-771.374] * (-770.625) (-770.863) [-774.581] (-776.762) -- 0:00:53
Average standard deviation of split frequencies: 0.011921
170500 -- [-773.250] (-772.192) (-776.085) (-775.887) * (-771.595) (-773.203) [-775.274] (-774.386) -- 0:00:53
171000 -- (-773.789) [-772.113] (-772.903) (-777.746) * (-771.133) (-772.206) [-774.481] (-771.696) -- 0:00:53
171500 -- [-773.799] (-772.251) (-773.286) (-771.558) * [-769.931] (-776.231) (-773.839) (-772.331) -- 0:00:53
172000 -- (-771.550) [-774.838] (-773.306) (-772.911) * [-771.549] (-773.849) (-773.173) (-770.244) -- 0:00:52
172500 -- (-773.198) (-773.436) [-772.712] (-772.951) * (-774.032) [-773.585] (-772.662) (-773.802) -- 0:00:52
173000 -- (-773.455) (-773.547) [-772.019] (-772.792) * [-778.281] (-776.893) (-775.217) (-771.199) -- 0:00:52
173500 -- (-771.134) (-773.809) (-772.456) [-772.953] * (-772.264) [-773.888] (-781.259) (-771.341) -- 0:00:52
174000 -- [-770.887] (-772.509) (-773.150) (-772.120) * (-774.342) [-773.314] (-776.904) (-770.033) -- 0:00:52
174500 -- [-773.947] (-772.276) (-774.740) (-773.704) * [-772.198] (-773.810) (-776.460) (-771.095) -- 0:00:52
175000 -- (-774.069) [-772.833] (-776.228) (-775.295) * (-773.872) (-773.386) (-772.414) [-772.782] -- 0:00:51
Average standard deviation of split frequencies: 0.012447
175500 -- [-773.513] (-773.528) (-773.313) (-773.733) * (-770.936) [-771.818] (-772.940) (-773.063) -- 0:00:51
176000 -- (-771.910) [-772.994] (-772.997) (-771.404) * (-778.231) (-771.876) [-774.903] (-770.207) -- 0:00:51
176500 -- (-772.178) (-775.254) (-774.823) [-773.245] * [-773.514] (-772.629) (-776.279) (-770.043) -- 0:00:51
177000 -- (-771.713) [-773.536] (-772.950) (-772.279) * (-775.289) (-773.374) (-773.574) [-771.868] -- 0:00:55
177500 -- [-772.467] (-772.793) (-776.663) (-772.308) * (-772.247) [-771.243] (-773.412) (-771.709) -- 0:00:55
178000 -- (-774.784) [-772.885] (-770.848) (-772.563) * [-771.655] (-772.867) (-774.364) (-772.385) -- 0:00:55
178500 -- (-773.328) (-771.744) [-771.350] (-771.466) * (-772.320) (-772.264) [-772.415] (-775.124) -- 0:00:55
179000 -- (-775.295) [-771.479] (-773.612) (-773.380) * (-773.156) (-770.684) (-773.411) [-771.601] -- 0:00:55
179500 -- (-772.678) [-772.344] (-774.572) (-772.987) * (-771.702) (-777.721) (-780.371) [-770.855] -- 0:00:54
180000 -- [-771.225] (-772.834) (-774.747) (-771.481) * [-771.843] (-775.597) (-774.598) (-773.343) -- 0:00:54
Average standard deviation of split frequencies: 0.014735
180500 -- (-773.271) (-771.019) [-773.006] (-771.236) * (-773.379) (-772.830) (-772.144) [-771.654] -- 0:00:54
181000 -- (-774.086) [-772.638] (-774.355) (-773.040) * (-774.121) [-771.827] (-776.256) (-773.337) -- 0:00:54
181500 -- (-776.652) (-772.997) (-775.197) [-774.483] * (-773.598) (-771.925) [-773.879] (-775.149) -- 0:00:54
182000 -- (-772.617) (-771.371) (-775.058) [-774.913] * (-772.994) (-773.435) [-771.368] (-772.553) -- 0:00:53
182500 -- (-772.488) [-772.942] (-774.442) (-776.609) * (-770.460) [-771.006] (-773.232) (-773.583) -- 0:00:53
183000 -- (-776.136) (-772.547) (-772.065) [-773.835] * [-773.207] (-771.432) (-774.935) (-772.743) -- 0:00:53
183500 -- [-770.443] (-771.005) (-772.030) (-774.717) * (-775.283) [-771.856] (-774.854) (-773.088) -- 0:00:53
184000 -- (-774.693) (-775.084) [-773.088] (-772.982) * (-775.642) (-773.526) (-772.339) [-774.001] -- 0:00:53
184500 -- (-773.564) [-771.005] (-773.537) (-772.099) * [-773.549] (-772.668) (-771.423) (-776.960) -- 0:00:53
185000 -- (-773.928) (-774.398) (-773.888) [-771.079] * (-774.824) (-777.010) [-771.799] (-772.424) -- 0:00:52
Average standard deviation of split frequencies: 0.012405
185500 -- (-774.616) (-779.567) (-771.949) [-772.504] * (-775.295) (-778.082) (-776.391) [-770.921] -- 0:00:52
186000 -- (-770.428) (-772.478) (-772.657) [-771.370] * (-773.167) (-771.047) (-772.316) [-772.342] -- 0:00:52
186500 -- [-773.031] (-774.691) (-771.559) (-772.044) * (-777.071) (-772.153) [-773.842] (-775.065) -- 0:00:52
187000 -- [-772.544] (-771.538) (-771.439) (-774.257) * (-772.080) [-771.607] (-771.957) (-772.428) -- 0:00:52
187500 -- (-774.687) (-774.409) [-772.388] (-773.576) * (-770.822) [-772.542] (-774.238) (-774.362) -- 0:00:52
188000 -- (-773.019) [-773.491] (-778.787) (-773.315) * [-772.674] (-771.445) (-775.228) (-771.373) -- 0:00:51
188500 -- (-775.014) [-770.147] (-772.829) (-773.953) * [-773.817] (-772.253) (-776.547) (-772.770) -- 0:00:51
189000 -- (-775.351) (-774.160) (-774.319) [-771.451] * [-772.248] (-771.000) (-774.042) (-774.439) -- 0:00:51
189500 -- (-775.226) (-772.820) [-773.256] (-772.151) * (-772.402) [-771.665] (-772.565) (-773.588) -- 0:00:51
190000 -- (-775.713) (-770.862) [-775.590] (-776.292) * [-770.695] (-771.038) (-771.369) (-773.001) -- 0:00:51
Average standard deviation of split frequencies: 0.014054
190500 -- (-779.446) (-773.910) (-771.934) [-771.902] * (-774.145) [-771.506] (-772.218) (-776.418) -- 0:00:50
191000 -- (-776.781) [-770.963] (-774.473) (-770.445) * [-771.810] (-775.932) (-774.588) (-774.496) -- 0:00:55
191500 -- [-771.300] (-769.988) (-775.741) (-774.909) * (-772.571) (-773.949) [-775.568] (-780.240) -- 0:00:54
192000 -- (-772.353) [-771.787] (-776.402) (-770.228) * (-772.832) (-772.658) (-772.824) [-772.008] -- 0:00:54
192500 -- (-771.674) (-773.588) [-772.629] (-772.647) * [-772.771] (-773.319) (-772.209) (-770.833) -- 0:00:54
193000 -- (-774.875) (-772.308) [-774.776] (-772.833) * (-774.861) (-771.602) (-773.243) [-772.333] -- 0:00:54
193500 -- (-771.376) [-770.801] (-778.545) (-771.387) * (-774.807) (-771.622) [-772.509] (-773.014) -- 0:00:54
194000 -- (-776.540) (-770.754) [-772.791] (-771.627) * (-777.515) (-772.915) (-774.259) [-771.236] -- 0:00:54
194500 -- [-773.216] (-776.090) (-772.257) (-773.093) * [-774.361] (-772.345) (-771.685) (-772.695) -- 0:00:53
195000 -- (-772.800) (-775.298) (-772.125) [-770.075] * (-772.872) (-774.773) [-775.414] (-773.542) -- 0:00:53
Average standard deviation of split frequencies: 0.014557
195500 -- (-775.666) [-775.351] (-771.010) (-771.597) * (-774.121) [-772.922] (-773.174) (-777.877) -- 0:00:53
196000 -- (-771.033) [-775.123] (-774.172) (-772.686) * [-775.780] (-771.623) (-772.919) (-772.517) -- 0:00:53
196500 -- (-771.662) (-773.395) [-771.422] (-773.041) * (-775.581) (-771.577) (-773.905) [-774.079] -- 0:00:53
197000 -- (-772.956) [-773.642] (-773.626) (-771.162) * (-772.672) (-774.853) [-773.288] (-774.131) -- 0:00:52
197500 -- (-775.946) (-773.086) [-771.746] (-773.119) * (-773.077) (-771.312) [-770.465] (-772.587) -- 0:00:52
198000 -- (-776.614) (-772.607) [-774.091] (-777.650) * (-772.391) (-773.029) [-774.434] (-772.429) -- 0:00:52
198500 -- (-772.942) [-772.078] (-774.011) (-773.085) * (-772.318) (-770.418) [-778.033] (-776.351) -- 0:00:52
199000 -- (-772.843) [-770.451] (-772.574) (-774.119) * (-771.796) (-771.491) [-772.970] (-774.781) -- 0:00:52
199500 -- [-776.635] (-770.947) (-770.446) (-775.593) * (-772.294) (-771.773) [-773.740] (-775.944) -- 0:00:52
200000 -- (-773.258) (-773.615) [-772.739] (-774.284) * [-774.186] (-770.956) (-772.270) (-774.096) -- 0:00:51
Average standard deviation of split frequencies: 0.014713
200500 -- [-774.434] (-771.278) (-771.713) (-778.430) * [-770.712] (-770.440) (-772.158) (-774.304) -- 0:00:51
201000 -- (-774.783) (-773.120) (-771.705) [-771.839] * (-772.108) (-772.066) [-770.920] (-773.941) -- 0:00:51
201500 -- (-774.443) [-773.591] (-771.305) (-774.639) * (-772.721) [-771.414] (-777.723) (-779.388) -- 0:00:51
202000 -- (-774.706) (-772.804) [-774.918] (-774.109) * (-772.395) (-771.980) [-780.993] (-772.092) -- 0:00:51
202500 -- (-777.445) (-774.386) [-776.060] (-772.665) * (-773.315) (-773.099) [-772.758] (-772.945) -- 0:00:51
203000 -- (-776.863) (-774.543) [-772.481] (-775.292) * (-772.881) [-773.120] (-771.325) (-775.007) -- 0:00:51
203500 -- (-776.344) (-774.598) (-770.897) [-775.741] * [-772.979] (-773.632) (-770.149) (-778.946) -- 0:00:50
204000 -- (-774.586) (-773.930) [-775.311] (-773.775) * (-771.421) [-769.145] (-770.146) (-772.582) -- 0:00:50
204500 -- (-773.326) [-772.748] (-779.224) (-770.893) * (-773.833) (-772.330) [-770.296] (-773.152) -- 0:00:50
205000 -- (-775.346) (-780.556) [-775.060] (-773.301) * (-778.031) [-770.158] (-775.026) (-772.702) -- 0:00:50
Average standard deviation of split frequencies: 0.015332
205500 -- (-773.734) [-774.126] (-771.409) (-771.921) * [-775.759] (-770.324) (-771.393) (-773.223) -- 0:00:50
206000 -- (-773.853) [-772.480] (-769.995) (-771.519) * [-774.039] (-773.548) (-771.167) (-771.604) -- 0:00:53
206500 -- (-772.423) (-772.562) (-773.150) [-770.418] * (-775.845) (-772.593) [-772.092] (-772.908) -- 0:00:53
207000 -- (-777.275) (-773.904) [-771.250] (-772.502) * [-771.304] (-774.278) (-774.026) (-774.221) -- 0:00:53
207500 -- (-774.143) (-774.198) [-772.756] (-771.591) * (-773.034) (-775.828) [-774.787] (-772.740) -- 0:00:53
208000 -- (-772.557) (-776.235) [-771.183] (-773.885) * (-773.237) (-772.120) (-773.499) [-772.469] -- 0:00:53
208500 -- [-773.255] (-773.648) (-771.486) (-776.068) * (-773.279) (-773.215) [-771.917] (-772.319) -- 0:00:53
209000 -- (-773.426) (-773.561) [-771.074] (-777.189) * [-770.105] (-775.238) (-773.785) (-771.789) -- 0:00:52
209500 -- (-770.759) [-772.361] (-772.284) (-777.260) * [-771.107] (-773.169) (-771.854) (-772.283) -- 0:00:52
210000 -- (-774.099) (-775.406) (-772.569) [-770.932] * (-770.293) [-770.615] (-771.330) (-776.968) -- 0:00:52
Average standard deviation of split frequencies: 0.015552
210500 -- (-775.194) (-774.719) [-769.911] (-774.431) * (-771.288) (-772.396) (-771.398) [-772.852] -- 0:00:52
211000 -- (-781.716) (-773.830) (-772.887) [-769.786] * (-771.549) (-772.293) (-774.952) [-773.623] -- 0:00:52
211500 -- (-780.457) (-774.543) [-772.377] (-772.845) * (-775.359) (-774.271) [-774.984] (-773.688) -- 0:00:52
212000 -- (-770.947) (-773.392) (-773.714) [-770.346] * (-771.594) (-771.567) [-774.540] (-771.292) -- 0:00:52
212500 -- (-770.806) (-771.601) (-772.813) [-773.377] * [-770.748] (-779.696) (-772.043) (-773.558) -- 0:00:51
213000 -- (-771.983) (-771.834) [-770.388] (-775.724) * (-771.721) [-779.311] (-773.299) (-773.173) -- 0:00:51
213500 -- (-771.656) (-775.337) [-774.814] (-773.200) * (-773.237) [-774.036] (-772.202) (-770.862) -- 0:00:51
214000 -- [-770.618] (-773.253) (-773.083) (-773.721) * [-771.839] (-772.309) (-776.809) (-773.490) -- 0:00:51
214500 -- (-770.686) (-771.648) [-772.058] (-775.775) * (-775.165) (-771.224) [-775.140] (-774.653) -- 0:00:51
215000 -- (-770.389) (-776.916) (-773.384) [-772.272] * (-774.923) (-772.237) [-772.116] (-772.595) -- 0:00:51
Average standard deviation of split frequencies: 0.014622
215500 -- [-775.869] (-777.311) (-771.112) (-773.301) * (-771.842) (-773.986) (-772.285) [-771.145] -- 0:00:50
216000 -- (-775.949) [-772.209] (-772.801) (-775.136) * (-772.726) (-775.627) (-770.865) [-770.588] -- 0:00:50
216500 -- (-773.453) (-773.336) (-775.339) [-778.238] * (-771.963) (-775.277) (-772.655) [-771.090] -- 0:00:50
217000 -- (-772.699) (-771.255) (-775.361) [-772.794] * (-771.208) (-772.952) (-775.102) [-773.567] -- 0:00:50
217500 -- [-774.351] (-770.066) (-773.832) (-771.349) * (-772.506) (-773.147) (-772.205) [-771.337] -- 0:00:50
218000 -- [-771.306] (-770.793) (-773.488) (-776.113) * (-774.146) [-776.460] (-772.258) (-773.901) -- 0:00:50
218500 -- [-772.189] (-772.080) (-773.928) (-770.179) * (-774.008) (-774.286) [-773.661] (-774.084) -- 0:00:50
219000 -- (-772.430) [-772.279] (-777.508) (-771.540) * (-771.265) (-774.004) (-772.366) [-772.600] -- 0:00:49
219500 -- (-773.638) (-771.396) (-774.512) [-770.466] * (-773.406) (-774.873) (-774.993) [-772.069] -- 0:00:49
220000 -- [-772.443] (-771.265) (-772.418) (-771.127) * (-779.245) (-771.056) (-774.568) [-770.511] -- 0:00:49
Average standard deviation of split frequencies: 0.016129
220500 -- (-775.983) (-769.519) (-777.025) [-772.168] * (-774.207) (-773.355) (-772.546) [-773.922] -- 0:00:49
221000 -- (-775.425) (-769.936) [-774.495] (-774.746) * (-776.287) (-774.303) (-772.009) [-770.464] -- 0:00:49
221500 -- (-775.153) (-774.564) (-772.751) [-774.617] * (-777.612) (-776.600) [-773.078] (-778.882) -- 0:00:52
222000 -- (-772.455) [-773.416] (-772.690) (-777.713) * [-776.335] (-772.891) (-773.769) (-773.324) -- 0:00:52
222500 -- (-773.080) [-777.549] (-779.178) (-774.489) * (-771.315) (-772.796) (-776.689) [-780.541] -- 0:00:52
223000 -- (-773.076) (-774.517) [-774.897] (-771.624) * (-773.365) [-773.221] (-776.824) (-771.735) -- 0:00:52
223500 -- (-771.394) (-773.273) (-771.463) [-772.708] * (-776.335) (-772.451) (-774.172) [-771.330] -- 0:00:52
224000 -- (-773.444) [-771.609] (-772.171) (-775.296) * (-776.555) (-778.177) (-773.127) [-771.634] -- 0:00:51
224500 -- (-771.093) (-773.165) (-775.747) [-771.758] * [-772.168] (-780.243) (-771.535) (-773.309) -- 0:00:51
225000 -- [-770.905] (-773.078) (-775.810) (-773.332) * (-771.661) (-776.645) [-773.385] (-774.393) -- 0:00:51
Average standard deviation of split frequencies: 0.016270
225500 -- (-771.846) [-771.367] (-773.048) (-774.547) * [-771.579] (-774.977) (-772.928) (-770.747) -- 0:00:51
226000 -- (-771.113) [-770.881] (-773.248) (-772.372) * (-770.249) (-772.113) [-772.824] (-772.615) -- 0:00:51
226500 -- [-771.663] (-772.252) (-774.241) (-772.639) * (-770.741) (-774.138) [-770.181] (-770.845) -- 0:00:51
227000 -- (-773.062) [-770.330] (-772.734) (-770.917) * [-771.330] (-772.708) (-773.900) (-772.019) -- 0:00:51
227500 -- (-772.299) [-772.483] (-773.052) (-771.092) * [-771.375] (-772.014) (-773.122) (-773.477) -- 0:00:50
228000 -- (-774.850) [-772.025] (-772.824) (-771.035) * (-773.205) [-772.110] (-772.650) (-771.861) -- 0:00:50
228500 -- (-777.218) (-773.490) (-771.325) [-769.984] * [-772.160] (-773.000) (-773.064) (-771.610) -- 0:00:50
229000 -- (-783.168) (-771.187) (-774.532) [-770.950] * [-770.824] (-771.611) (-773.743) (-773.846) -- 0:00:50
229500 -- (-775.067) (-771.690) (-774.509) [-773.032] * (-770.732) (-773.266) (-772.811) [-773.297] -- 0:00:50
230000 -- (-773.973) [-773.763] (-772.702) (-771.155) * (-777.095) (-772.698) (-774.950) [-773.788] -- 0:00:50
Average standard deviation of split frequencies: 0.015166
230500 -- (-773.858) (-772.419) [-773.577] (-772.189) * (-775.531) (-771.489) (-774.296) [-770.744] -- 0:00:50
231000 -- (-774.382) (-770.955) (-775.847) [-772.194] * (-773.279) (-773.152) (-773.107) [-773.560] -- 0:00:49
231500 -- (-776.758) [-770.700] (-777.967) (-774.901) * [-771.915] (-772.041) (-773.597) (-771.828) -- 0:00:49
232000 -- (-775.216) (-771.474) (-774.634) [-773.577] * (-771.977) (-774.650) (-773.946) [-771.231] -- 0:00:49
232500 -- (-774.264) (-770.251) (-773.752) [-772.079] * (-770.499) (-772.864) (-770.900) [-771.984] -- 0:00:49
233000 -- (-777.330) (-771.612) (-773.902) [-771.146] * (-774.157) (-776.908) [-770.378] (-776.518) -- 0:00:49
233500 -- [-777.505] (-776.300) (-773.055) (-771.562) * (-774.822) [-773.375] (-774.615) (-770.361) -- 0:00:49
234000 -- (-775.414) (-772.219) [-772.284] (-772.130) * (-774.539) [-772.433] (-774.080) (-770.085) -- 0:00:49
234500 -- (-775.221) [-771.107] (-772.821) (-771.109) * (-774.643) (-772.080) [-773.640] (-772.957) -- 0:00:48
235000 -- (-773.030) [-771.032] (-774.264) (-773.432) * (-772.908) (-769.655) [-773.095] (-775.186) -- 0:00:48
Average standard deviation of split frequencies: 0.013562
235500 -- (-778.553) [-772.412] (-773.425) (-773.665) * (-770.611) (-770.221) [-771.473] (-772.458) -- 0:00:48
236000 -- (-776.017) [-772.508] (-772.251) (-773.325) * (-773.654) (-771.659) [-770.265] (-774.074) -- 0:00:48
236500 -- [-775.386] (-771.330) (-774.124) (-772.428) * (-775.644) (-772.096) [-770.929] (-774.028) -- 0:00:48
237000 -- (-774.779) (-770.802) (-777.637) [-777.762] * [-776.630] (-771.194) (-772.988) (-778.965) -- 0:00:51
237500 -- (-771.026) [-773.521] (-773.003) (-778.708) * (-774.151) (-773.422) (-773.454) [-772.414] -- 0:00:51
238000 -- (-771.748) (-773.817) [-773.976] (-776.059) * (-774.543) (-775.005) [-776.349] (-770.779) -- 0:00:51
238500 -- (-775.560) [-772.416] (-772.446) (-774.529) * (-776.675) (-774.051) (-772.873) [-770.692] -- 0:00:51
239000 -- (-775.134) (-771.426) (-772.131) [-771.580] * (-772.455) [-773.013] (-771.826) (-771.471) -- 0:00:50
239500 -- [-774.713] (-772.164) (-772.282) (-773.343) * (-774.017) (-774.498) (-778.958) [-772.067] -- 0:00:50
240000 -- [-776.638] (-771.619) (-773.849) (-774.858) * (-772.948) (-769.664) (-778.998) [-776.981] -- 0:00:50
Average standard deviation of split frequencies: 0.012514
240500 -- (-777.285) [-774.312] (-774.569) (-773.408) * [-772.721] (-771.756) (-773.878) (-774.377) -- 0:00:50
241000 -- (-772.904) (-772.482) (-774.215) [-774.067] * [-773.372] (-776.898) (-772.140) (-772.835) -- 0:00:50
241500 -- (-774.061) [-772.070] (-777.576) (-770.187) * (-771.457) [-771.926] (-774.507) (-771.871) -- 0:00:50
242000 -- (-774.280) [-770.015] (-772.481) (-772.522) * [-771.619] (-773.670) (-775.038) (-771.560) -- 0:00:50
242500 -- (-776.068) (-772.332) [-772.897] (-775.436) * [-773.498] (-773.075) (-773.104) (-771.380) -- 0:00:49
243000 -- (-773.999) [-771.374] (-772.827) (-776.794) * (-771.382) (-772.396) [-772.914] (-772.469) -- 0:00:49
243500 -- (-772.796) [-772.493] (-775.385) (-773.052) * (-772.081) [-772.312] (-773.716) (-771.874) -- 0:00:49
244000 -- (-772.571) (-774.107) [-773.710] (-772.455) * (-771.912) (-772.290) [-776.756] (-773.667) -- 0:00:49
244500 -- (-773.535) (-772.874) [-772.349] (-773.581) * (-776.039) (-771.624) (-770.980) [-773.330] -- 0:00:49
245000 -- [-774.100] (-772.902) (-772.627) (-774.054) * (-775.398) (-769.933) [-772.796] (-775.075) -- 0:00:49
Average standard deviation of split frequencies: 0.011699
245500 -- (-776.036) (-773.190) (-771.805) [-770.944] * (-774.419) (-772.083) [-774.004] (-774.011) -- 0:00:49
246000 -- (-775.783) (-772.868) (-772.424) [-773.150] * [-774.646] (-774.238) (-772.290) (-771.568) -- 0:00:49
246500 -- [-774.280] (-775.176) (-776.295) (-776.059) * [-769.706] (-776.488) (-772.942) (-780.850) -- 0:00:48
247000 -- [-771.993] (-776.336) (-773.643) (-776.090) * [-772.238] (-772.150) (-772.480) (-774.818) -- 0:00:48
247500 -- (-773.453) (-771.088) (-773.155) [-774.251] * (-771.269) (-773.318) [-771.288] (-774.295) -- 0:00:48
248000 -- (-773.837) [-778.483] (-772.207) (-779.467) * [-773.098] (-773.807) (-773.645) (-773.870) -- 0:00:48
248500 -- [-774.802] (-772.214) (-772.688) (-779.366) * (-772.157) (-773.897) (-771.951) [-772.912] -- 0:00:48
249000 -- (-772.108) (-771.331) (-774.039) [-771.659] * (-770.651) (-772.355) (-775.994) [-770.194] -- 0:00:48
249500 -- (-773.325) [-772.114] (-773.136) (-771.683) * (-773.949) (-772.447) [-772.906] (-775.549) -- 0:00:48
250000 -- (-771.774) (-774.204) [-773.353] (-770.816) * (-771.087) (-774.440) [-772.632] (-773.644) -- 0:00:48
Average standard deviation of split frequencies: 0.012075
250500 -- [-775.286] (-774.930) (-774.440) (-775.461) * [-773.066] (-773.347) (-773.805) (-772.032) -- 0:00:47
251000 -- (-772.166) (-774.351) (-779.535) [-772.733] * [-774.262] (-776.310) (-772.120) (-771.024) -- 0:00:47
251500 -- [-772.410] (-775.203) (-774.954) (-770.959) * (-775.104) (-773.368) (-772.348) [-771.212] -- 0:00:47
252000 -- [-775.587] (-774.363) (-775.979) (-772.515) * [-770.952] (-771.975) (-773.771) (-771.435) -- 0:00:50
252500 -- (-771.843) (-773.130) (-772.722) [-770.659] * (-771.574) (-771.569) (-772.442) [-770.072] -- 0:00:50
253000 -- (-771.965) (-775.751) (-772.223) [-771.342] * [-770.196] (-772.289) (-770.689) (-773.975) -- 0:00:50
253500 -- [-773.239] (-777.458) (-774.872) (-770.731) * [-770.447] (-771.001) (-772.756) (-772.949) -- 0:00:50
254000 -- (-773.168) (-772.251) (-772.548) [-770.544] * (-772.956) (-772.164) [-774.509] (-773.765) -- 0:00:49
254500 -- (-772.814) (-775.046) [-772.586] (-772.155) * (-769.891) [-769.039] (-773.032) (-775.497) -- 0:00:49
255000 -- (-775.577) (-773.615) [-773.356] (-773.443) * (-774.684) [-773.728] (-773.234) (-774.946) -- 0:00:49
Average standard deviation of split frequencies: 0.013084
255500 -- (-776.118) [-774.121] (-771.856) (-779.614) * (-770.754) (-776.806) [-775.025] (-776.006) -- 0:00:49
256000 -- (-775.492) [-772.233] (-772.961) (-777.591) * (-773.541) [-776.640] (-775.858) (-775.101) -- 0:00:49
256500 -- (-776.712) [-773.123] (-776.555) (-775.288) * (-774.022) (-771.442) [-772.756] (-772.771) -- 0:00:49
257000 -- (-776.021) (-773.825) (-773.375) [-772.719] * (-772.226) (-776.030) (-774.442) [-772.652] -- 0:00:49
257500 -- (-774.805) (-771.103) (-770.753) [-769.165] * (-771.378) (-774.235) (-774.080) [-771.952] -- 0:00:49
258000 -- (-773.557) (-772.636) [-774.915] (-773.197) * [-773.774] (-772.005) (-775.876) (-773.496) -- 0:00:48
258500 -- (-770.708) (-772.467) (-771.529) [-771.532] * (-774.232) [-770.874] (-776.743) (-775.210) -- 0:00:48
259000 -- (-773.559) [-771.594] (-773.059) (-772.239) * (-772.802) (-771.399) (-772.360) [-775.212] -- 0:00:48
259500 -- (-771.873) (-773.182) [-770.987] (-774.895) * (-773.048) (-770.545) [-773.448] (-772.093) -- 0:00:48
260000 -- [-771.968] (-770.723) (-776.959) (-772.368) * [-774.494] (-771.738) (-771.853) (-770.706) -- 0:00:48
Average standard deviation of split frequencies: 0.014267
260500 -- [-771.017] (-771.183) (-770.946) (-770.575) * (-772.999) (-772.098) (-772.275) [-772.068] -- 0:00:48
261000 -- (-772.279) (-776.118) (-772.721) [-770.613] * [-772.254] (-776.199) (-774.561) (-769.482) -- 0:00:48
261500 -- (-773.293) (-770.821) [-775.070] (-770.416) * [-772.278] (-775.097) (-773.902) (-772.102) -- 0:00:48
262000 -- (-774.731) (-775.205) (-772.486) [-770.459] * [-771.151] (-777.014) (-773.115) (-772.185) -- 0:00:47
262500 -- [-776.454] (-775.084) (-772.181) (-774.774) * [-776.763] (-773.289) (-775.897) (-771.142) -- 0:00:47
263000 -- (-778.608) [-773.182] (-772.591) (-776.369) * [-775.334] (-774.273) (-774.313) (-770.873) -- 0:00:47
263500 -- (-774.823) (-772.778) [-773.818] (-777.288) * (-772.635) (-770.749) [-775.958] (-774.783) -- 0:00:47
264000 -- (-772.544) (-772.642) (-775.868) [-772.357] * (-779.488) (-774.339) [-771.911] (-770.860) -- 0:00:47
264500 -- (-772.796) (-771.067) (-774.520) [-777.035] * [-776.711] (-770.839) (-771.353) (-771.013) -- 0:00:47
265000 -- (-774.938) (-770.321) [-771.577] (-772.622) * (-777.575) [-769.769] (-771.534) (-772.768) -- 0:00:47
Average standard deviation of split frequencies: 0.012499
265500 -- [-773.421] (-771.431) (-771.339) (-773.439) * (-774.983) [-772.711] (-772.928) (-772.493) -- 0:00:47
266000 -- (-770.232) [-771.519] (-773.398) (-772.030) * (-774.581) (-777.800) (-774.647) [-771.058] -- 0:00:46
266500 -- (-769.486) (-772.524) (-773.084) [-771.342] * [-776.249] (-774.157) (-775.160) (-770.402) -- 0:00:46
267000 -- (-772.347) (-771.891) [-773.722] (-771.408) * (-774.277) (-770.149) (-772.898) [-774.858] -- 0:00:49
267500 -- [-772.251] (-772.244) (-772.416) (-773.007) * (-772.833) (-774.388) [-772.869] (-771.454) -- 0:00:49
268000 -- (-774.141) (-775.795) [-770.645] (-775.972) * (-772.441) (-769.267) (-772.651) [-771.659] -- 0:00:49
268500 -- [-773.059] (-773.512) (-774.447) (-777.139) * (-772.244) (-774.734) [-771.478] (-772.553) -- 0:00:49
269000 -- (-774.066) (-770.967) [-773.879] (-773.014) * (-773.694) [-770.269] (-771.687) (-776.751) -- 0:00:48
269500 -- (-772.942) (-773.561) (-772.780) [-773.572] * (-772.132) (-772.292) [-772.304] (-773.488) -- 0:00:48
270000 -- (-773.872) [-776.896] (-772.289) (-773.161) * (-771.295) (-772.755) (-774.543) [-770.945] -- 0:00:48
Average standard deviation of split frequencies: 0.011708
270500 -- (-771.938) [-773.191] (-775.653) (-773.928) * (-770.784) [-771.372] (-771.489) (-771.280) -- 0:00:48
271000 -- (-774.125) (-772.522) (-779.645) [-776.160] * (-777.223) (-770.952) [-772.813] (-771.398) -- 0:00:48
271500 -- (-771.715) [-775.527] (-773.147) (-773.351) * (-773.179) (-776.557) [-771.922] (-774.924) -- 0:00:48
272000 -- (-771.972) (-774.474) (-770.678) [-770.537] * (-777.579) (-773.620) (-771.759) [-774.992] -- 0:00:48
272500 -- (-774.222) [-774.677] (-770.592) (-773.059) * (-778.119) (-775.035) [-774.970] (-772.362) -- 0:00:48
273000 -- (-772.694) [-773.285] (-773.544) (-771.592) * (-778.616) (-774.437) (-773.886) [-773.347] -- 0:00:47
273500 -- (-772.613) [-772.656] (-773.480) (-771.887) * [-774.956] (-774.983) (-777.676) (-772.190) -- 0:00:47
274000 -- [-773.845] (-772.603) (-772.579) (-771.612) * [-773.219] (-772.571) (-773.008) (-771.642) -- 0:00:47
274500 -- (-775.259) [-773.460] (-772.425) (-771.396) * (-773.431) (-771.824) [-773.584] (-773.497) -- 0:00:47
275000 -- (-776.002) (-776.889) [-770.232] (-771.928) * (-775.461) (-772.750) [-773.416] (-775.582) -- 0:00:47
Average standard deviation of split frequencies: 0.012335
275500 -- (-774.395) (-772.314) (-771.704) [-772.880] * (-773.997) (-771.971) (-774.349) [-770.831] -- 0:00:47
276000 -- (-776.436) (-770.883) [-770.813] (-771.985) * (-775.187) [-772.887] (-776.658) (-771.884) -- 0:00:47
276500 -- [-772.390] (-773.410) (-772.119) (-773.552) * (-778.869) (-777.218) [-771.967] (-778.686) -- 0:00:47
277000 -- (-773.232) [-771.078] (-770.104) (-772.843) * (-773.894) [-771.332] (-774.371) (-775.905) -- 0:00:46
277500 -- (-775.470) (-770.344) [-771.917] (-772.410) * (-776.492) (-772.879) [-773.879] (-772.967) -- 0:00:46
278000 -- (-776.689) [-772.399] (-773.707) (-773.070) * (-772.794) (-773.300) [-773.642] (-773.995) -- 0:00:46
278500 -- [-772.659] (-774.315) (-772.512) (-770.192) * [-772.214] (-771.115) (-771.500) (-773.084) -- 0:00:46
279000 -- [-778.280] (-773.079) (-775.086) (-769.980) * (-771.058) (-772.832) [-774.345] (-772.663) -- 0:00:46
279500 -- (-773.314) (-772.674) (-773.569) [-772.737] * [-773.436] (-773.055) (-775.401) (-772.399) -- 0:00:46
280000 -- [-772.341] (-770.138) (-774.107) (-774.604) * [-772.144] (-771.082) (-774.070) (-771.203) -- 0:00:46
Average standard deviation of split frequencies: 0.011477
280500 -- (-773.328) (-772.599) [-773.659] (-771.149) * [-773.448] (-771.924) (-772.544) (-771.359) -- 0:00:46
281000 -- (-772.305) [-770.115] (-771.567) (-776.511) * (-772.725) (-772.440) (-773.366) [-771.470] -- 0:00:46
281500 -- (-773.057) (-771.956) [-772.843] (-772.440) * [-773.171] (-774.097) (-770.732) (-772.018) -- 0:00:45
282000 -- (-773.590) (-772.595) [-772.512] (-773.922) * (-774.301) (-773.387) [-771.441] (-772.323) -- 0:00:45
282500 -- (-776.711) [-773.421] (-771.059) (-770.816) * (-773.041) [-774.057] (-771.970) (-772.059) -- 0:00:48
283000 -- (-776.373) (-775.069) [-772.078] (-772.010) * (-775.555) [-773.262] (-773.238) (-773.442) -- 0:00:48
283500 -- (-773.972) (-773.318) (-772.055) [-775.168] * (-771.269) (-775.866) [-771.507] (-772.675) -- 0:00:48
284000 -- (-774.132) (-774.399) (-771.833) [-770.406] * [-774.224] (-775.750) (-774.882) (-773.041) -- 0:00:47
284500 -- (-774.017) (-772.859) [-771.386] (-773.421) * (-773.295) [-771.747] (-771.602) (-771.013) -- 0:00:47
285000 -- (-773.871) (-773.708) (-771.240) [-773.536] * (-775.355) (-774.089) [-772.610] (-773.152) -- 0:00:47
Average standard deviation of split frequencies: 0.010988
285500 -- (-770.626) [-770.888] (-771.777) (-776.237) * (-776.180) (-772.946) [-774.779] (-774.340) -- 0:00:47
286000 -- (-771.820) [-775.025] (-771.745) (-771.927) * (-772.357) (-772.334) [-775.211] (-772.602) -- 0:00:47
286500 -- (-778.739) [-773.024] (-774.258) (-772.255) * (-772.523) (-774.548) [-771.818] (-777.847) -- 0:00:47
287000 -- (-775.676) (-772.932) (-772.106) [-770.318] * (-772.027) [-772.922] (-772.927) (-773.378) -- 0:00:47
287500 -- (-776.524) (-773.869) [-770.627] (-771.896) * (-773.277) [-770.923] (-773.976) (-772.144) -- 0:00:47
288000 -- [-772.304] (-772.588) (-772.460) (-773.360) * [-772.603] (-769.548) (-775.657) (-772.256) -- 0:00:46
288500 -- [-771.465] (-773.322) (-773.561) (-773.191) * (-772.115) (-772.646) (-772.100) [-770.563] -- 0:00:46
289000 -- (-773.369) (-775.841) [-771.711] (-774.777) * [-773.300] (-776.742) (-773.847) (-774.653) -- 0:00:46
289500 -- (-770.875) (-772.502) [-774.674] (-771.563) * (-778.959) (-772.412) (-779.752) [-771.991] -- 0:00:46
290000 -- [-771.468] (-772.856) (-778.530) (-771.803) * (-772.779) (-772.552) (-777.707) [-772.334] -- 0:00:46
Average standard deviation of split frequencies: 0.011267
290500 -- (-773.066) (-771.252) [-774.425] (-770.932) * (-776.188) (-775.091) [-771.269] (-772.564) -- 0:00:46
291000 -- [-772.963] (-772.483) (-771.705) (-770.914) * (-774.947) (-778.231) (-772.077) [-772.199] -- 0:00:46
291500 -- [-772.331] (-771.448) (-774.822) (-774.050) * [-772.334] (-776.027) (-771.291) (-775.304) -- 0:00:46
292000 -- (-772.285) [-770.326] (-771.917) (-772.822) * [-773.097] (-772.311) (-773.185) (-771.029) -- 0:00:46
292500 -- (-775.141) (-771.185) [-771.584] (-773.130) * (-774.053) [-775.547] (-772.841) (-773.043) -- 0:00:45
293000 -- (-775.908) [-770.045] (-773.725) (-776.740) * [-770.705] (-772.538) (-772.814) (-770.726) -- 0:00:45
293500 -- (-773.451) (-770.708) (-771.303) [-774.173] * [-773.091] (-774.729) (-774.037) (-771.600) -- 0:00:45
294000 -- (-772.837) [-770.263] (-771.135) (-772.242) * (-773.818) (-771.984) [-771.577] (-778.486) -- 0:00:45
294500 -- (-775.242) (-772.043) [-770.807] (-771.927) * [-772.791] (-771.171) (-777.440) (-770.615) -- 0:00:45
295000 -- (-773.296) (-771.909) (-771.292) [-772.242] * [-772.593] (-772.788) (-779.430) (-773.523) -- 0:00:45
Average standard deviation of split frequencies: 0.010897
295500 -- (-772.885) (-772.605) (-772.067) [-771.191] * (-773.792) (-776.070) [-778.729] (-773.671) -- 0:00:45
296000 -- (-772.748) [-775.484] (-774.129) (-774.561) * (-774.974) (-775.226) [-773.020] (-772.321) -- 0:00:45
296500 -- (-775.186) (-773.581) (-773.635) [-771.776] * (-776.946) (-771.495) (-773.612) [-771.896] -- 0:00:45
297000 -- (-769.903) [-771.558] (-770.492) (-771.431) * [-776.798] (-772.422) (-773.625) (-775.156) -- 0:00:44
297500 -- (-773.413) (-771.535) (-771.658) [-772.669] * (-775.493) [-774.680] (-773.443) (-774.904) -- 0:00:44
298000 -- (-775.653) (-773.593) (-771.931) [-773.589] * (-774.676) (-772.397) [-773.405] (-773.203) -- 0:00:47
298500 -- (-773.480) [-771.783] (-770.946) (-772.226) * (-777.399) [-772.105] (-775.040) (-773.454) -- 0:00:47
299000 -- (-777.507) (-775.325) [-770.499] (-773.129) * (-773.378) (-775.404) [-773.849] (-774.609) -- 0:00:46
299500 -- (-774.951) (-775.396) (-772.668) [-773.445] * (-773.334) [-774.845] (-774.845) (-772.451) -- 0:00:46
300000 -- (-772.396) (-773.341) [-773.638] (-773.437) * [-772.464] (-772.878) (-771.585) (-775.714) -- 0:00:46
Average standard deviation of split frequencies: 0.009902
300500 -- (-770.824) [-773.240] (-776.381) (-775.905) * (-774.969) (-775.568) [-772.645] (-774.019) -- 0:00:46
301000 -- [-774.348] (-772.976) (-772.533) (-771.906) * (-773.570) (-773.234) [-772.657] (-770.868) -- 0:00:46
301500 -- [-772.102] (-772.135) (-771.493) (-774.096) * (-773.996) [-773.848] (-773.974) (-776.922) -- 0:00:46
302000 -- (-772.748) (-771.724) [-776.214] (-773.572) * (-776.525) (-773.357) [-771.609] (-777.174) -- 0:00:46
302500 -- [-771.860] (-772.760) (-772.791) (-773.275) * (-777.940) (-774.464) (-771.782) [-771.757] -- 0:00:46
303000 -- (-771.952) (-775.164) (-771.436) [-770.359] * (-780.278) (-770.749) (-771.423) [-771.903] -- 0:00:46
303500 -- (-772.965) (-772.216) (-773.668) [-772.777] * (-774.818) (-770.788) [-775.227] (-773.474) -- 0:00:45
304000 -- (-773.451) (-771.923) [-772.180] (-772.214) * (-773.837) [-773.356] (-774.691) (-773.108) -- 0:00:45
304500 -- (-772.595) (-779.518) (-771.342) [-773.001] * [-774.014] (-771.666) (-775.211) (-777.922) -- 0:00:45
305000 -- (-776.315) (-774.776) [-771.640] (-774.393) * [-777.847] (-773.894) (-775.338) (-772.107) -- 0:00:45
Average standard deviation of split frequencies: 0.009405
305500 -- (-771.595) (-772.408) [-771.765] (-772.113) * (-775.083) (-773.613) (-776.450) [-772.089] -- 0:00:45
306000 -- (-776.548) (-773.246) (-775.961) [-772.539] * [-773.277] (-773.704) (-773.487) (-771.562) -- 0:00:45
306500 -- (-774.009) (-773.348) [-773.396] (-772.829) * [-772.564] (-770.966) (-770.102) (-770.036) -- 0:00:45
307000 -- [-775.210] (-772.371) (-774.373) (-772.514) * (-774.006) (-775.132) [-773.921] (-773.570) -- 0:00:45
307500 -- (-773.325) (-772.182) [-776.640] (-772.893) * (-772.406) (-772.520) [-772.541] (-774.131) -- 0:00:45
308000 -- [-773.251] (-772.889) (-776.585) (-773.732) * [-771.348] (-772.164) (-776.368) (-775.175) -- 0:00:44
308500 -- (-773.015) [-772.147] (-771.637) (-773.348) * (-771.364) [-771.997] (-775.593) (-772.629) -- 0:00:44
309000 -- [-775.353] (-773.903) (-770.902) (-774.704) * (-772.191) (-772.764) [-773.589] (-772.863) -- 0:00:44
309500 -- [-775.788] (-776.894) (-773.465) (-773.511) * (-772.976) (-772.021) [-773.486] (-774.996) -- 0:00:44
310000 -- (-772.530) (-772.976) (-773.311) [-773.423] * (-772.519) [-778.051] (-774.434) (-773.310) -- 0:00:44
Average standard deviation of split frequencies: 0.008767
310500 -- (-772.909) (-771.214) [-772.698] (-774.398) * (-772.067) (-773.628) [-772.011] (-774.662) -- 0:00:44
311000 -- [-775.560] (-775.895) (-772.641) (-775.085) * [-771.412] (-776.130) (-772.261) (-771.543) -- 0:00:44
311500 -- (-777.242) (-774.737) (-771.077) [-773.833] * (-772.501) (-773.063) (-771.763) [-771.746] -- 0:00:44
312000 -- [-774.829] (-771.547) (-775.960) (-774.088) * (-773.914) (-774.233) [-773.504] (-774.876) -- 0:00:44
312500 -- (-773.462) (-772.527) [-772.547] (-770.523) * (-773.923) [-772.713] (-774.462) (-775.413) -- 0:00:44
313000 -- (-774.333) (-779.167) (-770.954) [-770.556] * (-771.606) (-777.432) [-774.536] (-773.392) -- 0:00:43
313500 -- (-773.630) (-772.940) [-770.912] (-773.895) * (-769.906) (-775.689) (-774.316) [-777.120] -- 0:00:45
314000 -- (-774.953) (-774.128) [-771.087] (-773.883) * [-773.755] (-774.242) (-773.536) (-779.033) -- 0:00:45
314500 -- (-774.719) (-772.568) (-772.740) [-772.844] * [-773.667] (-773.161) (-774.767) (-777.033) -- 0:00:45
315000 -- (-774.771) (-773.735) [-769.674] (-774.472) * (-774.359) (-773.524) (-772.877) [-775.345] -- 0:00:45
Average standard deviation of split frequencies: 0.008671
315500 -- (-775.788) [-772.877] (-771.371) (-778.535) * (-774.577) (-775.931) (-777.027) [-770.305] -- 0:00:45
316000 -- (-773.812) (-779.703) [-772.465] (-778.723) * (-773.438) [-771.641] (-773.546) (-774.305) -- 0:00:45
316500 -- (-775.108) [-772.305] (-775.588) (-778.831) * [-772.790] (-771.625) (-780.439) (-773.479) -- 0:00:45
317000 -- (-775.269) (-774.020) (-773.651) [-772.960] * (-773.181) (-774.139) (-775.183) [-774.778] -- 0:00:45
317500 -- (-777.285) (-772.606) (-771.084) [-776.990] * (-775.893) [-774.067] (-772.009) (-771.991) -- 0:00:45
318000 -- (-775.487) (-771.338) (-771.628) [-774.041] * (-775.717) (-774.744) (-772.680) [-771.986] -- 0:00:45
318500 -- (-773.181) [-776.639] (-770.585) (-774.446) * (-774.164) (-773.577) (-773.720) [-769.807] -- 0:00:44
319000 -- (-774.815) (-776.576) [-771.697] (-772.677) * [-773.935] (-775.551) (-774.623) (-775.326) -- 0:00:44
319500 -- (-772.644) [-772.197] (-773.241) (-770.772) * (-773.936) (-777.546) (-773.100) [-773.543] -- 0:00:44
320000 -- [-772.211] (-774.937) (-772.762) (-775.402) * (-775.141) (-773.278) (-770.986) [-774.202] -- 0:00:44
Average standard deviation of split frequencies: 0.008912
320500 -- [-771.763] (-771.977) (-770.824) (-771.586) * (-772.350) (-772.303) (-776.249) [-774.035] -- 0:00:44
321000 -- [-773.184] (-775.529) (-773.352) (-771.515) * (-773.693) (-773.565) [-776.468] (-772.178) -- 0:00:44
321500 -- (-773.314) (-773.756) (-769.066) [-772.827] * (-773.632) (-773.109) [-772.624] (-772.830) -- 0:00:44
322000 -- (-774.994) (-773.908) (-771.669) [-772.958] * (-778.796) (-771.631) (-774.190) [-772.319] -- 0:00:44
322500 -- [-772.617] (-772.850) (-774.741) (-772.988) * (-776.594) [-772.111] (-777.108) (-775.558) -- 0:00:44
323000 -- (-774.425) (-773.090) [-770.067] (-770.385) * (-776.650) [-772.630] (-772.314) (-776.680) -- 0:00:44
323500 -- (-774.587) (-775.313) [-771.675] (-772.037) * [-772.668] (-775.330) (-773.470) (-772.867) -- 0:00:43
324000 -- [-774.427] (-773.095) (-772.964) (-771.980) * (-772.683) (-771.324) (-773.704) [-774.106] -- 0:00:43
324500 -- (-772.365) (-775.492) [-771.407] (-776.591) * (-774.353) (-774.640) [-772.240] (-775.078) -- 0:00:43
325000 -- [-773.187] (-772.401) (-771.815) (-773.742) * (-775.835) (-771.631) [-773.488] (-773.409) -- 0:00:43
Average standard deviation of split frequencies: 0.008857
325500 -- (-774.229) [-772.538] (-771.625) (-774.437) * (-778.159) [-772.255] (-772.794) (-772.658) -- 0:00:43
326000 -- (-773.229) [-770.821] (-775.846) (-772.847) * (-772.590) [-773.644] (-772.857) (-772.738) -- 0:00:43
326500 -- (-775.432) [-772.124] (-772.703) (-772.372) * (-773.723) [-771.563] (-773.437) (-772.438) -- 0:00:43
327000 -- (-776.438) [-772.296] (-772.742) (-772.550) * (-775.379) (-773.049) (-772.372) [-772.890] -- 0:00:43
327500 -- (-773.338) [-772.244] (-772.425) (-772.896) * (-771.032) (-771.804) [-773.882] (-773.261) -- 0:00:43
328000 -- (-773.202) (-772.688) (-774.786) [-773.189] * (-772.870) (-773.565) (-771.162) [-771.492] -- 0:00:43
328500 -- (-771.628) [-770.692] (-772.106) (-773.629) * (-771.668) (-774.193) [-771.245] (-774.024) -- 0:00:42
329000 -- [-771.350] (-775.075) (-772.577) (-771.459) * (-774.913) (-769.419) [-770.731] (-772.613) -- 0:00:44
329500 -- (-776.922) [-774.879] (-772.660) (-773.336) * (-773.673) (-771.505) (-771.769) [-771.104] -- 0:00:44
330000 -- (-778.622) (-773.615) [-771.703] (-773.535) * (-773.334) [-770.685] (-775.128) (-772.631) -- 0:00:44
Average standard deviation of split frequencies: 0.008934
330500 -- (-773.027) (-774.853) [-775.796] (-771.818) * (-774.227) (-771.432) [-771.707] (-771.510) -- 0:00:44
331000 -- (-774.179) [-771.094] (-772.311) (-775.394) * [-773.760] (-772.142) (-770.404) (-774.031) -- 0:00:44
331500 -- (-775.193) (-772.883) (-771.199) [-772.810] * (-772.208) (-775.565) [-770.831] (-772.832) -- 0:00:44
332000 -- [-773.888] (-775.148) (-773.830) (-773.863) * (-775.159) (-776.950) [-775.300] (-773.721) -- 0:00:44
332500 -- (-772.422) (-772.498) (-773.026) [-771.247] * (-774.139) (-772.608) [-773.355] (-772.118) -- 0:00:44
333000 -- (-771.711) [-772.571] (-772.037) (-771.316) * [-773.336] (-771.862) (-772.066) (-774.503) -- 0:00:44
333500 -- [-773.882] (-776.548) (-773.289) (-772.268) * (-773.570) (-770.661) [-773.138] (-777.121) -- 0:00:43
334000 -- (-774.072) (-773.985) [-770.964] (-772.395) * (-776.281) (-769.802) (-772.941) [-772.459] -- 0:00:43
334500 -- (-771.334) [-770.583] (-775.874) (-772.450) * (-771.506) [-773.341] (-772.039) (-773.297) -- 0:00:43
335000 -- (-773.365) (-773.915) (-772.656) [-772.748] * (-771.988) (-771.041) (-773.692) [-774.429] -- 0:00:43
Average standard deviation of split frequencies: 0.009821
335500 -- (-773.850) [-772.338] (-773.683) (-772.620) * (-772.037) [-770.974] (-774.729) (-772.404) -- 0:00:43
336000 -- (-774.214) (-770.155) [-772.563] (-777.886) * (-776.496) (-771.014) (-772.703) [-772.493] -- 0:00:43
336500 -- (-775.323) [-771.567] (-772.643) (-775.796) * (-774.609) (-778.242) [-771.059] (-773.498) -- 0:00:43
337000 -- (-775.949) (-771.870) [-772.615] (-774.611) * (-779.269) (-774.414) [-770.142] (-775.598) -- 0:00:43
337500 -- (-773.800) (-773.852) (-775.675) [-773.357] * [-771.087] (-772.113) (-773.986) (-771.782) -- 0:00:43
338000 -- (-773.861) (-773.166) [-770.414] (-772.327) * (-771.146) (-776.476) [-774.281] (-771.703) -- 0:00:43
338500 -- (-775.207) (-772.112) (-770.898) [-775.969] * (-772.593) (-771.756) [-772.361] (-772.127) -- 0:00:42
339000 -- (-772.785) (-771.406) [-773.538] (-771.537) * [-772.096] (-773.881) (-771.490) (-771.914) -- 0:00:42
339500 -- (-776.390) (-773.923) (-775.677) [-772.549] * [-774.024] (-772.535) (-773.986) (-775.353) -- 0:00:42
340000 -- [-776.344] (-771.762) (-774.561) (-774.819) * (-773.340) (-774.849) [-771.016] (-775.681) -- 0:00:42
Average standard deviation of split frequencies: 0.009317
340500 -- [-775.107] (-772.523) (-772.939) (-774.119) * (-773.638) (-773.807) [-772.613] (-774.317) -- 0:00:42
341000 -- (-774.672) [-771.922] (-773.882) (-772.065) * (-773.149) (-774.173) [-778.390] (-770.910) -- 0:00:42
341500 -- (-775.548) (-773.607) (-772.698) [-772.753] * (-774.246) (-776.135) [-773.690] (-772.015) -- 0:00:42
342000 -- (-773.096) (-769.662) (-772.286) [-774.119] * (-777.551) [-773.744] (-772.579) (-774.217) -- 0:00:42
342500 -- (-771.794) [-771.076] (-772.470) (-772.905) * (-772.973) [-771.141] (-772.957) (-773.586) -- 0:00:42
343000 -- (-772.308) (-770.255) [-772.285] (-771.841) * (-772.964) (-771.945) [-774.502] (-775.840) -- 0:00:42
343500 -- [-772.610] (-776.516) (-772.441) (-772.770) * [-773.431] (-776.019) (-772.500) (-772.075) -- 0:00:42
344000 -- (-776.059) (-771.848) (-770.128) [-771.679] * (-772.061) (-772.157) [-775.228] (-770.218) -- 0:00:43
344500 -- (-771.983) (-772.050) [-772.401] (-773.120) * (-773.752) [-773.404] (-773.130) (-772.944) -- 0:00:43
345000 -- (-776.438) (-773.845) [-774.444] (-775.398) * [-772.027] (-772.819) (-775.768) (-774.003) -- 0:00:43
Average standard deviation of split frequencies: 0.009026
345500 -- (-772.930) [-773.415] (-775.643) (-774.897) * (-773.594) [-770.656] (-772.973) (-775.503) -- 0:00:43
346000 -- [-775.985] (-770.063) (-773.811) (-775.772) * (-772.922) (-771.318) [-776.825] (-778.198) -- 0:00:43
346500 -- (-773.550) [-770.995] (-771.954) (-774.839) * (-773.171) [-771.618] (-771.368) (-776.417) -- 0:00:43
347000 -- (-776.751) (-774.593) (-771.482) [-772.771] * (-774.980) (-776.862) [-775.391] (-774.659) -- 0:00:43
347500 -- (-774.683) [-773.244] (-773.923) (-774.072) * (-773.619) (-777.762) [-774.245] (-773.781) -- 0:00:43
348000 -- (-779.795) [-773.082] (-772.107) (-772.962) * (-773.278) [-773.083] (-771.047) (-771.693) -- 0:00:43
348500 -- (-774.860) (-774.939) (-772.479) [-772.680] * (-773.038) (-776.055) [-773.378] (-775.501) -- 0:00:42
349000 -- [-772.880] (-770.943) (-775.984) (-770.773) * [-774.936] (-773.799) (-778.935) (-774.037) -- 0:00:42
349500 -- [-770.753] (-770.903) (-772.487) (-775.316) * (-774.766) [-770.738] (-776.404) (-773.907) -- 0:00:42
350000 -- (-771.470) (-773.962) (-772.417) [-770.967] * [-772.449] (-772.438) (-771.057) (-772.846) -- 0:00:42
Average standard deviation of split frequencies: 0.009662
350500 -- (-775.249) (-775.046) [-773.573] (-772.828) * (-775.050) (-774.392) [-773.387] (-772.624) -- 0:00:42
351000 -- (-774.135) (-772.160) (-773.488) [-771.699] * (-775.300) (-772.660) (-774.270) [-773.175] -- 0:00:42
351500 -- (-774.123) (-772.594) (-776.391) [-775.624] * (-774.303) (-771.436) (-770.599) [-775.401] -- 0:00:42
352000 -- (-773.922) (-772.090) [-770.881] (-773.676) * (-776.988) [-773.105] (-775.408) (-778.156) -- 0:00:42
352500 -- (-772.472) (-772.312) (-773.360) [-771.570] * (-775.860) (-772.839) [-770.457] (-773.078) -- 0:00:42
353000 -- [-774.758] (-773.143) (-772.361) (-777.934) * [-775.710] (-773.319) (-772.758) (-773.083) -- 0:00:42
353500 -- (-779.529) (-774.192) [-770.930] (-775.685) * [-774.417] (-772.483) (-772.677) (-773.363) -- 0:00:42
354000 -- (-775.290) (-772.401) (-775.422) [-773.803] * [-774.190] (-773.930) (-771.629) (-772.194) -- 0:00:41
354500 -- [-774.033] (-772.197) (-773.642) (-774.126) * (-778.642) (-775.263) (-772.285) [-771.402] -- 0:00:41
355000 -- (-772.884) (-774.167) (-776.602) [-771.386] * (-772.127) (-774.028) (-772.443) [-773.817] -- 0:00:41
Average standard deviation of split frequencies: 0.009036
355500 -- (-773.421) [-772.080] (-770.508) (-774.819) * (-774.096) [-771.919] (-779.525) (-773.590) -- 0:00:41
356000 -- (-770.397) [-771.663] (-772.724) (-772.867) * (-774.236) (-777.142) [-772.378] (-774.859) -- 0:00:41
356500 -- (-772.851) (-773.406) (-771.005) [-772.610] * (-774.925) (-777.820) [-775.475] (-772.336) -- 0:00:41
357000 -- [-774.551] (-773.204) (-776.708) (-772.440) * (-779.114) (-773.843) (-776.704) [-773.319] -- 0:00:41
357500 -- (-772.203) [-771.664] (-773.010) (-771.955) * (-772.839) [-772.215] (-776.893) (-775.063) -- 0:00:41
358000 -- [-770.934] (-769.668) (-775.412) (-776.125) * (-773.110) [-774.367] (-776.751) (-771.436) -- 0:00:41
358500 -- (-771.843) [-770.928] (-770.579) (-776.589) * (-776.848) (-776.930) [-773.150] (-772.301) -- 0:00:41
359000 -- (-772.223) [-772.931] (-772.157) (-774.022) * [-774.644] (-772.794) (-773.602) (-772.858) -- 0:00:41
359500 -- (-773.957) [-772.821] (-774.342) (-778.918) * [-774.282] (-776.257) (-773.833) (-772.384) -- 0:00:42
360000 -- (-772.252) (-774.174) [-771.337] (-772.976) * (-770.792) [-776.489] (-772.777) (-772.168) -- 0:00:42
Average standard deviation of split frequencies: 0.008611
360500 -- (-773.388) [-780.398] (-772.210) (-772.145) * (-777.700) (-774.517) (-772.367) [-774.331] -- 0:00:42
361000 -- (-773.818) (-773.398) [-773.982] (-773.467) * (-771.295) [-776.638] (-775.986) (-773.639) -- 0:00:42
361500 -- (-774.962) (-773.176) (-775.150) [-772.924] * (-772.665) (-773.581) (-773.061) [-772.996] -- 0:00:42
362000 -- [-774.018] (-775.324) (-771.932) (-776.618) * (-775.051) (-775.079) (-770.600) [-772.932] -- 0:00:42
362500 -- [-771.929] (-773.037) (-778.927) (-772.123) * (-770.322) [-775.327] (-772.692) (-772.306) -- 0:00:42
363000 -- (-771.426) (-773.842) (-772.614) [-774.274] * (-773.682) (-774.481) (-771.679) [-773.355] -- 0:00:42
363500 -- (-771.217) (-773.650) [-772.871] (-772.467) * (-773.560) (-774.519) [-772.060] (-773.977) -- 0:00:42
364000 -- [-771.919] (-772.195) (-771.996) (-775.600) * (-779.077) (-772.907) [-771.940] (-773.999) -- 0:00:41
364500 -- (-771.427) [-775.126] (-774.650) (-776.150) * (-773.524) (-772.174) [-772.266] (-772.654) -- 0:00:41
365000 -- (-773.335) (-773.504) (-772.240) [-772.038] * [-775.832] (-773.466) (-775.828) (-774.587) -- 0:00:41
Average standard deviation of split frequencies: 0.008944
365500 -- (-774.668) [-773.117] (-771.857) (-772.059) * (-775.594) (-773.424) (-772.109) [-775.117] -- 0:00:41
366000 -- [-771.778] (-774.898) (-772.228) (-775.238) * (-774.420) [-774.292] (-771.549) (-773.833) -- 0:00:41
366500 -- (-775.299) [-771.934] (-771.971) (-776.220) * (-774.622) (-775.400) [-771.487] (-772.454) -- 0:00:41
367000 -- (-771.486) [-771.870] (-775.205) (-773.560) * (-772.463) (-771.456) [-771.691] (-774.843) -- 0:00:41
367500 -- (-776.185) (-771.336) [-772.387] (-771.962) * (-773.469) (-771.368) [-775.909] (-775.357) -- 0:00:41
368000 -- [-773.854] (-772.557) (-771.953) (-774.603) * (-771.710) (-774.249) [-770.645] (-772.969) -- 0:00:41
368500 -- [-773.095] (-771.930) (-769.566) (-771.093) * (-772.982) (-772.689) (-770.603) [-772.995] -- 0:00:41
369000 -- (-772.032) (-772.843) (-772.588) [-771.046] * (-771.417) [-771.204] (-772.498) (-777.952) -- 0:00:41
369500 -- (-773.337) [-772.245] (-774.515) (-772.954) * (-771.953) [-772.102] (-771.465) (-772.309) -- 0:00:40
370000 -- (-776.388) (-771.676) (-775.068) [-773.015] * [-772.696] (-772.895) (-772.816) (-771.522) -- 0:00:40
Average standard deviation of split frequencies: 0.009276
370500 -- [-773.824] (-772.397) (-772.535) (-773.264) * [-770.697] (-775.219) (-775.090) (-773.969) -- 0:00:40
371000 -- (-773.331) (-775.521) (-771.864) [-773.041] * [-770.473] (-771.373) (-771.232) (-772.748) -- 0:00:40
371500 -- (-771.767) (-775.177) [-773.553] (-775.080) * (-777.114) (-771.886) (-774.259) [-773.353] -- 0:00:40
372000 -- (-772.328) (-773.313) [-773.265] (-771.905) * [-771.703] (-770.544) (-774.544) (-774.517) -- 0:00:40
372500 -- (-774.593) [-775.682] (-772.644) (-771.334) * [-772.398] (-771.110) (-773.591) (-774.706) -- 0:00:40
373000 -- (-773.074) [-772.167] (-771.881) (-772.986) * (-773.593) (-772.077) (-775.537) [-773.494] -- 0:00:40
373500 -- (-773.588) [-773.243] (-771.300) (-771.722) * (-775.391) (-771.814) [-773.692] (-776.294) -- 0:00:40
374000 -- (-774.433) (-777.952) (-772.979) [-770.930] * (-772.507) (-770.860) (-772.628) [-771.050] -- 0:00:40
374500 -- (-774.921) (-772.264) [-772.898] (-773.966) * [-772.312] (-775.835) (-774.167) (-771.201) -- 0:00:40
375000 -- (-774.002) (-771.362) (-773.896) [-774.354] * (-774.910) (-775.097) (-770.655) [-769.663] -- 0:00:41
Average standard deviation of split frequencies: 0.009661
375500 -- (-773.619) (-772.348) [-774.696] (-772.261) * [-772.394] (-771.983) (-771.713) (-774.120) -- 0:00:41
376000 -- [-775.468] (-773.537) (-775.883) (-771.600) * (-777.769) (-770.683) [-770.647] (-771.263) -- 0:00:41
376500 -- [-772.634] (-770.607) (-773.673) (-774.059) * (-773.392) (-772.192) [-772.486] (-771.360) -- 0:00:41
377000 -- [-773.246] (-770.218) (-772.003) (-772.431) * (-772.731) [-773.567] (-774.057) (-776.789) -- 0:00:41
377500 -- [-771.863] (-773.071) (-772.403) (-775.656) * (-772.577) [-772.470] (-772.376) (-773.680) -- 0:00:41
378000 -- [-773.219] (-773.773) (-774.014) (-775.434) * (-772.431) (-775.558) [-776.351] (-771.788) -- 0:00:41
378500 -- (-775.140) (-773.367) (-773.006) [-774.614] * (-772.011) (-776.998) [-775.855] (-773.873) -- 0:00:41
379000 -- [-774.084] (-775.013) (-773.348) (-771.459) * (-774.162) (-772.410) (-773.642) [-773.158] -- 0:00:40
379500 -- (-773.316) (-771.801) (-777.218) [-774.301] * [-774.010] (-772.742) (-772.064) (-772.631) -- 0:00:40
380000 -- (-772.629) (-771.360) (-776.910) [-772.622] * (-778.505) [-775.493] (-773.480) (-777.919) -- 0:00:40
Average standard deviation of split frequencies: 0.010854
380500 -- (-775.555) [-772.578] (-774.253) (-772.410) * (-771.777) (-772.191) [-772.512] (-778.797) -- 0:00:40
381000 -- (-775.158) (-773.274) (-775.243) [-771.246] * [-774.350] (-774.913) (-774.659) (-773.533) -- 0:00:40
381500 -- (-775.480) (-773.125) [-772.518] (-772.888) * (-773.945) [-773.023] (-771.444) (-773.074) -- 0:00:40
382000 -- [-772.441] (-771.895) (-771.849) (-774.613) * (-774.139) [-772.931] (-773.349) (-773.382) -- 0:00:40
382500 -- [-773.978] (-774.382) (-773.679) (-778.337) * [-772.150] (-774.135) (-774.098) (-772.645) -- 0:00:40
383000 -- [-773.199] (-774.742) (-774.509) (-774.940) * (-772.791) (-773.494) [-772.889] (-771.030) -- 0:00:40
383500 -- (-773.075) [-774.022] (-771.937) (-772.624) * (-774.903) (-770.933) (-773.347) [-770.419] -- 0:00:40
384000 -- (-775.258) [-774.211] (-774.389) (-774.742) * (-774.440) (-772.269) [-771.957] (-773.752) -- 0:00:40
384500 -- (-774.278) [-777.312] (-772.315) (-774.472) * (-775.027) (-774.695) (-771.658) [-778.266] -- 0:00:40
385000 -- (-770.931) (-775.848) [-772.974] (-772.659) * (-776.466) [-772.506] (-772.966) (-772.683) -- 0:00:39
Average standard deviation of split frequencies: 0.011566
385500 -- (-772.500) [-776.471] (-774.140) (-771.158) * (-774.115) (-773.560) (-775.270) [-774.419] -- 0:00:39
386000 -- (-771.285) (-776.190) (-774.177) [-773.295] * (-771.844) (-776.064) [-773.519] (-772.307) -- 0:00:39
386500 -- [-771.931] (-771.546) (-773.298) (-772.718) * (-774.087) [-775.895] (-772.905) (-771.822) -- 0:00:39
387000 -- (-774.255) [-773.600] (-772.179) (-773.547) * (-773.125) (-773.187) [-773.268] (-771.903) -- 0:00:39
387500 -- (-772.049) [-771.035] (-772.867) (-772.072) * [-773.988] (-772.664) (-772.880) (-771.106) -- 0:00:39
388000 -- (-772.528) (-772.986) [-773.695] (-774.005) * (-771.760) (-775.041) (-770.972) [-774.973] -- 0:00:39
388500 -- (-772.690) (-772.624) (-774.087) [-770.768] * (-774.636) (-777.201) [-770.710] (-773.529) -- 0:00:39
389000 -- (-775.368) [-770.463] (-774.267) (-774.093) * (-776.246) (-773.953) [-770.833] (-772.401) -- 0:00:39
389500 -- (-779.448) [-772.980] (-772.364) (-775.790) * [-773.633] (-772.677) (-774.736) (-775.112) -- 0:00:39
390000 -- (-773.199) (-773.783) [-776.079] (-777.894) * (-773.390) (-772.513) [-774.733] (-775.840) -- 0:00:39
Average standard deviation of split frequencies: 0.010292
390500 -- (-773.814) [-774.690] (-773.897) (-771.114) * (-772.218) (-770.953) [-775.689] (-775.129) -- 0:00:40
391000 -- (-773.222) [-770.625] (-774.246) (-771.986) * (-774.507) [-772.948] (-771.686) (-773.180) -- 0:00:40
391500 -- (-775.159) [-771.002] (-775.472) (-771.389) * [-773.907] (-775.928) (-773.437) (-772.134) -- 0:00:40
392000 -- [-772.691] (-775.149) (-773.102) (-770.261) * (-773.745) (-773.371) [-772.912] (-772.758) -- 0:00:40
392500 -- [-774.541] (-773.793) (-775.216) (-771.584) * [-772.920] (-770.878) (-772.861) (-772.469) -- 0:00:40
393000 -- (-774.253) (-777.728) [-773.221] (-770.767) * (-774.685) [-771.030] (-773.010) (-775.423) -- 0:00:40
393500 -- (-773.648) (-774.926) (-773.465) [-770.399] * (-771.278) (-772.813) [-772.889] (-772.797) -- 0:00:40
394000 -- [-774.160] (-774.151) (-772.740) (-774.054) * (-773.736) [-772.416] (-773.134) (-772.373) -- 0:00:39
394500 -- [-771.929] (-773.593) (-772.441) (-772.428) * (-771.825) (-771.867) [-773.630] (-772.513) -- 0:00:39
395000 -- (-772.341) (-774.205) (-776.275) [-775.063] * (-775.774) (-772.245) (-772.077) [-773.565] -- 0:00:39
Average standard deviation of split frequencies: 0.010084
395500 -- (-773.481) [-772.715] (-774.802) (-771.883) * (-772.260) (-772.297) [-774.879] (-774.312) -- 0:00:39
396000 -- [-772.772] (-772.659) (-774.317) (-779.230) * [-774.365] (-770.618) (-771.907) (-773.110) -- 0:00:39
396500 -- (-771.138) [-771.754] (-776.972) (-774.126) * [-777.040] (-770.792) (-771.142) (-774.037) -- 0:00:39
397000 -- [-774.383] (-772.331) (-774.314) (-772.311) * (-772.407) [-771.147] (-774.842) (-770.320) -- 0:00:39
397500 -- (-772.438) [-774.058] (-776.161) (-771.626) * [-773.016] (-775.985) (-772.505) (-775.595) -- 0:00:39
398000 -- (-772.533) (-772.229) [-773.754] (-773.251) * (-774.739) [-774.955] (-776.891) (-772.354) -- 0:00:39
398500 -- [-773.804] (-771.913) (-772.311) (-772.423) * (-771.161) (-771.081) (-772.620) [-772.575] -- 0:00:39
399000 -- (-770.735) [-771.485] (-773.911) (-775.383) * (-772.078) (-774.511) (-770.772) [-771.055] -- 0:00:39
399500 -- (-776.657) (-773.102) [-772.434] (-771.956) * (-770.434) (-775.962) [-772.689] (-771.796) -- 0:00:39
400000 -- (-775.305) (-772.416) [-773.945] (-772.215) * (-770.287) (-772.935) [-772.123] (-773.606) -- 0:00:39
Average standard deviation of split frequencies: 0.010589
400500 -- [-776.653] (-772.036) (-773.559) (-772.625) * [-771.767] (-775.590) (-773.519) (-772.315) -- 0:00:38
401000 -- (-774.327) (-772.810) (-773.074) [-773.808] * (-772.901) (-772.430) [-770.786] (-772.605) -- 0:00:38
401500 -- [-772.131] (-772.194) (-775.787) (-773.170) * (-773.885) (-771.660) [-770.916] (-771.254) -- 0:00:38
402000 -- (-770.963) (-772.724) (-774.123) [-771.793] * [-775.061] (-772.475) (-772.377) (-770.318) -- 0:00:38
402500 -- (-770.971) (-772.573) (-770.074) [-775.119] * (-774.584) (-772.854) (-775.728) [-770.829] -- 0:00:38
403000 -- (-772.952) [-773.378] (-770.085) (-775.811) * (-772.979) (-771.454) [-775.982] (-770.173) -- 0:00:38
403500 -- (-771.067) (-773.018) (-772.059) [-772.492] * (-773.540) (-772.610) (-770.640) [-770.516] -- 0:00:38
404000 -- [-770.917] (-775.221) (-773.582) (-772.110) * [-774.084] (-771.619) (-773.720) (-775.940) -- 0:00:38
404500 -- [-775.179] (-774.570) (-772.513) (-773.202) * (-772.906) (-772.026) [-771.861] (-773.177) -- 0:00:38
405000 -- (-774.457) (-772.374) (-770.983) [-770.118] * (-774.737) [-773.689] (-774.867) (-773.069) -- 0:00:38
Average standard deviation of split frequencies: 0.009220
405500 -- [-773.769] (-776.719) (-772.309) (-774.550) * (-775.766) (-772.866) (-775.228) [-774.364] -- 0:00:39
406000 -- (-772.327) (-772.181) [-771.103] (-773.454) * (-778.233) [-774.506] (-774.342) (-772.049) -- 0:00:39
406500 -- (-773.579) (-772.119) [-773.598] (-771.571) * (-775.374) [-771.110] (-774.271) (-774.225) -- 0:00:39
407000 -- (-771.826) (-772.176) [-771.426] (-776.197) * [-773.056] (-772.606) (-774.030) (-772.336) -- 0:00:39
407500 -- (-773.200) (-774.042) (-770.943) [-770.324] * (-776.583) (-771.136) (-771.773) [-771.215] -- 0:00:39
408000 -- [-774.363] (-772.532) (-774.382) (-774.538) * (-773.370) [-772.500] (-773.039) (-772.752) -- 0:00:39
408500 -- [-774.730] (-777.022) (-774.408) (-775.056) * (-771.621) [-771.717] (-773.675) (-771.775) -- 0:00:39
409000 -- [-773.017] (-775.305) (-775.662) (-773.208) * (-774.578) (-774.698) [-775.075] (-775.752) -- 0:00:39
409500 -- (-773.757) (-774.953) (-772.791) [-771.341] * [-771.409] (-773.600) (-774.402) (-771.999) -- 0:00:38
410000 -- (-774.436) (-773.664) [-774.505] (-773.113) * (-769.721) (-775.474) [-771.418] (-774.871) -- 0:00:38
Average standard deviation of split frequencies: 0.009251
410500 -- (-775.513) (-773.185) (-770.665) [-772.170] * (-775.355) (-774.287) [-772.104] (-775.340) -- 0:00:38
411000 -- [-771.090] (-773.171) (-771.481) (-773.637) * (-772.682) [-771.186] (-770.789) (-777.231) -- 0:00:38
411500 -- [-772.211] (-773.979) (-772.470) (-771.752) * [-770.742] (-773.728) (-771.901) (-775.564) -- 0:00:38
412000 -- [-771.792] (-776.820) (-773.914) (-772.003) * [-778.009] (-774.561) (-772.208) (-773.525) -- 0:00:38
412500 -- (-774.603) (-774.454) (-772.874) [-771.887] * (-771.730) [-773.763] (-774.859) (-773.134) -- 0:00:38
413000 -- (-773.129) (-776.950) [-773.089] (-772.329) * (-774.121) (-772.565) (-774.826) [-773.035] -- 0:00:38
413500 -- (-775.267) (-771.699) [-773.037] (-773.661) * [-773.261] (-773.771) (-774.583) (-773.308) -- 0:00:38
414000 -- (-772.681) [-770.930] (-777.283) (-776.980) * (-771.515) [-773.061] (-775.748) (-770.028) -- 0:00:38
414500 -- (-775.151) [-773.638] (-776.272) (-774.282) * (-777.235) (-772.531) [-773.573] (-773.314) -- 0:00:38
415000 -- [-772.870] (-773.321) (-774.730) (-772.989) * (-774.310) [-773.408] (-772.362) (-774.300) -- 0:00:38
Average standard deviation of split frequencies: 0.008999
415500 -- [-774.570] (-774.659) (-772.323) (-773.261) * (-777.102) [-773.310] (-771.084) (-771.446) -- 0:00:37
416000 -- (-773.722) (-774.748) [-773.512] (-771.737) * (-772.101) (-771.978) (-774.389) [-771.753] -- 0:00:37
416500 -- (-775.914) [-771.920] (-773.735) (-772.741) * [-776.235] (-771.354) (-771.683) (-773.301) -- 0:00:37
417000 -- (-774.667) (-771.038) [-774.473] (-772.651) * (-772.988) (-774.206) (-772.867) [-769.545] -- 0:00:37
417500 -- (-772.594) (-772.920) (-779.363) [-770.452] * (-774.140) [-774.626] (-774.300) (-769.923) -- 0:00:37
418000 -- (-772.036) [-772.171] (-771.692) (-773.609) * (-777.432) (-773.401) [-772.381] (-768.821) -- 0:00:37
418500 -- (-772.800) (-772.602) [-772.818] (-777.825) * (-775.946) (-770.263) (-772.413) [-774.834] -- 0:00:37
419000 -- [-773.943] (-772.867) (-774.473) (-771.339) * (-774.628) (-772.859) (-777.849) [-769.557] -- 0:00:37
419500 -- [-773.809] (-771.860) (-772.006) (-774.344) * (-773.708) [-772.568] (-773.086) (-774.305) -- 0:00:37
420000 -- (-775.331) [-771.468] (-772.611) (-771.040) * (-770.772) [-771.105] (-773.353) (-771.020) -- 0:00:37
Average standard deviation of split frequencies: 0.009756
420500 -- (-774.980) (-774.227) (-770.829) [-772.553] * (-772.527) (-774.734) [-775.936] (-773.881) -- 0:00:37
421000 -- (-772.113) (-774.198) (-775.860) [-771.147] * (-777.548) [-774.190] (-772.377) (-776.252) -- 0:00:38
421500 -- (-772.815) (-773.975) (-773.758) [-771.606] * (-776.039) (-770.026) [-773.195] (-773.544) -- 0:00:38
422000 -- (-771.712) (-772.610) (-772.214) [-776.151] * (-776.365) (-769.964) [-772.386] (-773.220) -- 0:00:38
422500 -- (-772.997) (-775.108) [-771.501] (-772.970) * (-774.996) [-769.586] (-774.580) (-772.209) -- 0:00:38
423000 -- [-772.184] (-772.182) (-774.272) (-771.908) * [-776.587] (-772.220) (-775.983) (-770.880) -- 0:00:38
423500 -- [-771.536] (-772.982) (-769.230) (-778.867) * (-774.816) (-773.084) (-774.145) [-771.867] -- 0:00:38
424000 -- (-769.870) (-774.020) [-774.090] (-771.551) * (-773.750) (-773.191) (-773.936) [-771.186] -- 0:00:38
424500 -- (-770.320) (-774.470) (-771.952) [-768.768] * (-772.969) (-776.166) [-773.536] (-771.453) -- 0:00:37
425000 -- [-774.240] (-772.854) (-771.405) (-775.810) * (-772.040) (-771.514) (-776.286) [-771.735] -- 0:00:37
Average standard deviation of split frequencies: 0.009467
425500 -- (-772.782) (-775.919) [-770.167] (-771.429) * (-777.905) (-771.795) [-769.865] (-772.857) -- 0:00:37
426000 -- (-772.582) [-773.161] (-773.543) (-771.490) * (-775.312) (-773.141) [-770.892] (-772.446) -- 0:00:37
426500 -- [-770.786] (-774.870) (-773.184) (-772.624) * (-773.066) (-771.672) (-775.002) [-769.860] -- 0:00:37
427000 -- (-772.445) (-774.186) (-773.626) [-770.929] * [-772.025] (-775.289) (-776.752) (-774.884) -- 0:00:37
427500 -- [-771.066] (-773.211) (-773.383) (-772.652) * (-772.216) [-773.104] (-773.558) (-773.275) -- 0:00:37
428000 -- (-772.869) [-772.855] (-775.011) (-772.935) * (-771.964) [-773.074] (-770.539) (-771.553) -- 0:00:37
428500 -- (-773.540) (-773.988) [-771.456] (-773.211) * [-773.129] (-774.831) (-772.876) (-770.761) -- 0:00:37
429000 -- [-774.373] (-774.056) (-771.038) (-776.910) * (-772.038) (-772.946) (-775.990) [-771.442] -- 0:00:37
429500 -- (-772.620) [-777.149] (-772.049) (-774.538) * (-773.659) (-773.413) (-772.387) [-772.661] -- 0:00:37
430000 -- (-771.515) (-773.918) (-772.199) [-774.823] * (-772.423) (-772.873) (-772.384) [-772.635] -- 0:00:37
Average standard deviation of split frequencies: 0.009486
430500 -- [-771.790] (-777.862) (-774.746) (-773.482) * (-773.549) [-771.955] (-772.569) (-774.186) -- 0:00:37
431000 -- (-773.417) (-772.058) (-773.872) [-772.100] * (-773.327) (-772.307) [-772.336] (-775.397) -- 0:00:36
431500 -- (-776.021) (-772.402) [-773.397] (-772.224) * (-771.895) (-771.494) [-772.589] (-771.590) -- 0:00:36
432000 -- (-771.166) (-774.936) [-771.193] (-771.081) * [-772.787] (-771.885) (-774.556) (-773.897) -- 0:00:36
432500 -- (-771.507) (-772.485) (-774.156) [-770.481] * (-772.144) (-769.933) [-774.246] (-771.139) -- 0:00:36
433000 -- (-774.970) (-773.679) [-775.765] (-773.436) * (-773.671) (-770.425) [-772.691] (-771.770) -- 0:00:36
433500 -- (-771.507) (-774.872) (-772.250) [-772.031] * [-774.145] (-771.262) (-774.604) (-772.518) -- 0:00:36
434000 -- (-776.471) (-774.198) (-775.131) [-771.807] * (-774.137) (-773.591) (-774.335) [-773.447] -- 0:00:36
434500 -- (-774.754) (-771.194) (-771.355) [-771.262] * (-774.388) [-771.719] (-777.588) (-770.810) -- 0:00:36
435000 -- [-771.227] (-775.801) (-771.541) (-775.429) * (-771.294) (-772.913) (-780.528) [-772.804] -- 0:00:36
Average standard deviation of split frequencies: 0.009430
435500 -- (-773.023) (-772.684) [-771.403] (-771.567) * [-771.874] (-774.942) (-777.634) (-772.749) -- 0:00:36
436000 -- (-772.550) (-772.233) (-772.491) [-775.838] * (-775.270) (-777.784) (-779.429) [-770.849] -- 0:00:37
436500 -- (-772.629) [-773.145] (-775.655) (-770.854) * [-771.016] (-776.276) (-773.876) (-771.705) -- 0:00:37
437000 -- (-772.036) (-773.175) (-773.965) [-772.268] * (-772.294) [-771.566] (-775.208) (-774.107) -- 0:00:37
437500 -- (-770.004) (-773.580) (-772.171) [-773.448] * [-769.896] (-780.265) (-776.640) (-777.520) -- 0:00:37
438000 -- (-771.300) (-774.156) [-771.851] (-775.804) * (-770.502) (-773.155) [-773.718] (-775.828) -- 0:00:37
438500 -- [-773.998] (-772.307) (-772.911) (-777.029) * (-774.472) [-774.796] (-773.659) (-776.183) -- 0:00:37
439000 -- (-774.708) [-774.337] (-772.619) (-778.840) * (-772.287) (-769.590) (-777.165) [-777.309] -- 0:00:37
439500 -- (-774.194) (-772.055) [-772.432] (-772.645) * (-772.290) [-772.745] (-773.342) (-773.303) -- 0:00:36
440000 -- [-775.332] (-771.426) (-773.975) (-772.683) * (-772.317) (-769.563) (-774.795) [-772.004] -- 0:00:36
Average standard deviation of split frequencies: 0.010005
440500 -- (-773.257) (-775.013) (-777.149) [-771.204] * (-774.423) [-770.811] (-776.006) (-774.249) -- 0:00:36
441000 -- [-772.414] (-774.522) (-772.833) (-772.869) * (-775.509) [-778.290] (-773.517) (-772.028) -- 0:00:36
441500 -- (-774.443) [-772.982] (-771.377) (-775.207) * (-772.271) [-771.584] (-772.055) (-774.106) -- 0:00:36
442000 -- [-774.339] (-772.687) (-776.496) (-774.092) * [-773.373] (-771.338) (-770.635) (-773.480) -- 0:00:36
442500 -- (-772.396) [-772.859] (-773.764) (-773.607) * (-771.185) (-772.260) [-772.357] (-774.038) -- 0:00:36
443000 -- (-774.063) (-771.845) (-772.529) [-771.049] * (-775.460) [-772.095] (-772.730) (-773.572) -- 0:00:36
443500 -- [-773.306] (-774.304) (-774.393) (-777.573) * (-774.401) [-771.054] (-773.852) (-772.679) -- 0:00:36
444000 -- (-772.233) (-773.165) [-772.113] (-774.444) * [-772.657] (-772.865) (-772.834) (-773.064) -- 0:00:36
444500 -- [-774.047] (-774.576) (-772.296) (-775.372) * (-770.953) (-772.487) [-771.557] (-779.601) -- 0:00:36
445000 -- (-772.234) (-773.171) (-772.905) [-771.690] * (-774.006) (-771.638) (-770.157) [-774.193] -- 0:00:36
Average standard deviation of split frequencies: 0.010452
445500 -- [-773.004] (-772.226) (-773.952) (-775.118) * [-778.866] (-772.234) (-774.898) (-775.747) -- 0:00:36
446000 -- (-771.554) (-770.989) [-771.006] (-773.334) * (-776.004) (-775.524) [-773.910] (-774.527) -- 0:00:36
446500 -- (-772.808) [-771.310] (-775.578) (-772.383) * (-775.433) (-776.347) (-772.697) [-771.790] -- 0:00:35
447000 -- (-774.274) (-771.896) [-777.369] (-771.281) * (-771.908) (-778.277) [-773.900] (-775.043) -- 0:00:35
447500 -- [-772.795] (-773.557) (-774.908) (-772.856) * [-774.260] (-769.639) (-773.038) (-778.707) -- 0:00:35
448000 -- (-772.805) (-772.833) (-773.005) [-772.532] * [-773.364] (-769.461) (-771.495) (-773.937) -- 0:00:35
448500 -- [-772.143] (-774.177) (-771.917) (-772.136) * (-773.247) (-772.958) [-772.815] (-772.639) -- 0:00:35
449000 -- [-775.003] (-773.442) (-772.850) (-773.612) * (-772.141) [-773.086] (-771.780) (-772.703) -- 0:00:35
449500 -- (-777.736) (-772.938) [-773.340] (-772.913) * (-776.103) (-772.930) [-770.569] (-772.421) -- 0:00:35
450000 -- (-779.092) (-773.249) (-772.411) [-773.859] * (-779.954) [-773.570] (-777.934) (-772.922) -- 0:00:35
Average standard deviation of split frequencies: 0.010402
450500 -- (-772.635) (-773.062) (-772.624) [-772.237] * (-774.066) (-771.910) [-774.216] (-772.408) -- 0:00:35
451000 -- (-777.612) [-770.466] (-774.834) (-772.280) * (-774.012) [-773.082] (-773.531) (-775.548) -- 0:00:35
451500 -- (-775.660) [-771.282] (-774.706) (-771.920) * (-772.379) (-774.120) (-772.792) [-774.931] -- 0:00:36
452000 -- (-772.384) [-774.713] (-777.800) (-771.381) * (-772.191) [-771.822] (-776.382) (-773.229) -- 0:00:36
452500 -- [-770.300] (-772.425) (-772.646) (-773.921) * [-775.672] (-775.649) (-772.968) (-774.139) -- 0:00:36
453000 -- (-773.695) [-772.890] (-773.964) (-775.562) * (-773.968) [-772.595] (-772.835) (-772.042) -- 0:00:36
453500 -- [-771.026] (-773.687) (-774.126) (-773.315) * (-775.277) [-772.112] (-772.689) (-772.287) -- 0:00:36
454000 -- (-772.023) (-773.132) (-775.481) [-772.925] * [-775.886] (-773.245) (-774.030) (-774.026) -- 0:00:36
454500 -- [-772.115] (-774.942) (-774.453) (-770.497) * (-773.447) (-771.294) (-776.429) [-774.296] -- 0:00:36
455000 -- (-771.260) (-773.339) (-771.294) [-774.814] * (-774.478) (-776.185) [-771.567] (-776.702) -- 0:00:35
Average standard deviation of split frequencies: 0.010166
455500 -- [-771.136] (-772.669) (-771.942) (-777.620) * [-775.141] (-772.210) (-778.975) (-775.490) -- 0:00:35
456000 -- (-771.792) (-774.653) (-773.569) [-774.961] * (-771.377) (-773.581) (-774.114) [-776.069] -- 0:00:35
456500 -- (-776.608) (-772.836) [-770.815] (-775.908) * (-773.258) (-769.720) [-773.568] (-774.101) -- 0:00:35
457000 -- (-770.306) [-769.929] (-770.904) (-770.799) * (-775.785) [-772.317] (-772.182) (-773.368) -- 0:00:35
457500 -- (-770.479) (-771.425) [-772.388] (-774.628) * (-774.565) [-777.580] (-771.665) (-771.838) -- 0:00:35
458000 -- (-774.272) [-771.027] (-775.904) (-772.326) * (-778.783) (-773.306) [-772.235] (-772.394) -- 0:00:35
458500 -- (-774.666) (-776.431) [-775.085] (-773.881) * (-773.989) (-772.494) (-778.804) [-772.851] -- 0:00:35
459000 -- (-772.086) [-772.447] (-770.594) (-774.395) * [-776.271] (-774.674) (-772.616) (-773.651) -- 0:00:35
459500 -- (-772.193) (-775.303) (-773.209) [-770.376] * (-773.790) (-772.553) (-772.363) [-770.709] -- 0:00:35
460000 -- [-773.910] (-778.284) (-772.805) (-775.594) * (-773.105) (-774.195) (-774.127) [-772.514] -- 0:00:35
Average standard deviation of split frequencies: 0.010895
460500 -- (-772.265) [-774.400] (-772.671) (-777.814) * (-773.724) (-773.303) (-772.602) [-771.737] -- 0:00:35
461000 -- (-773.668) (-772.483) [-770.589] (-773.471) * (-771.447) [-771.432] (-773.989) (-775.263) -- 0:00:35
461500 -- [-770.646] (-772.194) (-772.632) (-773.229) * [-771.739] (-772.925) (-773.503) (-773.813) -- 0:00:35
462000 -- [-771.832] (-774.266) (-772.637) (-770.473) * [-773.351] (-772.289) (-771.641) (-774.017) -- 0:00:34
462500 -- (-778.120) (-774.501) [-773.690] (-772.071) * (-777.476) (-773.558) [-772.041] (-773.816) -- 0:00:34
463000 -- (-771.995) [-770.914] (-771.518) (-776.504) * [-772.520] (-773.386) (-775.297) (-774.885) -- 0:00:34
463500 -- (-772.031) [-771.718] (-771.522) (-772.142) * (-773.401) (-770.640) (-773.173) [-776.070] -- 0:00:34
464000 -- (-773.994) (-775.748) (-771.315) [-770.984] * (-775.466) (-771.962) (-771.152) [-773.497] -- 0:00:34
464500 -- (-771.358) (-773.542) (-775.458) [-772.651] * (-774.574) [-773.362] (-776.206) (-771.828) -- 0:00:34
465000 -- [-771.995] (-774.346) (-772.292) (-773.759) * [-772.646] (-774.107) (-778.183) (-775.221) -- 0:00:34
Average standard deviation of split frequencies: 0.010949
465500 -- [-771.100] (-771.380) (-772.363) (-776.597) * (-777.711) [-774.116] (-772.702) (-774.126) -- 0:00:34
466000 -- [-772.590] (-772.764) (-773.869) (-773.329) * [-774.883] (-774.908) (-773.104) (-773.196) -- 0:00:34
466500 -- (-773.860) (-771.435) (-775.792) [-774.435] * (-774.124) (-775.757) [-773.416] (-769.642) -- 0:00:34
467000 -- (-775.956) (-772.990) (-774.606) [-775.786] * (-774.329) (-770.842) [-774.497] (-773.810) -- 0:00:35
467500 -- (-772.183) (-773.203) (-772.971) [-772.154] * (-774.318) [-772.595] (-774.882) (-774.104) -- 0:00:35
468000 -- (-773.179) (-774.429) (-779.187) [-772.502] * (-773.630) (-773.634) (-772.118) [-774.724] -- 0:00:35
468500 -- [-773.120] (-775.574) (-777.917) (-772.422) * (-772.729) (-772.468) (-773.436) [-772.976] -- 0:00:35
469000 -- (-777.571) (-774.357) (-773.524) [-773.685] * [-773.341] (-772.769) (-773.355) (-777.025) -- 0:00:35
469500 -- [-771.317] (-775.426) (-777.692) (-776.943) * (-773.638) (-773.935) [-771.514] (-776.474) -- 0:00:35
470000 -- (-773.590) [-770.922] (-773.088) (-771.420) * (-770.086) (-772.560) [-771.107] (-770.875) -- 0:00:34
Average standard deviation of split frequencies: 0.010487
470500 -- (-773.369) [-772.223] (-773.783) (-772.956) * (-773.268) (-773.902) (-772.083) [-771.123] -- 0:00:34
471000 -- (-772.584) [-777.656] (-773.288) (-773.618) * (-773.443) (-772.630) [-774.772] (-775.835) -- 0:00:34
471500 -- [-771.827] (-776.182) (-773.445) (-773.835) * (-773.784) (-774.770) [-778.270] (-772.904) -- 0:00:34
472000 -- (-771.598) (-774.342) (-772.751) [-773.418] * (-773.427) [-776.977] (-772.690) (-772.598) -- 0:00:34
472500 -- (-773.968) [-772.153] (-774.383) (-774.287) * (-773.650) [-772.590] (-775.588) (-772.559) -- 0:00:34
473000 -- (-774.280) (-774.346) [-773.611] (-771.567) * (-772.365) [-773.486] (-774.497) (-771.647) -- 0:00:34
473500 -- (-775.778) (-773.190) (-774.344) [-774.210] * (-775.184) (-771.603) (-778.972) [-770.664] -- 0:00:34
474000 -- (-774.029) [-775.771] (-771.737) (-773.366) * (-776.880) (-772.491) (-774.380) [-772.923] -- 0:00:34
474500 -- (-773.966) (-773.398) [-773.676] (-774.985) * (-775.375) (-774.745) (-777.245) [-772.107] -- 0:00:34
475000 -- (-775.119) (-770.617) [-771.680] (-774.448) * [-772.715] (-774.174) (-774.961) (-773.621) -- 0:00:34
Average standard deviation of split frequencies: 0.010584
475500 -- [-775.050] (-772.340) (-781.472) (-773.038) * (-774.254) (-774.885) (-772.828) [-775.015] -- 0:00:34
476000 -- [-773.794] (-772.285) (-778.198) (-773.727) * (-772.924) (-770.616) [-773.834] (-775.601) -- 0:00:34
476500 -- (-773.037) [-775.577] (-771.725) (-774.034) * [-770.946] (-770.235) (-772.026) (-772.481) -- 0:00:34
477000 -- (-773.821) (-772.339) (-774.157) [-771.831] * [-771.466] (-773.487) (-774.278) (-770.678) -- 0:00:33
477500 -- (-773.040) (-773.961) (-778.995) [-772.517] * (-775.924) (-776.188) [-774.355] (-773.624) -- 0:00:33
478000 -- (-772.281) (-773.633) [-772.961] (-771.188) * (-773.404) [-774.200] (-774.102) (-776.885) -- 0:00:33
478500 -- (-775.363) [-771.421] (-775.218) (-772.335) * [-772.400] (-774.301) (-774.388) (-775.910) -- 0:00:33
479000 -- (-775.743) [-775.784] (-774.552) (-771.982) * [-776.838] (-774.903) (-776.290) (-773.499) -- 0:00:33
479500 -- (-773.463) (-772.162) [-772.567] (-772.133) * (-776.121) (-775.704) [-772.755] (-774.316) -- 0:00:33
480000 -- (-778.794) (-771.500) (-772.954) [-772.075] * (-776.999) (-777.681) [-773.129] (-771.454) -- 0:00:33
Average standard deviation of split frequencies: 0.009873
480500 -- (-773.882) [-770.997] (-773.360) (-771.387) * (-772.739) (-776.143) [-772.577] (-773.234) -- 0:00:33
481000 -- (-774.555) (-772.448) [-773.065] (-775.322) * (-771.728) (-772.706) [-772.709] (-772.018) -- 0:00:33
481500 -- (-775.132) (-773.500) (-775.165) [-772.468] * [-772.937] (-776.288) (-772.686) (-771.087) -- 0:00:33
482000 -- [-773.796] (-772.339) (-772.031) (-771.400) * [-775.136] (-774.453) (-776.145) (-770.177) -- 0:00:33
482500 -- (-772.832) [-772.386] (-777.692) (-771.492) * (-772.355) (-773.199) [-774.359] (-772.663) -- 0:00:34
483000 -- (-778.467) (-774.363) (-772.777) [-770.552] * [-771.467] (-772.276) (-772.438) (-770.188) -- 0:00:34
483500 -- (-771.010) (-772.954) [-772.120] (-772.311) * (-772.718) (-772.923) (-780.752) [-772.086] -- 0:00:34
484000 -- (-770.932) (-772.310) (-773.583) [-774.904] * (-770.202) (-774.073) (-772.194) [-773.232] -- 0:00:34
484500 -- (-773.284) [-770.301] (-774.214) (-771.703) * (-770.534) (-773.323) [-771.224] (-777.728) -- 0:00:34
485000 -- [-772.343] (-771.055) (-773.267) (-774.369) * [-772.575] (-770.616) (-770.260) (-775.752) -- 0:00:33
Average standard deviation of split frequencies: 0.009441
485500 -- (-773.534) [-774.691] (-774.432) (-774.950) * [-773.655] (-772.276) (-775.622) (-772.384) -- 0:00:33
486000 -- (-773.507) [-775.819] (-772.751) (-772.801) * (-775.786) [-776.523] (-774.175) (-772.423) -- 0:00:33
486500 -- [-772.431] (-775.059) (-769.892) (-774.775) * (-772.185) [-771.279] (-771.453) (-772.838) -- 0:00:33
487000 -- (-771.020) (-777.305) [-771.687] (-776.502) * (-773.948) (-772.716) [-771.537] (-773.261) -- 0:00:33
487500 -- (-772.315) (-772.177) (-771.746) [-774.765] * (-772.174) (-773.174) (-773.984) [-773.077] -- 0:00:33
488000 -- [-774.002] (-773.114) (-774.749) (-773.978) * (-775.007) (-776.267) [-771.938] (-771.795) -- 0:00:33
488500 -- (-770.511) [-777.816] (-774.706) (-775.730) * (-773.595) (-776.197) [-770.651] (-774.014) -- 0:00:33
489000 -- (-776.236) [-772.238] (-772.811) (-773.463) * (-773.953) (-770.199) [-773.289] (-772.111) -- 0:00:33
489500 -- (-772.423) [-772.274] (-776.110) (-771.984) * (-777.995) [-771.526] (-779.173) (-773.505) -- 0:00:33
490000 -- (-772.678) [-772.836] (-774.601) (-772.389) * (-774.459) [-771.366] (-774.935) (-772.765) -- 0:00:33
Average standard deviation of split frequencies: 0.009928
490500 -- (-773.853) (-777.466) [-774.760] (-772.144) * (-772.003) [-775.063] (-772.092) (-772.670) -- 0:00:33
491000 -- (-773.027) (-776.205) [-772.747] (-773.047) * (-773.691) (-781.166) [-773.602] (-771.789) -- 0:00:33
491500 -- (-771.543) [-775.372] (-771.643) (-773.804) * [-774.270] (-780.023) (-776.909) (-773.391) -- 0:00:33
492000 -- [-773.914] (-774.273) (-774.918) (-773.912) * (-775.400) (-772.793) (-773.102) [-772.762] -- 0:00:33
492500 -- (-773.320) [-774.477] (-772.465) (-773.583) * (-775.597) (-773.738) (-772.038) [-775.500] -- 0:00:32
493000 -- (-774.734) [-770.825] (-774.281) (-773.019) * [-773.092] (-771.872) (-772.250) (-775.275) -- 0:00:32
493500 -- (-771.895) (-774.255) (-779.642) [-769.675] * (-776.818) (-776.736) [-770.104] (-773.805) -- 0:00:32
494000 -- (-774.479) [-772.529] (-773.653) (-773.444) * (-771.595) (-772.861) (-773.801) [-771.793] -- 0:00:32
494500 -- (-770.748) [-776.608] (-777.986) (-772.444) * (-771.748) [-772.497] (-775.668) (-772.711) -- 0:00:32
495000 -- (-771.025) [-772.594] (-777.361) (-776.216) * (-771.789) (-772.178) (-775.889) [-772.352] -- 0:00:32
Average standard deviation of split frequencies: 0.009948
495500 -- [-771.544] (-771.096) (-778.099) (-774.155) * [-773.889] (-773.932) (-771.659) (-778.833) -- 0:00:32
496000 -- (-771.248) [-771.944] (-776.354) (-773.838) * [-773.408] (-773.428) (-771.805) (-778.378) -- 0:00:32
496500 -- (-770.965) (-773.411) [-770.599] (-774.822) * (-774.015) (-774.662) (-772.653) [-772.994] -- 0:00:32
497000 -- (-772.744) (-772.779) (-775.253) [-773.103] * (-772.647) (-775.035) (-773.863) [-776.181] -- 0:00:32
497500 -- (-773.389) [-774.115] (-772.958) (-771.934) * (-772.289) [-771.015] (-775.894) (-773.152) -- 0:00:32
498000 -- [-770.402] (-774.339) (-774.555) (-772.417) * (-774.629) (-773.253) [-771.666] (-772.955) -- 0:00:33
498500 -- (-772.401) [-773.546] (-772.729) (-772.498) * (-772.826) [-773.244] (-774.458) (-772.298) -- 0:00:33
499000 -- (-770.547) (-772.417) (-771.959) [-773.984] * (-773.180) [-772.448] (-771.215) (-772.013) -- 0:00:33
499500 -- (-773.314) (-772.039) (-772.963) [-773.046] * (-776.712) (-772.424) (-770.794) [-773.168] -- 0:00:33
500000 -- [-773.158] (-773.250) (-774.296) (-773.856) * [-773.547] (-774.601) (-771.890) (-774.178) -- 0:00:33
Average standard deviation of split frequencies: 0.010169
500500 -- (-772.967) (-774.886) (-773.499) [-772.250] * (-776.342) [-772.768] (-774.366) (-774.122) -- 0:00:32
501000 -- [-773.448] (-775.430) (-771.116) (-773.609) * (-773.089) (-771.422) [-772.467] (-776.769) -- 0:00:32
501500 -- (-770.136) (-776.558) [-772.514] (-772.370) * (-773.367) [-772.839] (-777.167) (-772.499) -- 0:00:32
502000 -- (-771.284) (-773.963) [-776.149] (-771.291) * (-771.369) (-772.700) (-781.019) [-772.315] -- 0:00:32
502500 -- [-770.726] (-773.206) (-775.038) (-772.880) * (-775.314) (-774.313) (-771.598) [-772.203] -- 0:00:32
503000 -- (-772.260) (-772.005) (-773.939) [-772.687] * [-770.485] (-775.925) (-772.773) (-774.462) -- 0:00:32
503500 -- (-773.234) (-772.584) [-778.080] (-772.953) * [-772.382] (-776.674) (-773.835) (-773.234) -- 0:00:32
504000 -- (-773.864) [-774.328] (-775.224) (-773.066) * [-774.184] (-777.376) (-773.377) (-774.768) -- 0:00:32
504500 -- [-770.403] (-774.233) (-774.327) (-774.322) * (-776.868) (-773.914) [-774.851] (-774.945) -- 0:00:32
505000 -- [-771.108] (-774.852) (-773.263) (-771.505) * (-774.526) [-774.028] (-773.345) (-775.892) -- 0:00:32
Average standard deviation of split frequencies: 0.010062
505500 -- (-772.403) (-778.161) (-772.825) [-774.456] * (-773.207) [-772.499] (-773.163) (-774.255) -- 0:00:32
506000 -- [-773.587] (-772.730) (-772.729) (-773.923) * (-774.072) [-772.047] (-772.562) (-773.379) -- 0:00:32
506500 -- (-774.242) (-771.914) [-773.834] (-773.580) * (-773.916) (-774.168) (-779.758) [-773.959] -- 0:00:32
507000 -- (-774.603) (-774.633) (-771.037) [-773.303] * (-773.375) [-773.025] (-774.356) (-771.679) -- 0:00:32
507500 -- [-771.680] (-776.548) (-772.896) (-774.247) * (-773.199) (-774.098) [-775.689] (-773.645) -- 0:00:32
508000 -- (-773.876) (-775.097) (-771.355) [-771.681] * (-772.616) (-777.117) [-771.356] (-773.846) -- 0:00:31
508500 -- (-771.706) (-776.217) [-772.890] (-772.035) * [-772.197] (-781.455) (-771.865) (-772.570) -- 0:00:31
509000 -- (-773.193) (-775.471) (-771.206) [-772.818] * (-774.807) [-772.792] (-775.845) (-773.337) -- 0:00:31
509500 -- [-770.519] (-775.746) (-774.966) (-773.794) * (-773.702) (-775.692) (-773.946) [-772.625] -- 0:00:31
510000 -- (-773.167) (-776.667) (-777.554) [-771.421] * (-772.576) (-772.434) [-773.735] (-771.862) -- 0:00:31
Average standard deviation of split frequencies: 0.009723
510500 -- (-773.928) (-777.808) [-776.947] (-770.108) * (-771.943) (-772.774) [-772.060] (-770.997) -- 0:00:31
511000 -- (-772.867) (-774.125) [-775.523] (-771.163) * (-771.576) (-774.886) [-773.696] (-772.255) -- 0:00:31
511500 -- (-772.650) (-775.704) (-771.384) [-773.897] * (-772.766) [-771.742] (-776.217) (-775.339) -- 0:00:31
512000 -- (-772.319) (-773.612) (-773.411) [-772.172] * (-772.572) (-770.632) (-776.244) [-771.250] -- 0:00:31
512500 -- (-773.423) (-773.179) (-772.190) [-772.594] * (-773.425) (-773.747) [-774.305] (-772.728) -- 0:00:31
513000 -- [-774.033] (-774.908) (-772.518) (-771.310) * (-769.617) (-774.907) (-771.114) [-773.251] -- 0:00:31
513500 -- [-773.335] (-775.021) (-773.717) (-775.190) * [-771.275] (-778.480) (-774.148) (-772.426) -- 0:00:32
514000 -- [-773.043] (-772.886) (-774.429) (-773.207) * [-771.316] (-774.049) (-772.285) (-776.448) -- 0:00:32
514500 -- [-774.111] (-773.659) (-775.389) (-770.964) * (-770.435) [-772.746] (-776.002) (-773.230) -- 0:00:32
515000 -- (-773.439) [-771.298] (-771.473) (-773.786) * (-774.000) [-771.507] (-772.216) (-772.945) -- 0:00:32
Average standard deviation of split frequencies: 0.009440
515500 -- (-778.285) (-775.474) [-771.015] (-771.878) * (-770.409) (-774.999) [-772.959] (-771.518) -- 0:00:31
516000 -- (-783.518) (-775.421) (-772.445) [-772.663] * [-773.419] (-771.826) (-771.363) (-774.312) -- 0:00:31
516500 -- [-772.122] (-771.809) (-772.914) (-769.409) * (-773.942) (-771.777) [-772.734] (-772.700) -- 0:00:31
517000 -- [-774.683] (-777.115) (-772.479) (-771.167) * [-772.721] (-776.510) (-775.551) (-775.508) -- 0:00:31
517500 -- (-772.341) (-776.222) (-772.858) [-771.978] * (-772.800) (-778.101) (-774.532) [-773.105] -- 0:00:31
518000 -- (-771.546) (-773.444) (-770.314) [-769.902] * [-774.559] (-773.234) (-776.046) (-776.676) -- 0:00:31
518500 -- (-772.504) (-775.360) (-773.997) [-771.492] * (-776.144) (-774.444) [-774.888] (-773.534) -- 0:00:31
519000 -- (-773.051) (-772.867) (-770.389) [-772.165] * (-774.681) (-770.512) (-773.069) [-773.260] -- 0:00:31
519500 -- (-780.086) [-774.546] (-774.496) (-773.880) * (-773.334) [-773.365] (-776.025) (-774.933) -- 0:00:31
520000 -- (-775.214) (-773.258) (-774.892) [-773.613] * (-770.526) (-774.611) (-776.326) [-773.244] -- 0:00:31
Average standard deviation of split frequencies: 0.010140
520500 -- [-773.326] (-772.469) (-775.601) (-775.217) * [-770.544] (-773.708) (-772.623) (-772.040) -- 0:00:31
521000 -- (-775.724) [-773.218] (-771.518) (-770.671) * (-770.181) (-776.066) [-772.855] (-772.921) -- 0:00:31
521500 -- (-772.964) (-772.429) [-770.226] (-773.185) * [-771.113] (-776.381) (-774.426) (-773.537) -- 0:00:31
522000 -- (-772.660) (-775.176) [-770.321] (-776.143) * (-770.479) (-771.116) [-773.539] (-772.380) -- 0:00:31
522500 -- (-772.864) (-773.876) (-771.385) [-776.700] * (-773.464) (-773.099) (-774.712) [-774.217] -- 0:00:31
523000 -- (-773.425) [-772.918] (-777.615) (-776.247) * (-772.184) (-775.360) (-778.166) [-771.507] -- 0:00:31
523500 -- (-773.445) [-773.250] (-770.235) (-776.202) * (-772.565) (-770.612) (-773.462) [-774.022] -- 0:00:30
524000 -- (-771.025) (-773.973) [-770.075] (-776.408) * (-771.837) [-773.625] (-772.880) (-772.466) -- 0:00:30
524500 -- (-771.419) [-771.383] (-770.707) (-774.019) * [-774.182] (-775.669) (-771.975) (-773.606) -- 0:00:30
525000 -- (-771.433) (-771.754) [-771.369] (-772.081) * (-771.692) (-769.064) (-773.909) [-772.606] -- 0:00:30
Average standard deviation of split frequencies: 0.010396
525500 -- [-773.172] (-774.158) (-773.353) (-773.935) * [-773.010] (-771.852) (-771.599) (-772.499) -- 0:00:30
526000 -- (-771.940) (-771.343) [-775.967] (-773.057) * (-770.767) (-774.002) (-772.757) [-772.327] -- 0:00:30
526500 -- (-770.771) [-775.018] (-772.164) (-773.903) * [-770.932] (-772.571) (-775.845) (-774.080) -- 0:00:30
527000 -- (-771.777) (-774.015) (-772.318) [-774.819] * (-773.804) [-769.962] (-777.167) (-772.175) -- 0:00:30
527500 -- (-771.527) (-774.503) (-771.638) [-774.936] * [-772.782] (-770.995) (-775.240) (-772.493) -- 0:00:30
528000 -- (-773.282) (-772.837) [-770.699] (-773.218) * (-775.872) (-773.893) [-772.979] (-772.452) -- 0:00:30
528500 -- [-772.699] (-774.495) (-772.018) (-771.307) * (-773.827) [-770.779] (-773.935) (-773.135) -- 0:00:30
529000 -- [-770.730] (-772.715) (-774.733) (-774.883) * (-772.877) (-770.986) [-775.054] (-772.430) -- 0:00:30
529500 -- [-774.493] (-773.486) (-777.489) (-776.444) * (-773.455) (-770.861) [-775.019] (-772.907) -- 0:00:31
530000 -- (-774.545) (-775.330) (-775.962) [-775.713] * (-773.956) (-775.316) (-773.899) [-773.310] -- 0:00:31
Average standard deviation of split frequencies: 0.010838
530500 -- (-773.870) (-778.400) [-774.768] (-775.218) * (-773.475) [-769.691] (-774.241) (-777.329) -- 0:00:30
531000 -- (-770.940) (-774.019) [-771.888] (-773.607) * (-774.093) (-772.604) [-773.924] (-772.709) -- 0:00:30
531500 -- (-782.562) (-772.455) [-774.489] (-774.148) * (-774.184) [-771.898] (-774.840) (-775.844) -- 0:00:30
532000 -- (-779.902) (-775.244) (-770.538) [-772.834] * [-772.315] (-772.816) (-772.161) (-774.934) -- 0:00:30
532500 -- (-778.312) (-775.632) (-772.220) [-772.911] * (-775.229) (-770.853) [-772.671] (-772.137) -- 0:00:30
533000 -- (-776.544) [-774.109] (-772.993) (-773.562) * (-771.851) [-771.923] (-772.687) (-771.576) -- 0:00:30
533500 -- (-775.117) (-775.539) [-773.813] (-773.289) * [-771.638] (-774.945) (-775.600) (-771.447) -- 0:00:30
534000 -- [-773.806] (-774.381) (-772.073) (-773.336) * [-772.966] (-773.123) (-774.208) (-771.264) -- 0:00:30
534500 -- (-781.790) (-774.044) (-772.756) [-770.862] * (-772.103) [-774.999] (-774.291) (-773.148) -- 0:00:30
535000 -- (-773.965) [-771.408] (-770.831) (-772.943) * (-772.085) (-772.285) (-772.959) [-773.039] -- 0:00:30
Average standard deviation of split frequencies: 0.011375
535500 -- (-776.472) (-771.870) (-776.487) [-771.659] * (-773.504) (-773.416) (-771.647) [-775.408] -- 0:00:30
536000 -- (-772.990) (-771.162) [-771.016] (-781.006) * (-773.964) [-770.830] (-773.678) (-777.114) -- 0:00:30
536500 -- (-773.888) (-775.868) [-772.053] (-773.227) * [-772.349] (-773.818) (-772.791) (-774.490) -- 0:00:30
537000 -- (-770.267) [-775.175] (-773.664) (-777.775) * (-771.759) (-775.886) (-778.849) [-771.855] -- 0:00:30
537500 -- (-778.910) [-772.216] (-773.793) (-777.317) * (-772.809) (-773.314) (-775.697) [-773.014] -- 0:00:30
538000 -- (-772.080) (-771.530) (-775.627) [-772.976] * (-774.352) (-773.586) [-774.566] (-772.534) -- 0:00:30
538500 -- (-770.152) [-771.288] (-772.812) (-777.110) * (-773.561) (-769.773) (-775.689) [-771.713] -- 0:00:29
539000 -- (-773.235) (-771.576) [-771.795] (-774.933) * (-778.784) (-775.786) (-776.350) [-776.503] -- 0:00:29
539500 -- (-773.499) (-772.317) [-772.458] (-773.161) * [-773.417] (-773.898) (-773.231) (-773.581) -- 0:00:29
540000 -- (-773.616) (-773.080) [-774.287] (-773.452) * [-773.360] (-771.771) (-773.602) (-773.135) -- 0:00:29
Average standard deviation of split frequencies: 0.011451
540500 -- (-772.921) (-774.558) (-772.198) [-771.498] * (-774.912) (-772.122) (-772.881) [-773.229] -- 0:00:29
541000 -- (-774.855) (-777.597) (-775.749) [-771.853] * (-775.407) [-772.621] (-775.492) (-773.346) -- 0:00:29
541500 -- (-774.710) (-773.390) [-775.083] (-772.594) * (-774.023) (-769.774) [-772.539] (-777.825) -- 0:00:29
542000 -- (-773.888) [-773.119] (-770.288) (-770.052) * [-773.078] (-770.536) (-772.958) (-773.522) -- 0:00:29
542500 -- [-771.020] (-774.415) (-775.438) (-771.298) * (-773.193) (-773.076) [-772.423] (-776.863) -- 0:00:29
543000 -- (-772.875) (-774.185) [-771.572] (-772.262) * [-772.196] (-773.391) (-774.602) (-774.727) -- 0:00:29
543500 -- (-773.927) [-770.299] (-772.836) (-776.064) * (-773.744) (-774.277) [-773.067] (-777.300) -- 0:00:29
544000 -- (-776.136) (-773.193) [-774.460] (-774.593) * [-775.302] (-773.611) (-774.209) (-777.664) -- 0:00:29
544500 -- (-773.117) (-773.185) [-773.255] (-772.785) * [-773.941] (-772.484) (-773.027) (-775.281) -- 0:00:29
545000 -- (-772.412) (-772.078) [-771.269] (-773.265) * [-773.690] (-771.725) (-774.865) (-773.925) -- 0:00:30
Average standard deviation of split frequencies: 0.011569
545500 -- (-775.934) [-775.333] (-773.066) (-774.960) * (-776.112) [-772.959] (-772.931) (-773.488) -- 0:00:29
546000 -- [-773.930] (-774.177) (-772.271) (-772.247) * (-772.470) (-773.952) (-774.563) [-771.443] -- 0:00:29
546500 -- (-772.741) [-774.675] (-772.543) (-776.955) * (-772.993) (-777.676) [-773.462] (-773.135) -- 0:00:29
547000 -- (-773.186) [-773.566] (-771.090) (-780.614) * [-772.851] (-772.170) (-770.681) (-771.608) -- 0:00:29
547500 -- [-773.757] (-774.194) (-771.000) (-774.232) * (-772.877) [-772.961] (-773.239) (-774.123) -- 0:00:29
548000 -- (-772.759) (-771.536) (-772.998) [-772.936] * [-773.286] (-772.780) (-772.826) (-773.568) -- 0:00:29
548500 -- (-772.748) (-772.527) (-772.372) [-774.649] * (-772.854) [-773.866] (-771.590) (-771.940) -- 0:00:29
549000 -- [-772.080] (-771.048) (-773.947) (-775.779) * (-773.722) [-776.603] (-773.114) (-777.381) -- 0:00:29
549500 -- (-773.089) (-772.323) [-773.914] (-772.056) * [-774.411] (-770.737) (-772.479) (-773.299) -- 0:00:29
550000 -- (-771.367) (-772.677) (-778.955) [-771.774] * [-772.912] (-773.456) (-773.135) (-773.499) -- 0:00:29
Average standard deviation of split frequencies: 0.011186
550500 -- [-771.367] (-773.365) (-778.844) (-770.587) * (-774.992) (-771.367) [-773.495] (-772.731) -- 0:00:29
551000 -- (-773.929) (-777.337) [-771.199] (-776.228) * (-775.834) [-775.751] (-770.968) (-773.867) -- 0:00:29
551500 -- (-772.203) (-774.730) (-771.659) [-776.634] * (-772.227) (-776.164) [-771.337] (-773.317) -- 0:00:29
552000 -- (-775.201) (-772.373) (-774.228) [-770.799] * (-776.860) (-771.316) [-772.395] (-772.155) -- 0:00:29
552500 -- (-774.454) (-771.797) (-774.643) [-771.984] * (-771.655) [-773.401] (-773.118) (-771.570) -- 0:00:29
553000 -- (-774.043) [-770.683] (-772.641) (-770.524) * (-773.086) [-770.968] (-772.767) (-773.811) -- 0:00:29
553500 -- [-773.846] (-775.157) (-772.146) (-772.542) * (-773.095) (-772.525) (-774.044) [-772.894] -- 0:00:29
554000 -- (-776.084) [-774.722] (-770.779) (-772.749) * [-773.315] (-772.930) (-771.660) (-779.420) -- 0:00:28
554500 -- (-771.630) (-771.877) (-772.286) [-771.209] * (-771.265) (-773.209) (-772.943) [-773.995] -- 0:00:28
555000 -- (-771.319) (-778.216) [-770.073] (-771.594) * (-772.136) (-769.874) [-772.441] (-772.094) -- 0:00:28
Average standard deviation of split frequencies: 0.011361
555500 -- (-774.751) [-773.433] (-769.863) (-772.090) * [-771.266] (-770.023) (-772.942) (-772.452) -- 0:00:28
556000 -- (-773.034) (-774.026) [-771.980] (-772.334) * (-771.032) [-771.193] (-774.318) (-772.991) -- 0:00:28
556500 -- (-772.975) (-771.246) (-772.535) [-773.991] * (-774.277) (-777.996) [-770.859] (-773.077) -- 0:00:28
557000 -- (-771.548) (-771.269) (-772.003) [-775.915] * (-773.979) (-774.633) [-772.034] (-774.578) -- 0:00:28
557500 -- [-773.315] (-775.487) (-770.343) (-774.074) * (-770.923) [-770.435] (-773.537) (-772.603) -- 0:00:28
558000 -- (-774.984) (-772.377) (-772.221) [-773.111] * (-771.815) (-772.023) [-773.866] (-776.060) -- 0:00:28
558500 -- (-773.472) [-773.164] (-770.184) (-771.579) * [-773.568] (-771.401) (-772.494) (-775.656) -- 0:00:28
559000 -- (-772.012) (-774.702) [-773.816] (-776.538) * (-773.160) (-771.220) [-773.935] (-775.546) -- 0:00:28
559500 -- (-773.908) [-775.236] (-771.968) (-771.955) * (-771.813) (-774.189) [-773.982] (-771.536) -- 0:00:28
560000 -- (-776.562) (-771.361) [-774.023] (-772.318) * (-771.421) [-772.492] (-773.289) (-771.803) -- 0:00:29
Average standard deviation of split frequencies: 0.011155
560500 -- (-773.920) (-771.124) [-773.240] (-774.292) * (-774.748) [-771.194] (-772.764) (-775.833) -- 0:00:29
561000 -- (-776.638) (-771.452) (-777.550) [-772.810] * [-777.142] (-771.370) (-773.230) (-771.010) -- 0:00:28
561500 -- (-777.025) (-770.353) (-775.738) [-770.706] * (-780.666) (-770.786) (-772.420) [-772.620] -- 0:00:28
562000 -- [-773.944] (-774.044) (-770.692) (-772.332) * (-772.305) (-772.018) [-772.402] (-775.017) -- 0:00:28
562500 -- (-773.686) (-777.202) (-773.939) [-775.708] * [-774.299] (-775.265) (-771.515) (-775.716) -- 0:00:28
563000 -- (-772.947) [-773.430] (-773.345) (-772.707) * [-773.142] (-773.000) (-771.164) (-773.973) -- 0:00:28
563500 -- (-772.319) (-771.591) [-773.013] (-774.461) * (-773.589) (-773.160) [-770.555] (-772.377) -- 0:00:28
564000 -- (-770.909) (-773.981) [-773.121] (-772.810) * (-772.824) [-773.540] (-774.112) (-771.385) -- 0:00:28
564500 -- [-773.659] (-772.971) (-771.989) (-770.878) * (-774.305) [-770.775] (-775.369) (-774.050) -- 0:00:28
565000 -- (-773.079) (-773.696) (-773.227) [-772.677] * (-772.260) (-777.151) [-770.165] (-774.551) -- 0:00:28
Average standard deviation of split frequencies: 0.011216
565500 -- (-773.771) (-776.325) [-773.164] (-771.886) * (-773.410) [-770.703] (-772.141) (-771.906) -- 0:00:28
566000 -- (-774.212) [-773.892] (-772.082) (-772.292) * (-776.414) (-771.761) [-770.956] (-773.154) -- 0:00:28
566500 -- [-772.617] (-770.791) (-771.506) (-769.680) * (-774.181) (-774.627) (-771.876) [-772.508] -- 0:00:28
567000 -- [-771.167] (-778.141) (-770.880) (-770.809) * (-774.386) [-771.565] (-775.078) (-771.587) -- 0:00:28
567500 -- (-773.462) [-772.464] (-773.078) (-774.844) * (-777.903) (-774.694) [-772.782] (-777.652) -- 0:00:28
568000 -- (-774.136) (-772.771) [-771.776] (-774.624) * [-774.197] (-776.203) (-772.675) (-771.189) -- 0:00:28
568500 -- (-772.115) [-773.557] (-769.487) (-774.275) * (-770.822) [-773.706] (-772.141) (-773.926) -- 0:00:28
569000 -- [-773.003] (-772.827) (-773.087) (-775.005) * (-773.987) (-774.192) [-772.723] (-775.519) -- 0:00:28
569500 -- (-773.589) (-773.747) (-774.686) [-775.347] * (-774.255) [-777.336] (-771.778) (-772.604) -- 0:00:27
570000 -- (-774.022) (-773.459) (-776.287) [-771.088] * (-772.084) [-773.123] (-771.834) (-771.949) -- 0:00:27
Average standard deviation of split frequencies: 0.011014
570500 -- (-778.659) [-771.153] (-774.067) (-771.793) * [-771.491] (-774.450) (-773.021) (-772.878) -- 0:00:27
571000 -- [-771.254] (-771.415) (-774.997) (-773.793) * (-773.079) (-773.896) [-770.568] (-775.016) -- 0:00:27
571500 -- [-772.045] (-770.691) (-780.094) (-777.987) * [-777.458] (-772.993) (-771.374) (-773.697) -- 0:00:27
572000 -- (-775.498) (-771.985) [-770.591] (-772.942) * (-775.941) (-774.704) (-773.427) [-772.392] -- 0:00:27
572500 -- (-774.214) (-770.693) (-775.512) [-771.635] * (-774.548) (-776.365) [-771.363] (-773.833) -- 0:00:27
573000 -- (-773.514) (-771.497) [-774.027] (-772.515) * (-775.124) (-775.373) (-772.437) [-771.531] -- 0:00:27
573500 -- (-777.706) [-769.693] (-773.941) (-775.490) * (-776.556) [-770.051] (-773.507) (-772.574) -- 0:00:27
574000 -- (-773.649) (-771.169) [-773.290] (-774.036) * (-773.445) (-771.901) [-772.595] (-772.231) -- 0:00:27
574500 -- [-773.000] (-772.631) (-772.717) (-770.900) * (-775.563) (-770.691) [-774.033] (-771.611) -- 0:00:27
575000 -- (-772.972) (-772.396) (-771.882) [-776.612] * (-774.989) (-770.563) [-772.084] (-773.403) -- 0:00:27
Average standard deviation of split frequencies: 0.009875
575500 -- (-776.851) [-769.718] (-771.762) (-772.944) * [-777.052] (-774.398) (-771.031) (-771.233) -- 0:00:28
576000 -- (-771.906) (-769.734) (-773.288) [-772.843] * (-773.609) (-773.249) (-772.445) [-769.741] -- 0:00:27
576500 -- [-772.347] (-771.485) (-775.898) (-773.927) * (-772.273) (-774.358) (-772.327) [-773.201] -- 0:00:27
577000 -- (-770.914) (-772.203) (-772.352) [-773.037] * [-770.963] (-774.518) (-772.873) (-772.177) -- 0:00:27
577500 -- (-776.204) (-772.348) [-772.719] (-774.590) * [-774.470] (-776.189) (-774.865) (-773.710) -- 0:00:27
578000 -- [-772.963] (-772.127) (-771.692) (-772.898) * [-772.349] (-771.578) (-776.640) (-772.371) -- 0:00:27
578500 -- [-774.779] (-773.505) (-770.462) (-773.228) * (-773.818) (-770.960) [-773.205] (-776.329) -- 0:00:27
579000 -- (-774.643) (-772.463) [-776.373] (-772.121) * (-771.381) [-772.391] (-772.969) (-778.001) -- 0:00:27
579500 -- (-774.553) (-777.417) [-778.809] (-770.490) * (-773.494) [-771.963] (-772.546) (-776.918) -- 0:00:27
580000 -- (-774.725) (-771.242) [-774.248] (-774.162) * (-770.843) [-773.348] (-773.781) (-773.658) -- 0:00:27
Average standard deviation of split frequencies: 0.009742
580500 -- (-775.375) (-770.417) [-773.007] (-771.615) * (-772.077) (-776.562) (-773.850) [-773.014] -- 0:00:27
581000 -- (-776.701) [-773.181] (-775.575) (-772.079) * (-773.661) (-780.159) (-773.404) [-771.975] -- 0:00:27
581500 -- (-773.201) [-771.871] (-776.742) (-774.644) * (-772.687) [-773.417] (-774.740) (-771.474) -- 0:00:27
582000 -- [-773.267] (-775.358) (-772.072) (-772.303) * [-778.251] (-772.814) (-779.330) (-771.926) -- 0:00:27
582500 -- (-774.498) (-773.409) [-777.097] (-772.276) * (-772.678) [-774.573] (-777.060) (-772.894) -- 0:00:27
583000 -- (-776.053) (-772.974) [-773.270] (-774.760) * [-775.314] (-772.073) (-771.932) (-773.116) -- 0:00:27
583500 -- [-773.612] (-772.663) (-772.812) (-772.913) * (-780.837) [-772.806] (-773.757) (-773.463) -- 0:00:27
584000 -- (-777.890) (-772.622) [-774.127] (-773.649) * (-773.702) (-775.013) (-774.113) [-772.958] -- 0:00:27
584500 -- (-775.112) (-774.286) (-771.695) [-774.842] * (-775.526) (-777.863) (-773.053) [-770.867] -- 0:00:27
585000 -- (-773.978) [-771.545] (-770.736) (-768.898) * (-774.606) [-773.124] (-773.232) (-773.793) -- 0:00:26
Average standard deviation of split frequencies: 0.009100
585500 -- (-773.948) (-774.928) (-771.382) [-770.650] * [-774.768] (-772.843) (-776.982) (-773.050) -- 0:00:26
586000 -- (-774.039) (-776.353) (-770.501) [-773.316] * (-773.514) (-774.992) [-771.783] (-771.921) -- 0:00:26
586500 -- (-776.042) (-775.503) [-773.352] (-776.864) * (-775.015) (-776.290) [-771.145] (-774.046) -- 0:00:26
587000 -- (-773.133) [-773.644] (-772.376) (-782.688) * (-774.728) (-772.816) (-771.131) [-771.631] -- 0:00:26
587500 -- [-774.675] (-774.366) (-773.066) (-775.317) * (-773.693) (-771.886) [-774.713] (-774.567) -- 0:00:26
588000 -- (-771.869) (-774.522) [-771.512] (-774.092) * [-770.980] (-772.808) (-771.959) (-773.578) -- 0:00:26
588500 -- (-772.652) (-772.611) [-772.600] (-771.419) * (-771.286) [-776.121] (-773.604) (-776.110) -- 0:00:26
589000 -- (-773.269) (-773.961) (-770.517) [-772.658] * (-772.994) [-773.893] (-775.125) (-771.512) -- 0:00:26
589500 -- (-773.808) [-772.012] (-773.468) (-773.401) * (-776.182) (-774.413) [-773.413] (-773.132) -- 0:00:26
590000 -- (-781.786) (-774.630) [-772.218] (-771.241) * (-773.538) (-775.091) (-772.494) [-772.636] -- 0:00:26
Average standard deviation of split frequencies: 0.008829
590500 -- (-781.595) [-773.143] (-773.668) (-772.812) * (-773.175) (-771.374) (-774.156) [-772.360] -- 0:00:26
591000 -- (-778.147) [-773.835] (-771.015) (-771.209) * (-778.079) (-773.817) (-772.730) [-776.043] -- 0:00:26
591500 -- (-773.957) (-774.453) (-772.093) [-770.082] * (-775.141) (-774.984) [-771.750] (-784.429) -- 0:00:26
592000 -- (-774.136) [-773.866] (-772.163) (-769.709) * [-772.860] (-771.790) (-772.963) (-774.207) -- 0:00:26
592500 -- (-774.845) (-774.910) (-772.491) [-771.414] * (-772.613) (-773.927) (-772.612) [-771.873] -- 0:00:26
593000 -- (-774.027) (-772.741) (-770.983) [-772.512] * (-772.660) [-776.377] (-774.119) (-772.052) -- 0:00:26
593500 -- (-774.017) (-773.725) (-773.909) [-770.652] * [-771.997] (-770.481) (-773.700) (-770.741) -- 0:00:26
594000 -- [-772.873] (-772.724) (-773.770) (-771.861) * (-771.482) (-774.733) [-774.286] (-770.656) -- 0:00:26
594500 -- (-772.581) (-772.805) [-769.831] (-770.156) * [-772.651] (-772.455) (-772.493) (-773.309) -- 0:00:26
595000 -- (-773.102) (-775.626) (-772.368) [-771.255] * [-773.770] (-772.733) (-771.596) (-772.410) -- 0:00:26
Average standard deviation of split frequencies: 0.008859
595500 -- (-772.868) (-773.928) [-772.839] (-772.186) * (-777.252) (-771.568) [-773.950] (-781.322) -- 0:00:26
596000 -- [-771.619] (-772.414) (-771.140) (-770.473) * (-770.729) [-771.773] (-772.273) (-780.970) -- 0:00:26
596500 -- [-773.385] (-775.329) (-772.119) (-773.444) * [-772.295] (-771.745) (-775.057) (-771.537) -- 0:00:26
597000 -- (-776.757) (-773.195) [-770.506] (-770.289) * (-771.479) (-773.315) [-771.177] (-771.650) -- 0:00:26
597500 -- (-772.908) [-772.153] (-771.004) (-771.333) * [-771.767] (-771.557) (-773.639) (-770.972) -- 0:00:26
598000 -- (-777.411) (-775.072) [-775.536] (-771.390) * [-772.692] (-773.431) (-772.800) (-774.733) -- 0:00:26
598500 -- (-773.479) (-773.555) [-770.813] (-774.538) * (-773.661) (-771.708) [-773.799] (-772.952) -- 0:00:26
599000 -- (-770.647) [-775.368] (-774.744) (-772.891) * (-774.076) [-773.284] (-770.723) (-771.686) -- 0:00:26
599500 -- (-770.849) [-771.041] (-774.582) (-776.143) * (-773.892) (-773.089) (-775.758) [-772.932] -- 0:00:26
600000 -- (-771.635) [-770.672] (-771.548) (-774.348) * (-774.092) (-777.236) [-774.102] (-773.024) -- 0:00:25
Average standard deviation of split frequencies: 0.008476
600500 -- (-772.402) (-772.475) [-771.528] (-772.917) * [-772.358] (-774.157) (-773.314) (-773.838) -- 0:00:25
601000 -- (-775.112) [-774.030] (-772.064) (-772.295) * (-773.378) [-774.865] (-775.362) (-772.214) -- 0:00:25
601500 -- (-777.071) (-772.577) (-771.639) [-772.350] * (-770.577) (-771.648) (-773.827) [-774.849] -- 0:00:25
602000 -- (-773.199) [-772.721] (-775.134) (-773.154) * [-772.881] (-773.091) (-772.915) (-770.562) -- 0:00:25
602500 -- (-774.026) [-773.275] (-772.970) (-775.155) * (-775.759) [-771.836] (-775.218) (-772.302) -- 0:00:25
603000 -- [-770.825] (-775.663) (-772.468) (-773.643) * (-773.711) (-774.422) [-772.488] (-776.828) -- 0:00:25
603500 -- [-772.464] (-778.183) (-770.522) (-777.196) * [-772.610] (-771.346) (-773.758) (-775.006) -- 0:00:25
604000 -- [-772.159] (-776.115) (-771.435) (-775.439) * (-773.042) (-779.061) [-776.352] (-779.820) -- 0:00:25
604500 -- (-774.737) (-772.733) (-770.317) [-772.224] * [-772.628] (-774.832) (-773.108) (-774.926) -- 0:00:25
605000 -- (-772.221) (-774.187) [-772.890] (-770.621) * (-773.238) [-777.906] (-772.765) (-773.710) -- 0:00:25
Average standard deviation of split frequencies: 0.007779
605500 -- (-777.981) (-775.870) [-773.204] (-771.928) * (-777.734) (-773.786) [-772.403] (-775.468) -- 0:00:25
606000 -- [-773.156] (-772.974) (-771.915) (-776.113) * (-773.920) [-772.513] (-773.874) (-770.862) -- 0:00:25
606500 -- [-771.456] (-771.641) (-771.740) (-772.842) * (-775.887) (-775.796) (-770.257) [-774.339] -- 0:00:25
607000 -- [-771.731] (-772.529) (-774.478) (-775.388) * (-773.983) (-775.966) [-773.054] (-776.245) -- 0:00:25
607500 -- (-774.301) (-773.345) (-773.563) [-771.659] * (-774.092) [-773.265] (-778.844) (-772.420) -- 0:00:25
608000 -- (-770.102) (-770.733) (-770.751) [-771.946] * (-776.030) [-773.290] (-771.470) (-772.958) -- 0:00:25
608500 -- (-772.833) (-771.403) (-770.113) [-774.884] * (-771.904) (-772.395) (-774.394) [-773.727] -- 0:00:25
609000 -- (-774.784) (-773.455) (-771.102) [-770.931] * [-772.787] (-772.905) (-775.336) (-774.835) -- 0:00:25
609500 -- (-771.747) [-771.603] (-771.292) (-771.966) * (-771.140) [-772.515] (-773.769) (-776.677) -- 0:00:25
610000 -- (-771.867) (-771.527) [-771.974] (-771.673) * [-772.653] (-770.714) (-771.158) (-777.355) -- 0:00:25
Average standard deviation of split frequencies: 0.007462
610500 -- (-771.753) [-775.837] (-771.277) (-773.044) * (-775.138) (-770.159) [-773.873] (-773.547) -- 0:00:25
611000 -- (-773.137) (-772.359) [-773.392] (-773.762) * (-774.771) [-770.043] (-771.339) (-773.337) -- 0:00:25
611500 -- (-771.340) (-775.513) (-771.532) [-774.621] * [-772.207] (-771.569) (-771.328) (-772.511) -- 0:00:25
612000 -- [-774.429] (-773.587) (-772.479) (-771.740) * [-772.766] (-776.748) (-772.547) (-777.193) -- 0:00:25
612500 -- (-784.252) (-774.601) [-770.899] (-771.793) * (-775.958) (-772.784) [-773.318] (-773.777) -- 0:00:25
613000 -- (-769.651) (-774.518) (-772.629) [-771.790] * (-771.161) (-773.793) [-771.487] (-773.677) -- 0:00:25
613500 -- (-772.533) [-771.935] (-774.285) (-773.184) * [-770.454] (-774.232) (-774.819) (-772.763) -- 0:00:25
614000 -- (-772.962) (-771.636) [-775.331] (-775.031) * [-774.126] (-772.437) (-773.622) (-776.921) -- 0:00:25
614500 -- (-770.921) (-770.976) (-773.633) [-771.211] * (-772.204) (-776.875) (-772.324) [-775.798] -- 0:00:25
615000 -- (-777.326) (-771.542) (-773.984) [-772.362] * [-777.069] (-778.084) (-775.095) (-773.268) -- 0:00:25
Average standard deviation of split frequencies: 0.007347
615500 -- [-772.704] (-772.289) (-774.903) (-775.715) * (-771.726) (-784.614) (-771.892) [-771.862] -- 0:00:24
616000 -- (-774.679) (-772.770) [-774.068] (-775.036) * (-773.239) (-777.636) [-772.932] (-773.725) -- 0:00:24
616500 -- (-773.556) (-773.947) (-773.266) [-773.457] * [-772.356] (-770.370) (-774.372) (-771.680) -- 0:00:24
617000 -- [-776.218] (-775.203) (-773.831) (-772.431) * (-771.262) (-771.858) [-773.034] (-774.420) -- 0:00:24
617500 -- (-775.177) (-774.361) (-773.503) [-773.011] * (-772.957) [-772.432] (-771.734) (-771.445) -- 0:00:24
618000 -- (-772.973) (-772.624) (-772.754) [-773.434] * (-777.288) (-771.727) [-770.375] (-777.211) -- 0:00:24
618500 -- (-773.388) (-775.385) [-771.310] (-773.674) * (-775.983) (-774.731) [-772.983] (-776.258) -- 0:00:24
619000 -- (-772.943) (-774.912) (-772.542) [-775.029] * (-772.550) (-772.356) [-773.724] (-775.999) -- 0:00:24
619500 -- (-776.430) (-771.659) (-772.033) [-772.820] * [-776.689] (-773.129) (-771.332) (-772.672) -- 0:00:24
620000 -- (-775.804) (-773.469) [-771.105] (-776.114) * (-778.751) (-772.172) (-774.592) [-772.680] -- 0:00:24
Average standard deviation of split frequencies: 0.007646
620500 -- (-774.306) [-775.233] (-774.454) (-774.884) * (-778.786) (-773.272) (-770.307) [-774.584] -- 0:00:24
621000 -- (-775.405) [-772.495] (-772.727) (-773.561) * (-773.722) [-771.305] (-773.265) (-774.577) -- 0:00:24
621500 -- (-772.461) [-772.754] (-773.621) (-775.900) * (-776.404) [-771.538] (-772.522) (-773.492) -- 0:00:24
622000 -- (-773.478) [-774.305] (-775.797) (-774.417) * [-772.792] (-772.808) (-775.147) (-773.661) -- 0:00:24
622500 -- (-775.240) (-773.205) (-772.524) [-769.819] * (-778.570) [-771.797] (-773.968) (-778.496) -- 0:00:24
623000 -- (-776.480) (-772.186) (-771.318) [-773.090] * (-776.091) (-771.756) (-771.937) [-775.137] -- 0:00:24
623500 -- [-774.333] (-776.945) (-773.732) (-770.365) * (-779.711) [-772.248] (-772.475) (-775.079) -- 0:00:24
624000 -- (-773.906) (-772.735) [-772.450] (-772.588) * (-774.475) (-772.455) [-772.899] (-778.110) -- 0:00:24
624500 -- (-771.149) [-772.682] (-774.239) (-771.937) * (-772.607) (-776.118) [-771.056] (-775.421) -- 0:00:24
625000 -- (-776.786) [-773.667] (-776.360) (-773.939) * (-776.146) (-773.640) (-771.972) [-773.630] -- 0:00:24
Average standard deviation of split frequencies: 0.007631
625500 -- (-773.867) (-772.449) [-775.925] (-773.035) * (-776.400) (-776.045) (-774.234) [-772.619] -- 0:00:24
626000 -- (-773.221) (-772.568) (-772.167) [-771.562] * (-773.924) [-772.569] (-773.131) (-771.916) -- 0:00:24
626500 -- [-772.761] (-771.682) (-772.801) (-773.522) * (-773.460) (-772.170) [-775.321] (-774.293) -- 0:00:24
627000 -- [-770.903] (-773.551) (-774.953) (-777.597) * (-771.118) (-773.898) (-772.243) [-775.285] -- 0:00:24
627500 -- (-771.884) (-773.462) (-774.619) [-771.030] * (-774.265) [-772.339] (-772.863) (-775.341) -- 0:00:24
628000 -- (-773.422) (-775.063) [-774.834] (-773.582) * [-772.691] (-772.398) (-774.697) (-775.185) -- 0:00:24
628500 -- (-775.544) [-774.218] (-772.734) (-772.817) * (-774.186) [-771.746] (-774.995) (-774.490) -- 0:00:24
629000 -- (-777.105) [-774.494] (-775.153) (-773.110) * (-778.383) (-770.217) [-773.352] (-772.944) -- 0:00:24
629500 -- (-773.610) (-772.195) (-780.249) [-775.948] * [-771.768] (-772.342) (-771.859) (-773.420) -- 0:00:24
630000 -- (-772.674) (-776.266) [-774.577] (-776.424) * (-771.839) [-772.393] (-771.855) (-773.253) -- 0:00:24
Average standard deviation of split frequencies: 0.007525
630500 -- (-775.292) (-773.838) [-769.985] (-771.517) * [-772.060] (-772.282) (-773.360) (-774.897) -- 0:00:24
631000 -- (-773.519) [-772.697] (-772.315) (-773.445) * (-774.114) (-774.806) [-772.183] (-772.033) -- 0:00:23
631500 -- (-772.099) (-775.416) [-771.296] (-770.605) * [-772.704] (-774.128) (-776.068) (-773.781) -- 0:00:23
632000 -- (-776.967) (-772.752) (-769.729) [-775.221] * (-774.330) [-773.353] (-772.809) (-772.773) -- 0:00:23
632500 -- (-777.183) (-772.436) (-773.164) [-775.401] * (-777.528) [-774.431] (-772.429) (-773.296) -- 0:00:23
633000 -- [-772.575] (-774.173) (-773.124) (-776.589) * (-776.826) [-772.517] (-771.968) (-773.217) -- 0:00:23
633500 -- (-777.181) [-774.600] (-774.735) (-773.296) * (-772.385) (-771.459) [-769.488] (-777.071) -- 0:00:23
634000 -- (-776.149) (-776.690) [-773.721] (-772.777) * (-775.225) (-771.448) [-770.112] (-775.964) -- 0:00:23
634500 -- (-776.231) (-775.515) (-771.936) [-770.354] * (-771.843) (-772.223) (-774.289) [-771.112] -- 0:00:23
635000 -- (-777.741) (-775.044) [-772.596] (-771.729) * (-771.457) (-770.272) (-774.161) [-773.359] -- 0:00:23
Average standard deviation of split frequencies: 0.007363
635500 -- (-777.670) (-772.226) (-771.581) [-772.014] * [-773.261] (-770.895) (-770.754) (-774.615) -- 0:00:23
636000 -- (-772.856) [-771.502] (-772.746) (-772.431) * [-773.402] (-772.656) (-772.836) (-774.675) -- 0:00:23
636500 -- (-775.590) [-774.075] (-772.285) (-775.697) * [-774.393] (-776.825) (-774.728) (-775.151) -- 0:00:23
637000 -- (-774.858) [-772.507] (-772.864) (-775.539) * (-772.908) (-772.531) (-773.551) [-773.425] -- 0:00:23
637500 -- (-775.175) (-772.788) (-777.047) [-772.974] * (-772.312) (-772.722) (-772.207) [-771.343] -- 0:00:23
638000 -- [-773.948] (-775.551) (-773.447) (-776.187) * [-770.083] (-773.988) (-778.137) (-772.660) -- 0:00:23
638500 -- (-775.182) [-772.137] (-773.477) (-773.995) * (-771.869) [-772.834] (-778.945) (-773.388) -- 0:00:23
639000 -- (-769.090) (-772.950) [-775.757] (-773.501) * [-772.030] (-775.679) (-772.725) (-772.130) -- 0:00:23
639500 -- [-771.465] (-781.071) (-774.450) (-773.999) * (-773.167) (-773.789) [-773.144] (-771.138) -- 0:00:23
640000 -- (-772.512) (-777.759) (-775.027) [-773.350] * (-772.672) (-772.767) [-774.224] (-776.366) -- 0:00:23
Average standard deviation of split frequencies: 0.007309
640500 -- [-772.296] (-774.853) (-773.208) (-772.187) * (-772.709) (-777.599) [-774.550] (-777.027) -- 0:00:23
641000 -- (-774.736) [-771.268] (-772.632) (-771.585) * (-773.028) (-773.172) [-773.086] (-772.420) -- 0:00:23
641500 -- (-775.819) (-771.101) [-773.019] (-770.281) * [-771.479] (-772.412) (-773.427) (-774.105) -- 0:00:23
642000 -- (-775.721) (-775.162) (-775.533) [-769.752] * (-780.500) [-771.068] (-774.780) (-771.763) -- 0:00:23
642500 -- (-770.777) (-772.502) (-773.197) [-772.602] * (-772.704) [-770.112] (-773.897) (-774.139) -- 0:00:23
643000 -- (-773.592) (-771.985) (-770.937) [-771.771] * (-773.535) (-771.010) (-772.580) [-770.909] -- 0:00:23
643500 -- [-770.761] (-773.766) (-773.118) (-771.527) * (-773.890) (-773.771) (-773.791) [-773.316] -- 0:00:23
644000 -- (-772.950) (-773.081) [-770.877] (-773.223) * (-774.905) (-771.099) [-771.819] (-772.127) -- 0:00:23
644500 -- (-772.863) (-772.889) (-771.262) [-771.210] * [-772.541] (-773.429) (-771.973) (-771.816) -- 0:00:23
645000 -- [-770.282] (-774.759) (-773.551) (-771.527) * (-773.111) (-773.051) (-773.389) [-773.133] -- 0:00:23
Average standard deviation of split frequencies: 0.006811
645500 -- (-772.354) (-779.498) [-771.048] (-773.307) * (-771.155) [-772.190] (-774.786) (-774.977) -- 0:00:23
646000 -- [-771.827] (-776.346) (-770.118) (-774.597) * (-771.123) [-771.929] (-772.609) (-774.967) -- 0:00:23
646500 -- [-774.858] (-775.066) (-770.743) (-771.465) * [-771.727] (-772.697) (-774.639) (-774.154) -- 0:00:22
647000 -- (-774.126) (-772.056) (-771.771) [-774.839] * (-771.062) (-771.726) (-771.698) [-773.004] -- 0:00:22
647500 -- (-776.335) [-773.105] (-773.448) (-770.570) * (-772.833) (-770.724) (-771.963) [-774.775] -- 0:00:22
648000 -- [-777.858] (-772.807) (-771.324) (-773.272) * (-773.410) (-772.691) [-773.971] (-773.413) -- 0:00:22
648500 -- [-777.662] (-773.504) (-776.583) (-776.721) * (-773.379) (-775.687) [-770.590] (-772.954) -- 0:00:22
649000 -- (-774.578) (-775.336) [-773.411] (-772.342) * (-771.047) (-773.537) [-775.071] (-776.613) -- 0:00:22
649500 -- (-772.488) (-772.087) (-775.074) [-771.174] * (-772.886) (-773.821) [-773.006] (-773.690) -- 0:00:22
650000 -- (-773.264) [-773.561] (-773.594) (-775.041) * (-773.401) [-774.272] (-769.927) (-772.831) -- 0:00:22
Average standard deviation of split frequencies: 0.006810
650500 -- (-772.960) [-771.394] (-773.766) (-773.861) * [-772.381] (-772.068) (-773.644) (-772.209) -- 0:00:22
651000 -- [-777.057] (-773.243) (-773.077) (-774.670) * (-773.805) (-773.309) [-773.406] (-773.447) -- 0:00:22
651500 -- (-774.295) (-773.211) [-770.415] (-770.291) * (-774.734) (-772.736) (-772.115) [-771.815] -- 0:00:22
652000 -- (-774.355) (-772.403) (-773.933) [-774.512] * (-773.600) (-776.129) (-770.983) [-773.417] -- 0:00:22
652500 -- (-773.277) [-772.789] (-771.792) (-774.768) * [-774.006] (-772.441) (-772.412) (-774.142) -- 0:00:22
653000 -- (-778.457) [-771.389] (-775.953) (-772.320) * (-772.448) [-774.434] (-773.132) (-772.287) -- 0:00:22
653500 -- (-775.067) (-771.265) (-775.297) [-771.409] * [-770.475] (-772.732) (-773.855) (-772.256) -- 0:00:22
654000 -- (-772.574) [-774.259] (-781.783) (-776.033) * (-771.021) [-770.967] (-772.087) (-770.678) -- 0:00:22
654500 -- (-775.085) (-774.013) [-775.753] (-774.572) * (-774.924) [-771.272] (-771.344) (-774.581) -- 0:00:22
655000 -- (-778.480) [-773.373] (-776.267) (-773.899) * [-776.684] (-771.192) (-772.428) (-772.685) -- 0:00:22
Average standard deviation of split frequencies: 0.007138
655500 -- (-771.223) [-772.301] (-776.398) (-772.731) * (-776.966) (-771.913) [-770.769] (-773.927) -- 0:00:22
656000 -- (-770.920) [-772.221] (-772.026) (-772.942) * [-772.481] (-774.665) (-771.767) (-776.374) -- 0:00:22
656500 -- (-779.875) (-776.271) (-774.514) [-773.320] * (-773.886) (-775.990) [-770.694] (-773.627) -- 0:00:22
657000 -- (-773.031) [-771.108] (-774.668) (-772.763) * (-773.946) (-774.344) (-772.740) [-777.702] -- 0:00:22
657500 -- [-773.237] (-771.479) (-772.699) (-772.856) * [-772.086] (-770.820) (-777.740) (-773.648) -- 0:00:22
658000 -- (-772.762) [-772.429] (-774.247) (-770.318) * (-779.502) [-772.499] (-770.316) (-772.455) -- 0:00:22
658500 -- (-773.391) (-774.118) [-773.398] (-772.258) * (-773.538) [-771.554] (-774.647) (-770.559) -- 0:00:22
659000 -- (-776.768) (-772.568) [-773.116] (-774.174) * (-775.578) [-774.118] (-773.612) (-775.885) -- 0:00:22
659500 -- (-773.470) (-777.125) [-773.952] (-774.517) * [-771.063] (-772.870) (-773.265) (-773.785) -- 0:00:22
660000 -- (-773.130) [-774.468] (-773.285) (-774.806) * (-772.365) (-770.331) (-774.663) [-773.229] -- 0:00:22
Average standard deviation of split frequencies: 0.006612
660500 -- (-773.406) [-773.239] (-770.320) (-771.170) * (-772.245) (-774.395) [-773.260] (-773.123) -- 0:00:22
661000 -- (-773.277) (-774.501) (-772.296) [-773.705] * [-772.739] (-775.864) (-771.511) (-773.087) -- 0:00:22
661500 -- (-772.773) (-772.201) (-775.119) [-779.469] * (-773.432) (-776.120) [-772.090] (-771.923) -- 0:00:22
662000 -- (-777.675) (-776.074) [-772.639] (-774.664) * [-773.566] (-772.378) (-773.600) (-774.991) -- 0:00:21
662500 -- (-771.955) (-774.457) (-772.415) [-772.708] * (-771.485) (-773.437) [-773.303] (-771.937) -- 0:00:21
663000 -- (-772.229) (-772.957) [-772.717] (-774.162) * (-772.176) (-770.247) [-768.978] (-773.586) -- 0:00:21
663500 -- (-772.998) (-774.741) (-773.937) [-772.578] * (-772.556) [-775.163] (-770.335) (-775.175) -- 0:00:21
664000 -- (-771.521) (-775.188) (-773.928) [-773.015] * (-776.614) [-771.562] (-772.944) (-772.389) -- 0:00:21
664500 -- (-773.653) (-773.401) [-773.121] (-774.748) * (-774.485) (-771.082) (-778.480) [-772.070] -- 0:00:21
665000 -- (-778.096) [-771.276] (-773.597) (-771.569) * (-773.324) (-775.010) [-772.392] (-773.531) -- 0:00:21
Average standard deviation of split frequencies: 0.006937
665500 -- (-773.399) [-772.361] (-773.880) (-771.916) * (-773.241) (-772.758) [-774.699] (-774.807) -- 0:00:21
666000 -- (-771.275) [-772.335] (-774.369) (-772.357) * (-771.084) (-772.293) [-773.678] (-777.663) -- 0:00:21
666500 -- [-770.995] (-773.146) (-777.970) (-774.881) * [-770.277] (-773.555) (-770.000) (-773.324) -- 0:00:21
667000 -- [-772.287] (-772.720) (-776.366) (-773.446) * [-770.497] (-773.957) (-773.548) (-771.687) -- 0:00:21
667500 -- [-772.105] (-775.487) (-771.518) (-774.298) * (-772.656) [-773.781] (-772.577) (-776.245) -- 0:00:21
668000 -- (-773.474) [-779.414] (-770.697) (-772.320) * (-771.878) (-773.870) [-773.040] (-774.666) -- 0:00:21
668500 -- [-773.676] (-775.893) (-772.355) (-775.889) * (-772.468) (-774.556) (-773.484) [-775.188] -- 0:00:21
669000 -- (-774.586) [-772.764] (-773.107) (-771.257) * [-773.980] (-775.647) (-774.964) (-775.763) -- 0:00:21
669500 -- (-771.720) (-773.171) [-771.217] (-773.492) * [-771.068] (-774.379) (-775.850) (-775.478) -- 0:00:21
670000 -- (-773.292) [-772.788] (-770.534) (-771.926) * (-773.373) (-775.850) (-772.326) [-775.277] -- 0:00:21
Average standard deviation of split frequencies: 0.006467
670500 -- (-773.454) (-776.633) [-771.273] (-772.149) * [-772.476] (-774.448) (-771.763) (-774.897) -- 0:00:21
671000 -- (-775.425) (-772.567) (-772.055) [-771.551] * [-773.380] (-772.526) (-774.773) (-775.317) -- 0:00:21
671500 -- (-776.024) [-771.243] (-770.732) (-776.724) * [-771.309] (-771.530) (-774.064) (-777.077) -- 0:00:21
672000 -- (-780.908) (-773.590) [-772.080] (-772.134) * (-776.517) [-772.169] (-773.275) (-775.626) -- 0:00:21
672500 -- [-774.320] (-773.588) (-772.008) (-772.583) * [-772.358] (-779.359) (-772.808) (-773.133) -- 0:00:21
673000 -- (-772.467) (-774.595) (-774.083) [-775.788] * (-772.416) [-776.375] (-773.561) (-773.375) -- 0:00:21
673500 -- (-776.466) (-774.920) [-770.692] (-773.370) * (-772.984) (-778.566) (-770.867) [-775.271] -- 0:00:21
674000 -- [-771.724] (-776.322) (-771.065) (-772.250) * (-774.840) (-774.545) [-770.740] (-773.069) -- 0:00:21
674500 -- (-772.702) (-776.088) (-774.339) [-774.559] * (-772.459) (-774.821) (-771.405) [-772.359] -- 0:00:21
675000 -- (-775.139) [-772.257] (-773.647) (-770.422) * (-773.952) (-773.066) (-775.458) [-772.883] -- 0:00:21
Average standard deviation of split frequencies: 0.005858
675500 -- (-773.375) (-775.029) (-774.297) [-771.014] * (-779.805) (-774.519) (-775.922) [-772.397] -- 0:00:21
676000 -- (-772.515) (-776.330) [-769.885] (-771.235) * (-776.117) (-773.670) [-772.874] (-775.946) -- 0:00:21
676500 -- (-776.809) [-771.464] (-776.957) (-776.049) * (-775.764) [-772.874] (-770.388) (-776.189) -- 0:00:21
677000 -- [-771.351] (-771.965) (-774.619) (-770.892) * [-776.830] (-775.213) (-773.495) (-771.565) -- 0:00:20
677500 -- (-773.873) [-773.638] (-772.301) (-771.582) * (-772.336) (-773.221) [-771.977] (-775.442) -- 0:00:20
678000 -- [-773.603] (-772.453) (-773.277) (-770.162) * (-771.232) (-772.597) (-772.001) [-771.740] -- 0:00:20
678500 -- (-773.608) (-772.412) [-771.670] (-772.374) * [-772.653] (-772.061) (-773.129) (-772.394) -- 0:00:20
679000 -- [-777.696] (-772.402) (-775.176) (-772.422) * [-772.186] (-773.419) (-772.110) (-778.545) -- 0:00:20
679500 -- [-778.079] (-774.004) (-777.667) (-773.584) * (-772.204) (-773.805) [-773.225] (-772.858) -- 0:00:20
680000 -- [-775.494] (-773.881) (-774.529) (-771.483) * (-773.986) (-772.668) [-776.371] (-774.399) -- 0:00:20
Average standard deviation of split frequencies: 0.005402
680500 -- (-773.986) (-775.220) (-772.434) [-772.245] * [-771.762] (-771.677) (-772.099) (-774.828) -- 0:00:20
681000 -- (-775.503) (-776.022) (-774.033) [-773.301] * [-772.726] (-771.446) (-771.071) (-776.465) -- 0:00:20
681500 -- (-772.513) (-774.883) [-771.323] (-772.263) * (-771.285) [-777.136] (-774.203) (-771.247) -- 0:00:20
682000 -- [-771.738] (-776.197) (-778.606) (-771.697) * (-771.392) (-779.610) (-772.609) [-773.335] -- 0:00:20
682500 -- (-772.532) (-772.744) (-777.412) [-771.499] * (-770.322) (-783.982) [-770.752] (-773.649) -- 0:00:20
683000 -- (-772.798) (-774.477) [-772.762] (-772.340) * (-775.068) [-773.219] (-772.485) (-772.247) -- 0:00:20
683500 -- (-772.236) (-773.116) (-770.468) [-771.985] * (-772.494) (-773.838) (-778.243) [-773.303] -- 0:00:20
684000 -- (-773.894) (-776.287) [-770.455] (-771.435) * (-774.047) (-771.248) [-769.714] (-773.688) -- 0:00:20
684500 -- (-772.009) [-775.075] (-770.065) (-772.257) * [-772.776] (-774.115) (-773.715) (-774.833) -- 0:00:20
685000 -- (-773.284) (-774.260) (-774.287) [-772.888] * (-774.041) [-775.127] (-772.565) (-777.390) -- 0:00:20
Average standard deviation of split frequencies: 0.005818
685500 -- (-772.391) (-772.838) (-770.956) [-775.223] * (-774.192) [-772.130] (-774.592) (-772.328) -- 0:00:20
686000 -- (-771.340) (-772.452) (-774.128) [-771.678] * [-771.249] (-777.744) (-775.009) (-775.287) -- 0:00:20
686500 -- [-770.989] (-777.220) (-772.904) (-772.822) * (-779.082) (-769.799) [-774.756] (-772.320) -- 0:00:20
687000 -- (-772.472) (-777.534) [-771.155] (-774.550) * (-771.834) (-773.393) (-773.737) [-772.813] -- 0:00:20
687500 -- (-772.677) (-778.923) [-770.446] (-774.486) * (-771.120) (-771.078) [-775.331] (-773.944) -- 0:00:20
688000 -- (-770.812) (-773.166) [-770.946] (-773.792) * (-774.154) (-773.229) (-772.571) [-773.089] -- 0:00:20
688500 -- [-772.084] (-774.883) (-773.517) (-774.650) * (-772.578) (-771.234) [-770.892] (-774.479) -- 0:00:20
689000 -- [-775.852] (-772.886) (-772.022) (-773.709) * (-771.125) (-775.645) (-771.528) [-776.506] -- 0:00:20
689500 -- (-773.163) [-772.296] (-773.085) (-775.071) * (-772.375) (-774.459) (-772.844) [-775.663] -- 0:00:20
690000 -- (-774.418) (-773.405) [-775.296] (-775.489) * (-770.875) [-773.803] (-777.387) (-774.643) -- 0:00:20
Average standard deviation of split frequencies: 0.005733
690500 -- (-774.342) (-775.371) [-773.693] (-776.007) * (-773.879) (-773.132) [-775.043] (-775.014) -- 0:00:20
691000 -- (-772.246) (-772.224) [-773.919] (-771.659) * (-771.698) (-773.585) (-774.722) [-772.752] -- 0:00:20
691500 -- [-773.443] (-772.057) (-770.390) (-772.865) * (-775.876) (-775.492) (-772.403) [-771.818] -- 0:00:20
692000 -- (-773.225) (-771.801) (-772.754) [-773.357] * (-771.741) (-776.101) [-774.601] (-772.127) -- 0:00:20
692500 -- [-772.268] (-774.740) (-775.953) (-772.870) * (-773.822) [-772.970] (-772.118) (-773.798) -- 0:00:19
693000 -- (-772.333) (-772.906) [-771.076] (-773.215) * (-775.694) (-773.289) [-771.254] (-772.685) -- 0:00:19
693500 -- (-769.186) (-776.601) [-770.631] (-772.970) * [-773.073] (-772.484) (-769.894) (-773.476) -- 0:00:19
694000 -- (-774.000) (-771.890) (-774.205) [-775.443] * (-773.046) (-774.310) [-777.569] (-776.810) -- 0:00:19
694500 -- [-774.034] (-772.866) (-772.023) (-774.421) * (-773.252) [-775.169] (-773.536) (-771.917) -- 0:00:19
695000 -- (-772.840) (-775.256) [-771.749] (-772.843) * (-771.100) (-775.424) (-772.287) [-771.687] -- 0:00:19
Average standard deviation of split frequencies: 0.006276
695500 -- (-771.650) [-772.959] (-771.562) (-773.505) * (-773.933) [-777.167] (-776.539) (-777.299) -- 0:00:19
696000 -- (-771.680) (-771.054) (-773.525) [-771.542] * (-771.322) [-772.158] (-778.897) (-774.261) -- 0:00:19
696500 -- [-770.879] (-772.499) (-777.408) (-774.691) * (-775.217) (-775.533) (-776.368) [-772.948] -- 0:00:19
697000 -- (-772.218) (-772.092) [-771.782] (-775.734) * [-774.166] (-773.514) (-775.759) (-776.033) -- 0:00:19
697500 -- [-771.366] (-773.732) (-774.711) (-777.578) * (-776.993) (-772.454) (-774.489) [-772.898] -- 0:00:19
698000 -- (-774.994) [-772.248] (-775.469) (-773.234) * [-772.761] (-774.447) (-773.967) (-773.107) -- 0:00:19
698500 -- (-776.036) (-772.830) (-771.834) [-774.842] * (-776.220) (-774.051) [-776.929] (-776.473) -- 0:00:19
699000 -- (-772.464) (-774.466) (-771.680) [-773.206] * (-774.176) (-775.171) (-774.639) [-769.214] -- 0:00:19
699500 -- (-774.321) [-775.311] (-772.176) (-774.900) * [-770.007] (-773.157) (-774.200) (-771.206) -- 0:00:19
700000 -- (-770.907) [-774.685] (-773.917) (-771.994) * [-771.492] (-771.603) (-774.495) (-770.882) -- 0:00:19
Average standard deviation of split frequencies: 0.006145
700500 -- [-770.064] (-774.757) (-774.306) (-773.114) * (-772.170) [-771.216] (-775.431) (-770.004) -- 0:00:19
701000 -- (-774.463) (-773.379) [-773.483] (-774.897) * (-772.910) (-773.830) [-773.206] (-773.934) -- 0:00:19
701500 -- (-775.258) (-773.055) (-776.926) [-772.662] * (-773.094) (-773.775) (-771.547) [-770.512] -- 0:00:19
702000 -- (-775.718) [-772.261] (-777.099) (-774.155) * [-771.608] (-773.437) (-771.985) (-779.445) -- 0:00:19
702500 -- (-772.300) [-772.934] (-772.184) (-771.834) * (-774.534) (-772.074) [-773.313] (-773.900) -- 0:00:19
703000 -- (-775.019) [-771.217] (-773.320) (-772.596) * [-772.710] (-772.934) (-771.521) (-775.436) -- 0:00:19
703500 -- (-772.492) (-771.924) [-773.045] (-772.632) * (-776.805) [-772.703] (-772.213) (-772.298) -- 0:00:19
704000 -- [-773.440] (-776.133) (-773.496) (-775.217) * (-772.655) [-772.415] (-775.059) (-771.479) -- 0:00:19
704500 -- (-773.855) [-774.426] (-773.775) (-774.011) * (-772.332) (-774.336) (-773.251) [-771.923] -- 0:00:19
705000 -- (-778.249) [-770.861] (-771.943) (-772.952) * (-770.459) (-772.364) (-772.079) [-778.959] -- 0:00:19
Average standard deviation of split frequencies: 0.005698
705500 -- (-774.665) (-774.937) (-772.575) [-772.824] * (-771.680) [-771.130] (-774.777) (-775.570) -- 0:00:19
706000 -- (-772.986) [-770.581] (-771.600) (-775.540) * (-773.670) (-775.477) [-770.774] (-772.383) -- 0:00:19
706500 -- (-772.060) (-772.180) (-771.644) [-772.450] * [-775.392] (-773.629) (-771.221) (-774.615) -- 0:00:19
707000 -- [-777.257] (-774.162) (-772.460) (-772.062) * (-774.390) (-775.293) [-772.272] (-772.518) -- 0:00:19
707500 -- (-775.008) (-777.756) [-774.681] (-771.992) * (-774.672) (-771.961) (-771.870) [-771.285] -- 0:00:19
708000 -- (-772.043) (-774.128) (-771.766) [-772.735] * (-773.636) (-774.841) (-776.606) [-771.354] -- 0:00:18
708500 -- (-773.011) (-774.007) [-775.796] (-774.363) * (-776.741) [-772.268] (-770.733) (-772.620) -- 0:00:18
709000 -- (-774.745) (-773.033) (-774.130) [-773.577] * (-777.146) (-772.736) [-771.634] (-773.322) -- 0:00:18
709500 -- (-776.710) [-772.587] (-772.223) (-773.533) * [-773.566] (-771.782) (-772.194) (-775.584) -- 0:00:18
710000 -- (-772.881) (-773.401) (-774.893) [-773.121] * (-772.249) (-772.574) (-773.108) [-771.970] -- 0:00:18
Average standard deviation of split frequencies: 0.005616
710500 -- [-772.467] (-772.332) (-773.992) (-774.958) * (-774.100) [-772.067] (-774.127) (-773.148) -- 0:00:18
711000 -- [-772.955] (-772.213) (-773.109) (-777.859) * (-770.877) (-772.366) [-776.478] (-777.533) -- 0:00:18
711500 -- [-772.744] (-775.901) (-776.663) (-775.026) * [-770.288] (-771.962) (-775.274) (-776.214) -- 0:00:18
712000 -- (-773.971) (-772.635) (-773.957) [-772.758] * [-773.633] (-770.776) (-775.479) (-774.552) -- 0:00:19
712500 -- (-772.251) (-771.339) [-771.602] (-773.895) * (-771.043) (-771.630) [-773.604] (-775.975) -- 0:00:18
713000 -- (-773.549) (-774.908) [-772.348] (-771.399) * [-772.281] (-777.089) (-772.589) (-771.734) -- 0:00:18
713500 -- (-775.550) (-772.024) (-775.487) [-773.915] * (-774.171) (-777.661) [-770.859] (-773.495) -- 0:00:18
714000 -- (-775.882) [-773.540] (-776.213) (-772.312) * (-773.961) (-772.581) [-772.269] (-776.069) -- 0:00:18
714500 -- [-772.054] (-775.135) (-773.593) (-772.984) * (-773.436) [-773.343] (-772.393) (-774.187) -- 0:00:18
715000 -- [-772.866] (-773.967) (-776.661) (-777.355) * (-773.006) (-776.734) (-772.505) [-773.195] -- 0:00:18
Average standard deviation of split frequencies: 0.005267
715500 -- (-773.856) (-772.320) (-773.170) [-773.022] * (-771.867) (-770.804) [-773.422] (-774.580) -- 0:00:18
716000 -- (-774.334) [-774.367] (-776.517) (-773.056) * (-772.773) [-772.865] (-770.639) (-773.067) -- 0:00:18
716500 -- [-774.568] (-772.650) (-776.806) (-772.072) * (-772.709) [-772.971] (-770.743) (-772.700) -- 0:00:18
717000 -- (-774.498) (-773.146) (-773.397) [-772.176] * (-772.984) [-770.599] (-773.298) (-772.970) -- 0:00:18
717500 -- (-775.113) [-770.370] (-773.307) (-773.354) * (-772.403) [-771.131] (-771.717) (-775.430) -- 0:00:18
718000 -- (-771.655) (-777.091) (-774.108) [-772.368] * (-770.133) [-775.004] (-773.141) (-774.455) -- 0:00:18
718500 -- (-772.707) (-774.057) (-773.242) [-772.132] * (-775.206) (-772.562) [-771.254] (-773.675) -- 0:00:18
719000 -- (-771.258) (-773.871) (-773.843) [-770.686] * (-772.984) [-776.614] (-772.105) (-775.752) -- 0:00:18
719500 -- [-771.935] (-772.480) (-772.719) (-772.994) * (-772.841) (-772.231) (-773.768) [-775.044] -- 0:00:18
720000 -- (-775.708) (-772.655) [-775.219] (-775.830) * (-773.620) (-776.942) (-772.162) [-773.901] -- 0:00:18
Average standard deviation of split frequencies: 0.005538
720500 -- (-773.408) (-774.930) [-773.714] (-772.943) * (-772.217) (-772.082) [-774.608] (-773.056) -- 0:00:18
721000 -- [-773.263] (-771.700) (-771.832) (-781.877) * (-776.116) (-770.597) [-772.495] (-771.881) -- 0:00:18
721500 -- (-771.973) [-772.457] (-773.038) (-772.749) * (-776.082) (-772.674) (-770.473) [-772.114] -- 0:00:18
722000 -- (-773.037) (-772.650) [-772.075] (-772.860) * [-770.890] (-773.740) (-773.246) (-772.340) -- 0:00:18
722500 -- [-776.279] (-774.751) (-773.042) (-771.049) * (-772.551) (-773.299) (-775.072) [-770.853] -- 0:00:18
723000 -- (-777.544) (-771.972) (-777.360) [-771.543] * [-771.582] (-775.092) (-773.384) (-772.161) -- 0:00:18
723500 -- (-774.861) (-772.937) [-772.576] (-773.293) * [-770.850] (-772.354) (-772.607) (-771.692) -- 0:00:17
724000 -- (-772.833) [-771.151] (-774.005) (-775.383) * (-772.540) [-773.046] (-771.664) (-771.034) -- 0:00:17
724500 -- (-771.573) (-773.861) [-773.463] (-772.540) * (-770.997) [-776.117] (-770.446) (-771.936) -- 0:00:17
725000 -- (-777.738) [-778.264] (-772.776) (-773.521) * [-772.632] (-777.491) (-769.757) (-772.089) -- 0:00:17
Average standard deviation of split frequencies: 0.005498
725500 -- (-772.742) (-776.544) (-772.132) [-774.732] * (-772.124) (-772.187) [-774.757] (-772.062) -- 0:00:17
726000 -- [-773.228] (-775.382) (-772.703) (-770.069) * (-772.906) (-772.331) (-774.650) [-770.137] -- 0:00:17
726500 -- (-774.516) (-777.773) (-770.758) [-773.971] * [-769.995] (-774.547) (-773.463) (-771.633) -- 0:00:17
727000 -- (-773.676) (-773.937) [-775.594] (-771.782) * (-774.752) [-770.252] (-770.281) (-773.645) -- 0:00:18
727500 -- (-775.061) (-777.024) [-773.111] (-774.294) * [-775.053] (-772.687) (-771.341) (-769.750) -- 0:00:17
728000 -- (-773.096) [-773.881] (-770.294) (-772.407) * (-771.692) [-770.299] (-772.330) (-774.510) -- 0:00:17
728500 -- (-772.646) (-777.906) [-772.667] (-772.315) * (-771.202) (-774.708) [-771.087] (-773.387) -- 0:00:17
729000 -- (-773.733) (-772.879) (-772.816) [-772.379] * (-772.757) (-776.597) (-772.529) [-772.087] -- 0:00:17
729500 -- (-774.425) [-773.766] (-773.832) (-771.919) * [-772.815] (-772.706) (-772.521) (-776.182) -- 0:00:17
730000 -- (-772.639) [-772.574] (-774.802) (-771.630) * [-770.176] (-777.489) (-773.105) (-775.545) -- 0:00:17
Average standard deviation of split frequencies: 0.004946
730500 -- (-773.953) (-772.895) [-771.487] (-773.700) * (-770.898) [-774.841] (-771.796) (-772.267) -- 0:00:17
731000 -- (-775.234) (-773.846) [-776.120] (-771.274) * [-772.700] (-773.446) (-776.811) (-774.551) -- 0:00:17
731500 -- (-774.345) [-772.416] (-773.849) (-771.889) * (-770.299) [-771.696] (-775.332) (-775.673) -- 0:00:17
732000 -- (-773.569) (-770.701) (-774.556) [-774.701] * [-771.635] (-774.661) (-774.333) (-776.416) -- 0:00:17
732500 -- (-772.886) (-770.352) [-771.980] (-775.454) * [-771.403] (-772.477) (-770.617) (-771.434) -- 0:00:17
733000 -- (-772.652) [-772.207] (-776.931) (-773.646) * (-772.552) [-776.211] (-771.693) (-773.800) -- 0:00:17
733500 -- [-772.019] (-771.798) (-774.472) (-773.822) * (-775.192) (-770.241) [-771.218] (-770.395) -- 0:00:17
734000 -- (-773.825) [-775.547] (-771.900) (-773.361) * (-771.877) (-770.555) (-771.478) [-772.476] -- 0:00:17
734500 -- [-774.294] (-773.277) (-772.418) (-774.314) * (-773.630) (-775.299) (-770.096) [-773.544] -- 0:00:17
735000 -- (-774.157) (-772.864) [-773.021] (-773.610) * (-772.065) (-776.269) [-772.042] (-771.441) -- 0:00:17
Average standard deviation of split frequencies: 0.004782
735500 -- (-777.529) [-772.281] (-772.697) (-774.179) * [-771.826] (-773.182) (-774.744) (-772.952) -- 0:00:17
736000 -- [-772.626] (-770.926) (-773.566) (-772.992) * (-771.489) (-773.686) (-771.506) [-770.600] -- 0:00:17
736500 -- (-772.243) [-770.758] (-772.331) (-772.194) * (-772.547) (-770.645) (-774.299) [-774.880] -- 0:00:17
737000 -- (-774.070) [-773.049] (-772.276) (-773.912) * (-774.829) [-771.380] (-780.479) (-774.646) -- 0:00:17
737500 -- [-773.045] (-772.424) (-770.643) (-770.997) * (-772.450) (-774.549) [-775.278] (-773.557) -- 0:00:17
738000 -- [-772.590] (-772.522) (-771.313) (-776.915) * (-773.234) (-773.213) (-773.684) [-772.146] -- 0:00:17
738500 -- [-772.143] (-772.522) (-771.673) (-773.257) * (-772.934) [-773.667] (-772.631) (-772.481) -- 0:00:16
739000 -- (-774.807) (-773.325) (-773.717) [-774.611] * (-774.361) [-769.851] (-774.162) (-777.874) -- 0:00:16
739500 -- (-773.749) (-773.244) [-771.978] (-780.133) * [-776.730] (-769.469) (-772.280) (-774.395) -- 0:00:16
740000 -- (-773.951) (-774.313) [-770.326] (-775.545) * (-776.671) (-771.376) (-779.040) [-773.532] -- 0:00:16
Average standard deviation of split frequencies: 0.005177
740500 -- (-771.597) (-773.389) (-772.809) [-772.180] * (-772.553) (-769.934) (-772.113) [-771.483] -- 0:00:16
741000 -- (-773.225) [-773.797] (-774.272) (-771.871) * (-772.794) (-773.325) [-773.872] (-776.445) -- 0:00:16
741500 -- (-777.954) (-773.595) (-774.866) [-770.701] * (-772.303) (-773.600) [-770.354] (-772.223) -- 0:00:16
742000 -- (-776.414) (-771.357) (-772.146) [-773.301] * (-775.681) [-773.002] (-774.763) (-772.305) -- 0:00:16
742500 -- (-774.426) (-774.197) [-772.972] (-773.386) * [-773.455] (-771.646) (-775.237) (-773.572) -- 0:00:16
743000 -- [-774.942] (-775.692) (-776.166) (-772.971) * (-772.035) [-770.704] (-770.701) (-772.787) -- 0:00:16
743500 -- (-776.500) [-773.717] (-775.284) (-774.047) * (-774.530) (-773.084) (-773.447) [-769.707] -- 0:00:16
744000 -- (-774.958) [-775.030] (-773.926) (-771.989) * [-774.068] (-772.593) (-772.081) (-770.585) -- 0:00:16
744500 -- (-774.295) (-774.077) (-772.353) [-774.230] * (-778.770) (-770.415) (-774.239) [-771.998] -- 0:00:16
745000 -- (-774.118) [-772.740] (-772.013) (-769.946) * (-771.822) (-772.474) [-771.821] (-772.868) -- 0:00:16
Average standard deviation of split frequencies: 0.004929
745500 -- (-771.697) [-771.543] (-773.847) (-771.875) * (-773.476) (-774.228) (-773.345) [-772.647] -- 0:00:16
746000 -- [-774.384] (-774.360) (-770.501) (-770.490) * (-774.417) [-775.061] (-773.552) (-773.313) -- 0:00:16
746500 -- [-771.671] (-774.875) (-770.454) (-774.748) * (-771.550) (-769.622) [-773.986] (-772.622) -- 0:00:16
747000 -- [-772.025] (-772.844) (-781.617) (-772.155) * (-771.953) [-769.591] (-777.734) (-772.336) -- 0:00:16
747500 -- (-771.035) (-773.406) (-779.328) [-770.912] * (-777.074) (-771.381) (-775.378) [-769.892] -- 0:00:16
748000 -- (-772.825) (-772.276) [-774.401] (-772.995) * (-774.643) [-773.738] (-773.263) (-771.000) -- 0:00:16
748500 -- (-771.781) (-779.015) [-772.676] (-771.346) * (-771.436) (-772.978) (-774.432) [-781.125] -- 0:00:16
749000 -- (-771.602) (-774.589) (-772.836) [-771.416] * (-772.952) [-771.719] (-773.386) (-773.764) -- 0:00:16
749500 -- [-772.957] (-779.307) (-774.954) (-776.228) * (-772.104) [-775.999] (-775.055) (-770.179) -- 0:00:16
750000 -- [-771.998] (-780.082) (-773.985) (-773.947) * (-771.838) [-773.070] (-773.567) (-771.596) -- 0:00:16
Average standard deviation of split frequencies: 0.005108
750500 -- (-770.444) (-772.513) (-771.257) [-771.458] * (-772.387) (-775.311) (-773.407) [-772.967] -- 0:00:16
751000 -- (-772.859) [-771.938] (-774.371) (-770.115) * [-773.243] (-771.625) (-772.973) (-775.053) -- 0:00:16
751500 -- (-770.186) (-772.668) [-772.905] (-773.385) * (-775.510) [-770.628] (-773.520) (-773.454) -- 0:00:16
752000 -- (-773.042) [-773.913] (-770.653) (-775.626) * (-769.562) [-771.690] (-773.814) (-771.167) -- 0:00:16
752500 -- (-771.432) [-773.247] (-773.594) (-773.615) * (-773.026) (-774.657) (-772.173) [-770.991] -- 0:00:16
753000 -- (-770.755) (-773.862) [-772.482] (-771.067) * (-771.661) [-770.139] (-774.060) (-770.813) -- 0:00:16
753500 -- (-774.223) (-771.624) [-775.825] (-773.465) * (-771.246) (-772.307) (-773.335) [-772.565] -- 0:00:16
754000 -- (-774.106) (-772.210) (-772.792) [-772.258] * (-771.213) (-770.292) (-773.518) [-771.258] -- 0:00:15
754500 -- (-774.520) (-774.122) (-774.144) [-773.629] * (-772.285) [-772.823] (-778.935) (-771.574) -- 0:00:15
755000 -- [-775.546] (-776.067) (-775.079) (-777.203) * (-771.191) (-772.252) [-775.967] (-772.108) -- 0:00:15
Average standard deviation of split frequencies: 0.004697
755500 -- (-772.636) [-773.382] (-775.177) (-773.168) * (-777.331) (-772.017) (-771.708) [-770.970] -- 0:00:15
756000 -- (-771.033) [-771.212] (-774.764) (-773.597) * [-774.539] (-774.664) (-778.194) (-772.123) -- 0:00:15
756500 -- (-772.005) (-772.891) [-772.127] (-771.736) * (-777.366) (-770.777) (-770.193) [-773.087] -- 0:00:15
757000 -- (-773.811) (-773.282) [-773.538] (-770.639) * (-776.937) [-772.620] (-773.533) (-773.362) -- 0:00:15
757500 -- (-774.890) (-771.651) (-775.739) [-772.395] * (-774.392) [-771.090] (-774.080) (-772.556) -- 0:00:15
758000 -- (-777.422) [-772.113] (-774.208) (-772.615) * [-774.197] (-779.404) (-774.798) (-774.708) -- 0:00:15
758500 -- (-777.924) [-772.106] (-772.516) (-775.544) * (-771.018) (-774.175) [-771.303] (-773.023) -- 0:00:15
759000 -- (-774.370) [-772.829] (-771.740) (-774.330) * (-771.158) (-776.970) [-776.619] (-774.099) -- 0:00:15
759500 -- (-772.693) (-777.620) (-771.997) [-772.045] * (-772.606) (-774.357) (-771.597) [-774.872] -- 0:00:15
760000 -- (-771.124) (-769.554) (-774.071) [-772.159] * [-773.331] (-772.037) (-770.495) (-775.790) -- 0:00:15
Average standard deviation of split frequencies: 0.005082
760500 -- (-771.658) (-771.966) [-773.123] (-775.684) * (-777.389) (-773.702) [-775.232] (-771.320) -- 0:00:15
761000 -- (-773.086) (-771.622) (-771.870) [-772.469] * [-772.718] (-773.398) (-772.066) (-771.305) -- 0:00:15
761500 -- (-772.485) [-772.371] (-773.070) (-770.974) * (-774.204) (-772.197) [-771.563] (-774.508) -- 0:00:15
762000 -- (-774.062) [-772.030] (-773.293) (-773.502) * (-772.816) (-774.017) (-773.249) [-773.606] -- 0:00:15
762500 -- (-774.464) (-772.841) [-775.753] (-775.865) * (-773.769) (-773.483) (-771.190) [-772.095] -- 0:00:15
763000 -- [-771.770] (-775.448) (-775.110) (-773.516) * (-772.336) (-772.235) (-770.514) [-769.804] -- 0:00:15
763500 -- (-772.789) (-772.098) [-775.116] (-770.136) * (-779.211) (-772.145) (-772.710) [-772.472] -- 0:00:15
764000 -- (-775.185) [-771.830] (-775.130) (-772.099) * (-775.753) (-774.412) [-774.662] (-772.992) -- 0:00:15
764500 -- (-772.941) [-772.489] (-775.505) (-770.850) * (-776.431) (-771.989) [-776.729] (-776.662) -- 0:00:15
765000 -- (-778.226) (-771.817) (-774.478) [-772.583] * (-773.278) (-772.900) (-770.735) [-773.454] -- 0:00:15
Average standard deviation of split frequencies: 0.004800
765500 -- (-774.101) (-774.080) [-772.879] (-773.045) * (-773.124) (-773.792) (-772.171) [-771.927] -- 0:00:15
766000 -- [-774.172] (-770.457) (-775.220) (-772.090) * (-776.392) [-775.122] (-774.015) (-775.103) -- 0:00:15
766500 -- (-779.487) [-772.911] (-773.160) (-775.338) * (-772.712) (-776.642) [-771.622] (-778.132) -- 0:00:15
767000 -- (-773.488) (-775.353) (-773.734) [-772.773] * [-774.915] (-775.016) (-772.572) (-774.051) -- 0:00:15
767500 -- (-775.270) (-773.242) (-777.394) [-770.755] * [-771.523] (-774.649) (-774.331) (-774.581) -- 0:00:15
768000 -- (-773.188) (-772.295) [-773.788] (-774.259) * [-771.712] (-772.597) (-770.928) (-773.402) -- 0:00:15
768500 -- (-777.329) (-772.619) (-776.281) [-772.702] * (-771.005) [-768.703] (-773.097) (-774.025) -- 0:00:15
769000 -- (-770.404) [-773.244] (-774.884) (-770.880) * (-771.527) (-771.554) (-778.115) [-772.393] -- 0:00:15
769500 -- [-771.494] (-773.611) (-773.000) (-772.565) * [-772.384] (-773.559) (-775.304) (-773.914) -- 0:00:14
770000 -- [-773.796] (-773.362) (-772.884) (-773.996) * [-773.481] (-773.381) (-779.859) (-774.011) -- 0:00:14
Average standard deviation of split frequencies: 0.005220
770500 -- (-771.951) (-774.872) (-773.140) [-774.630] * (-771.522) (-771.267) [-772.131] (-770.959) -- 0:00:14
771000 -- [-770.877] (-777.221) (-770.348) (-773.315) * [-771.106] (-774.810) (-773.469) (-776.217) -- 0:00:14
771500 -- [-770.903] (-776.922) (-771.776) (-776.032) * [-771.320] (-772.471) (-773.696) (-773.755) -- 0:00:14
772000 -- [-770.949] (-773.712) (-772.219) (-775.929) * (-773.737) [-771.509] (-773.440) (-771.572) -- 0:00:14
772500 -- [-770.846] (-774.913) (-772.089) (-772.697) * (-772.677) (-770.686) (-775.023) [-772.764] -- 0:00:15
773000 -- [-770.964] (-773.371) (-771.705) (-772.902) * (-773.595) [-774.844] (-773.754) (-772.187) -- 0:00:14
773500 -- (-772.862) (-774.859) [-770.713] (-772.094) * [-775.282] (-777.259) (-774.575) (-774.901) -- 0:00:14
774000 -- (-771.268) (-772.086) (-773.302) [-772.248] * [-771.574] (-776.672) (-775.503) (-772.681) -- 0:00:14
774500 -- [-772.479] (-776.643) (-773.117) (-771.731) * (-774.218) [-772.136] (-774.658) (-773.665) -- 0:00:14
775000 -- (-775.194) (-776.257) [-769.874] (-771.146) * [-772.466] (-772.823) (-774.475) (-774.925) -- 0:00:14
Average standard deviation of split frequencies: 0.005710
775500 -- (-776.130) (-772.257) [-769.749] (-775.965) * (-770.646) (-772.841) (-771.637) [-773.914] -- 0:00:14
776000 -- (-776.528) (-772.806) [-769.757] (-775.576) * (-773.958) [-775.218] (-772.840) (-775.381) -- 0:00:14
776500 -- (-771.592) [-773.763] (-771.917) (-771.894) * (-775.091) (-774.529) (-774.024) [-772.210] -- 0:00:14
777000 -- (-772.827) (-776.252) (-772.078) [-773.427] * [-772.080] (-775.437) (-772.217) (-772.925) -- 0:00:14
777500 -- [-770.192] (-775.866) (-776.271) (-773.878) * (-772.486) (-771.681) [-773.095] (-771.232) -- 0:00:14
778000 -- (-772.000) [-772.267] (-772.259) (-772.710) * (-774.684) (-773.648) [-773.910] (-771.901) -- 0:00:14
778500 -- (-775.445) [-773.018] (-773.746) (-773.133) * (-772.776) [-771.730] (-775.325) (-773.788) -- 0:00:14
779000 -- [-771.541] (-771.839) (-773.265) (-773.261) * (-773.897) [-771.302] (-772.367) (-777.578) -- 0:00:14
779500 -- (-770.936) [-773.822] (-772.490) (-771.255) * (-775.724) (-774.033) [-771.854] (-775.477) -- 0:00:14
780000 -- (-775.388) (-771.519) [-771.203] (-773.324) * (-771.738) (-777.490) (-773.816) [-772.628] -- 0:00:14
Average standard deviation of split frequencies: 0.005877
780500 -- (-774.736) [-773.247] (-774.242) (-771.209) * (-774.675) (-774.749) [-777.191] (-772.205) -- 0:00:14
781000 -- (-772.624) (-772.245) [-774.987] (-772.120) * (-773.506) (-775.134) [-772.907] (-772.699) -- 0:00:14
781500 -- (-775.313) [-772.227] (-774.270) (-772.152) * (-772.743) (-775.033) (-776.318) [-777.070] -- 0:00:14
782000 -- [-771.046] (-772.635) (-774.050) (-773.839) * (-776.084) (-775.976) [-771.617] (-773.520) -- 0:00:14
782500 -- (-774.725) (-775.681) (-776.159) [-774.111] * (-778.543) (-775.564) (-772.425) [-771.357] -- 0:00:14
783000 -- (-770.662) (-771.377) (-773.355) [-770.661] * [-771.586] (-778.184) (-771.049) (-771.805) -- 0:00:14
783500 -- (-771.804) (-773.580) [-774.646] (-771.997) * (-771.217) (-778.056) [-772.609] (-772.133) -- 0:00:14
784000 -- (-771.302) (-780.747) [-773.136] (-776.569) * (-774.505) (-773.619) (-775.212) [-772.265] -- 0:00:14
784500 -- (-772.394) (-774.783) [-774.303] (-774.588) * (-772.043) [-772.661] (-774.567) (-774.649) -- 0:00:14
785000 -- (-772.615) (-770.773) [-772.982] (-773.425) * [-774.062] (-772.183) (-777.121) (-772.203) -- 0:00:13
Average standard deviation of split frequencies: 0.005718
785500 -- (-772.944) (-770.792) [-772.287] (-772.366) * (-773.856) (-772.920) [-770.670] (-771.290) -- 0:00:14
786000 -- (-771.037) [-771.792] (-771.060) (-772.018) * (-773.778) (-773.729) [-771.668] (-771.510) -- 0:00:14
786500 -- (-771.954) (-773.676) (-773.764) [-772.819] * (-770.966) (-774.828) [-771.357] (-777.442) -- 0:00:14
787000 -- (-771.836) (-770.990) (-772.359) [-773.079] * (-774.642) (-772.458) [-772.816] (-773.444) -- 0:00:14
787500 -- (-771.013) [-772.384] (-776.221) (-771.177) * [-773.702] (-775.524) (-772.785) (-773.569) -- 0:00:14
788000 -- (-771.699) (-774.983) [-772.203] (-774.694) * (-773.536) (-779.430) [-772.671] (-776.757) -- 0:00:13
788500 -- (-775.375) (-772.704) [-772.353] (-771.042) * (-773.363) (-772.337) [-774.632] (-771.333) -- 0:00:13
789000 -- (-774.800) [-770.678] (-772.671) (-771.865) * (-776.073) [-772.660] (-772.589) (-771.742) -- 0:00:13
789500 -- (-775.778) [-770.874] (-770.401) (-771.605) * (-775.855) (-772.409) (-773.559) [-773.944] -- 0:00:13
790000 -- (-774.211) (-773.132) [-776.803] (-776.052) * (-773.723) [-775.639] (-773.425) (-773.632) -- 0:00:13
Average standard deviation of split frequencies: 0.005962
790500 -- [-775.519] (-773.498) (-774.246) (-774.300) * [-773.405] (-772.886) (-773.989) (-774.660) -- 0:00:13
791000 -- (-774.660) (-772.927) [-773.268] (-774.876) * [-771.883] (-775.594) (-773.974) (-771.544) -- 0:00:13
791500 -- (-772.366) (-771.272) (-772.023) [-773.250] * [-772.163] (-775.983) (-773.563) (-773.052) -- 0:00:13
792000 -- (-773.525) (-770.378) [-771.910] (-774.949) * (-769.458) (-773.758) [-773.718] (-772.212) -- 0:00:13
792500 -- [-772.878] (-773.837) (-773.854) (-775.834) * [-773.033] (-771.675) (-772.498) (-772.432) -- 0:00:13
793000 -- (-773.760) (-774.692) (-772.151) [-772.215] * (-772.394) [-773.084] (-772.714) (-771.426) -- 0:00:13
793500 -- [-773.442] (-771.475) (-773.188) (-770.365) * (-774.149) [-770.721] (-772.113) (-774.184) -- 0:00:13
794000 -- (-772.004) [-771.185] (-772.311) (-770.938) * (-772.697) (-772.624) [-775.025] (-771.002) -- 0:00:13
794500 -- (-772.515) [-771.110] (-776.354) (-770.650) * [-770.114] (-772.527) (-773.720) (-770.853) -- 0:00:13
795000 -- [-772.218] (-775.271) (-777.845) (-771.380) * (-770.382) (-770.683) [-773.325] (-774.109) -- 0:00:13
Average standard deviation of split frequencies: 0.005962
795500 -- (-774.041) [-773.251] (-771.090) (-769.992) * [-773.464] (-774.101) (-772.643) (-775.104) -- 0:00:13
796000 -- (-772.855) (-770.641) [-771.345] (-770.877) * (-778.204) (-774.056) [-771.113] (-772.830) -- 0:00:13
796500 -- (-774.148) [-773.620] (-773.363) (-772.249) * (-774.728) [-774.553] (-774.996) (-774.524) -- 0:00:13
797000 -- (-772.618) (-771.271) (-773.683) [-772.496] * (-773.581) (-775.542) (-774.473) [-771.756] -- 0:00:13
797500 -- (-771.101) (-775.162) (-777.452) [-772.671] * (-773.462) (-774.069) (-773.422) [-775.116] -- 0:00:13
798000 -- (-771.357) (-774.765) [-771.832] (-775.404) * [-774.300] (-773.947) (-771.433) (-774.397) -- 0:00:13
798500 -- (-771.201) (-771.320) [-774.282] (-774.351) * [-771.201] (-772.599) (-770.435) (-776.150) -- 0:00:13
799000 -- [-772.794] (-770.324) (-774.148) (-770.824) * (-773.028) (-772.208) [-770.437] (-777.427) -- 0:00:13
799500 -- (-772.447) (-770.681) (-775.627) [-770.402] * (-771.361) (-780.333) [-769.604] (-777.585) -- 0:00:13
800000 -- (-781.852) [-769.953] (-772.249) (-773.512) * [-773.731] (-775.952) (-771.837) (-771.643) -- 0:00:12
Average standard deviation of split frequencies: 0.006241
800500 -- [-772.702] (-772.224) (-772.834) (-773.435) * (-773.259) (-773.961) [-771.341] (-773.439) -- 0:00:13
801000 -- (-775.840) (-773.122) (-772.437) [-771.989] * [-772.152] (-772.265) (-772.544) (-771.942) -- 0:00:13
801500 -- (-771.914) [-773.448] (-775.182) (-773.115) * (-772.491) (-773.173) [-772.605] (-772.051) -- 0:00:13
802000 -- (-772.913) [-771.229] (-772.626) (-775.368) * (-775.355) (-772.056) [-774.476] (-772.156) -- 0:00:13
802500 -- (-773.527) (-771.999) [-771.422] (-773.227) * (-773.567) (-772.332) [-771.530] (-773.549) -- 0:00:13
803000 -- (-781.665) [-771.863] (-772.858) (-773.405) * (-773.474) [-772.358] (-772.691) (-774.053) -- 0:00:13
803500 -- [-772.424] (-776.227) (-772.445) (-771.754) * (-771.912) [-771.958] (-773.936) (-774.065) -- 0:00:12
804000 -- (-772.657) [-774.096] (-770.693) (-775.819) * (-773.325) [-774.546] (-775.977) (-772.764) -- 0:00:12
804500 -- (-771.890) (-773.090) [-772.849] (-773.796) * [-771.893] (-776.771) (-772.767) (-776.744) -- 0:00:12
805000 -- (-771.895) [-772.851] (-770.727) (-774.053) * (-772.591) [-774.017] (-773.285) (-774.442) -- 0:00:12
Average standard deviation of split frequencies: 0.005888
805500 -- [-772.676] (-773.035) (-772.103) (-773.581) * (-774.257) (-771.522) [-772.714] (-774.443) -- 0:00:12
806000 -- (-774.226) (-772.503) [-772.587] (-772.958) * [-771.946] (-772.907) (-776.684) (-773.538) -- 0:00:12
806500 -- (-771.459) [-774.803] (-773.103) (-777.356) * (-774.199) (-772.172) (-771.037) [-770.377] -- 0:00:12
807000 -- (-775.773) [-770.927] (-770.083) (-774.567) * (-772.367) (-772.258) [-773.017] (-771.496) -- 0:00:12
807500 -- (-775.277) (-772.033) (-773.348) [-772.336] * [-770.449] (-774.994) (-774.722) (-774.386) -- 0:00:12
808000 -- (-772.650) [-772.737] (-774.938) (-770.852) * (-769.758) (-772.215) [-770.857] (-769.972) -- 0:00:12
808500 -- (-770.831) (-770.314) (-775.163) [-771.896] * (-771.222) (-773.518) [-771.229] (-776.014) -- 0:00:12
809000 -- (-772.166) (-772.525) (-775.752) [-773.701] * (-773.715) (-770.724) (-775.214) [-772.585] -- 0:00:12
809500 -- (-774.506) (-773.147) (-775.470) [-772.864] * [-771.224] (-774.180) (-774.149) (-772.980) -- 0:00:12
810000 -- [-770.762] (-774.908) (-774.373) (-771.097) * (-770.425) (-775.094) [-772.575] (-771.293) -- 0:00:12
Average standard deviation of split frequencies: 0.005970
810500 -- (-773.127) (-776.256) (-775.340) [-772.451] * (-771.267) (-771.065) [-772.658] (-772.264) -- 0:00:12
811000 -- [-772.746] (-776.243) (-774.486) (-773.575) * (-773.642) (-770.806) [-772.965] (-773.698) -- 0:00:12
811500 -- [-771.865] (-778.213) (-772.432) (-772.789) * [-774.880] (-772.044) (-771.622) (-774.328) -- 0:00:12
812000 -- [-772.839] (-777.410) (-772.745) (-774.733) * (-775.196) (-775.163) (-773.280) [-772.554] -- 0:00:12
812500 -- (-775.374) (-777.753) (-773.863) [-771.302] * (-773.268) [-775.080] (-773.896) (-773.644) -- 0:00:12
813000 -- (-775.631) (-774.822) (-773.795) [-772.570] * [-772.093] (-772.648) (-770.674) (-777.658) -- 0:00:12
813500 -- (-769.636) [-774.763] (-773.131) (-772.168) * (-773.607) [-771.636] (-776.387) (-780.258) -- 0:00:12
814000 -- (-773.051) [-772.745] (-772.101) (-773.168) * [-773.571] (-774.443) (-770.706) (-775.570) -- 0:00:12
814500 -- (-771.083) (-773.867) [-771.556] (-772.132) * (-775.640) (-777.814) (-770.866) [-776.921] -- 0:00:12
815000 -- [-771.661] (-777.426) (-771.954) (-775.712) * (-770.485) [-775.038] (-771.404) (-771.969) -- 0:00:12
Average standard deviation of split frequencies: 0.006278
815500 -- (-775.638) (-773.191) [-773.264] (-777.913) * (-773.256) (-772.975) [-773.463] (-776.216) -- 0:00:12
816000 -- [-770.674] (-777.858) (-775.838) (-775.366) * [-772.358] (-771.744) (-772.608) (-773.833) -- 0:00:12
816500 -- [-771.568] (-775.361) (-776.288) (-771.418) * (-772.171) (-773.662) (-774.345) [-771.445] -- 0:00:12
817000 -- [-773.293] (-771.562) (-774.836) (-776.733) * [-772.118] (-775.642) (-773.115) (-772.352) -- 0:00:12
817500 -- (-772.249) (-775.124) [-774.642] (-772.423) * [-770.905] (-775.946) (-771.394) (-772.909) -- 0:00:12
818000 -- [-776.751] (-772.585) (-773.891) (-775.080) * (-776.049) [-772.000] (-772.825) (-774.982) -- 0:00:12
818500 -- (-771.562) (-772.436) (-772.310) [-773.798] * (-774.853) [-772.822] (-773.800) (-772.054) -- 0:00:11
819000 -- (-771.888) (-774.870) [-775.725] (-773.405) * (-770.391) (-773.938) [-770.611] (-773.697) -- 0:00:11
819500 -- (-774.207) (-774.904) (-773.194) [-774.410] * [-769.112] (-774.446) (-771.521) (-774.363) -- 0:00:11
820000 -- (-774.333) [-772.305] (-775.743) (-773.920) * [-771.489] (-774.396) (-771.270) (-773.673) -- 0:00:11
Average standard deviation of split frequencies: 0.006051
820500 -- (-772.694) [-772.363] (-775.417) (-773.144) * (-775.230) (-776.448) (-772.427) [-773.857] -- 0:00:11
821000 -- (-772.842) [-773.121] (-781.080) (-771.372) * (-774.491) (-772.238) (-773.097) [-770.200] -- 0:00:11
821500 -- (-773.124) (-778.447) (-777.547) [-772.761] * (-773.148) (-777.746) (-771.909) [-771.654] -- 0:00:11
822000 -- (-772.867) (-774.547) (-778.074) [-771.970] * (-771.803) (-771.714) [-774.936] (-775.523) -- 0:00:11
822500 -- [-776.748] (-776.164) (-771.139) (-775.141) * (-770.776) [-770.349] (-774.456) (-769.907) -- 0:00:11
823000 -- (-773.850) (-775.114) (-773.862) [-773.073] * [-771.062] (-771.742) (-772.716) (-771.085) -- 0:00:11
823500 -- (-774.232) (-775.104) (-773.416) [-773.035] * (-771.212) (-773.791) [-772.021] (-771.065) -- 0:00:11
824000 -- (-774.731) (-770.087) [-773.369] (-773.551) * [-775.298] (-774.628) (-776.200) (-774.481) -- 0:00:11
824500 -- [-773.124] (-772.926) (-772.150) (-775.110) * (-775.919) (-771.233) (-774.418) [-773.078] -- 0:00:11
825000 -- (-776.008) [-773.027] (-772.803) (-773.548) * (-777.930) [-772.537] (-772.058) (-772.297) -- 0:00:11
Average standard deviation of split frequencies: 0.006354
825500 -- (-778.134) [-771.000] (-774.470) (-772.062) * (-771.688) (-773.209) (-771.987) [-773.510] -- 0:00:11
826000 -- [-771.706] (-777.074) (-773.977) (-772.820) * (-774.442) (-771.805) [-774.865] (-773.070) -- 0:00:11
826500 -- (-773.938) (-771.408) (-776.140) [-771.438] * (-771.116) (-771.941) [-774.900] (-776.127) -- 0:00:11
827000 -- [-774.222] (-772.268) (-775.576) (-773.523) * [-772.542] (-772.424) (-774.805) (-776.212) -- 0:00:11
827500 -- (-772.085) (-773.631) [-771.143] (-771.605) * (-773.600) (-772.289) (-774.182) [-773.853] -- 0:00:11
828000 -- (-775.097) (-774.063) [-772.578] (-773.008) * (-775.168) (-772.935) [-772.846] (-769.881) -- 0:00:11
828500 -- [-774.591] (-772.076) (-771.561) (-770.761) * (-774.161) (-774.364) (-774.037) [-773.086] -- 0:00:11
829000 -- (-773.074) [-772.994] (-775.530) (-772.086) * [-774.937] (-775.554) (-773.147) (-772.617) -- 0:00:11
829500 -- (-772.938) [-772.676] (-775.833) (-771.091) * (-772.677) [-772.375] (-774.459) (-774.917) -- 0:00:11
830000 -- [-774.545] (-779.846) (-773.311) (-772.052) * [-770.304] (-774.411) (-774.880) (-774.536) -- 0:00:11
Average standard deviation of split frequencies: 0.006280
830500 -- (-773.590) [-777.929] (-774.314) (-770.856) * (-772.677) [-771.935] (-773.680) (-772.653) -- 0:00:11
831000 -- (-775.426) (-774.264) (-775.732) [-775.240] * [-773.996] (-774.608) (-772.098) (-775.662) -- 0:00:11
831500 -- (-774.809) [-772.711] (-776.414) (-776.568) * [-769.805] (-773.555) (-772.014) (-772.101) -- 0:00:11
832000 -- (-776.012) [-772.391] (-777.108) (-772.009) * [-772.823] (-777.391) (-773.053) (-774.106) -- 0:00:11
832500 -- [-772.972] (-771.897) (-775.174) (-770.951) * (-773.515) (-772.837) (-775.617) [-775.761] -- 0:00:11
833000 -- (-775.037) (-776.407) [-772.285] (-772.674) * (-772.132) (-774.293) (-775.932) [-770.999] -- 0:00:11
833500 -- [-776.806] (-773.214) (-773.372) (-772.408) * (-774.684) (-773.786) (-772.642) [-776.529] -- 0:00:10
834000 -- (-776.050) (-776.751) (-771.673) [-771.160] * (-772.197) (-772.230) (-772.969) [-774.800] -- 0:00:10
834500 -- (-773.979) [-775.677] (-773.540) (-773.313) * (-775.082) [-774.475] (-774.551) (-773.470) -- 0:00:10
835000 -- [-774.635] (-772.220) (-776.201) (-776.349) * [-772.819] (-773.579) (-773.108) (-771.227) -- 0:00:10
Average standard deviation of split frequencies: 0.006165
835500 -- (-776.682) (-772.484) [-774.140] (-772.214) * [-772.397] (-771.384) (-772.606) (-771.411) -- 0:00:10
836000 -- [-773.838] (-770.882) (-771.757) (-772.994) * (-773.905) (-773.828) (-772.617) [-772.721] -- 0:00:10
836500 -- (-773.790) [-773.796] (-773.254) (-774.219) * [-775.040] (-776.064) (-778.268) (-771.143) -- 0:00:10
837000 -- (-773.195) (-773.608) (-778.361) [-771.227] * (-772.484) [-772.058] (-772.705) (-771.108) -- 0:00:10
837500 -- (-773.458) (-773.463) (-772.720) [-769.944] * [-775.821] (-772.702) (-773.197) (-777.797) -- 0:00:10
838000 -- [-772.972] (-772.755) (-775.098) (-771.044) * (-772.401) (-772.564) [-773.671] (-776.288) -- 0:00:10
838500 -- [-773.613] (-772.763) (-774.926) (-773.367) * (-773.861) [-773.082] (-772.018) (-775.928) -- 0:00:10
839000 -- (-771.885) (-774.067) (-772.584) [-775.659] * (-774.783) [-770.520] (-774.128) (-772.346) -- 0:00:10
839500 -- [-772.152] (-773.165) (-773.152) (-771.510) * (-777.075) (-771.517) (-770.690) [-771.062] -- 0:00:10
840000 -- (-773.184) [-774.310] (-771.281) (-769.947) * [-771.748] (-772.596) (-771.871) (-772.875) -- 0:00:10
Average standard deviation of split frequencies: 0.006019
840500 -- (-771.802) (-771.573) (-774.154) [-774.204] * (-773.599) (-773.494) (-775.582) [-771.486] -- 0:00:10
841000 -- (-771.808) (-771.209) [-774.148] (-774.953) * (-771.149) [-774.504] (-775.645) (-770.597) -- 0:00:10
841500 -- (-771.637) (-773.066) (-772.935) [-776.931] * [-770.956] (-774.982) (-774.772) (-774.126) -- 0:00:10
842000 -- [-774.509] (-779.455) (-773.194) (-775.429) * (-771.005) (-771.728) [-773.687] (-773.286) -- 0:00:10
842500 -- (-772.403) (-773.814) (-777.531) [-773.123] * [-770.375] (-772.298) (-773.814) (-772.162) -- 0:00:10
843000 -- [-771.707] (-772.689) (-774.597) (-774.171) * (-772.675) (-771.969) (-772.179) [-774.147] -- 0:00:10
843500 -- [-772.173] (-771.837) (-771.869) (-771.765) * (-773.838) (-772.879) [-776.202] (-773.019) -- 0:00:10
844000 -- (-771.238) (-776.429) (-773.041) [-772.086] * [-774.597] (-773.330) (-773.857) (-775.010) -- 0:00:10
844500 -- [-770.779] (-773.313) (-771.696) (-772.562) * [-772.666] (-774.734) (-775.807) (-774.015) -- 0:00:10
845000 -- [-770.432] (-774.077) (-772.482) (-774.176) * [-771.897] (-775.558) (-776.861) (-774.979) -- 0:00:10
Average standard deviation of split frequencies: 0.006352
845500 -- (-772.340) (-774.280) [-770.121] (-773.522) * (-774.567) (-776.260) (-773.062) [-771.726] -- 0:00:10
846000 -- [-772.966] (-772.575) (-775.392) (-777.217) * (-772.878) (-775.807) [-771.959] (-774.332) -- 0:00:10
846500 -- (-771.112) (-771.961) [-772.441] (-775.780) * (-772.003) [-772.793] (-772.720) (-774.414) -- 0:00:10
847000 -- (-771.542) (-772.301) (-772.692) [-775.044] * (-771.608) (-773.176) [-771.634] (-774.115) -- 0:00:10
847500 -- [-771.771] (-772.402) (-771.722) (-778.521) * [-770.493] (-775.504) (-774.815) (-772.299) -- 0:00:10
848000 -- (-773.693) (-772.129) (-770.357) [-773.096] * (-775.174) (-772.880) (-775.019) [-773.830] -- 0:00:10
848500 -- (-770.556) (-772.103) (-772.396) [-775.208] * (-775.543) [-774.029] (-780.888) (-772.355) -- 0:00:09
849000 -- [-774.633] (-772.856) (-774.494) (-777.345) * (-772.982) (-772.664) (-773.441) [-773.846] -- 0:00:09
849500 -- (-776.795) (-772.469) [-772.692] (-775.818) * [-773.441] (-772.597) (-772.988) (-775.347) -- 0:00:09
850000 -- (-774.342) [-772.248] (-773.202) (-776.148) * (-774.179) (-772.078) (-771.837) [-773.890] -- 0:00:09
Average standard deviation of split frequencies: 0.006576
850500 -- (-774.078) (-774.395) [-772.672] (-772.188) * (-774.942) (-772.738) [-770.143] (-777.419) -- 0:00:09
851000 -- (-774.030) (-774.665) (-771.908) [-773.379] * [-773.223] (-774.241) (-771.206) (-771.493) -- 0:00:09
851500 -- (-774.203) [-773.320] (-773.755) (-774.462) * (-772.302) (-773.524) [-772.140] (-775.802) -- 0:00:09
852000 -- (-771.193) [-774.378] (-777.830) (-775.678) * (-773.224) [-773.652] (-773.596) (-773.704) -- 0:00:09
852500 -- (-772.073) [-771.308] (-774.011) (-774.175) * (-772.361) (-775.662) (-771.155) [-773.933] -- 0:00:09
853000 -- (-772.568) (-774.123) [-775.855] (-773.989) * [-772.275] (-773.457) (-772.785) (-773.069) -- 0:00:09
853500 -- (-773.883) (-774.004) [-771.290] (-773.947) * [-772.940] (-774.097) (-772.965) (-776.148) -- 0:00:09
854000 -- (-775.120) (-772.824) [-772.471] (-772.305) * (-773.667) (-776.103) [-771.024] (-777.332) -- 0:00:09
854500 -- (-774.945) [-774.451] (-774.938) (-776.901) * (-774.008) [-773.913] (-771.756) (-779.951) -- 0:00:09
855000 -- (-771.667) [-772.136] (-773.176) (-774.163) * [-772.653] (-771.532) (-771.178) (-772.788) -- 0:00:09
Average standard deviation of split frequencies: 0.006535
855500 -- (-770.368) (-774.185) [-773.993] (-771.254) * (-776.111) (-773.184) (-770.965) [-774.912] -- 0:00:09
856000 -- (-776.052) [-770.966] (-774.293) (-770.865) * [-771.035] (-773.645) (-771.629) (-772.114) -- 0:00:09
856500 -- (-776.894) (-773.881) [-771.757] (-771.354) * (-778.628) (-771.636) [-771.643] (-775.823) -- 0:00:09
857000 -- (-773.559) (-773.845) (-772.340) [-772.402] * (-774.472) (-773.550) [-775.532] (-771.649) -- 0:00:09
857500 -- (-776.888) (-772.905) [-772.127] (-774.411) * (-776.842) [-773.909] (-773.539) (-773.218) -- 0:00:09
858000 -- (-774.980) (-775.971) (-773.873) [-773.475] * (-772.908) (-771.903) (-774.757) [-774.408] -- 0:00:09
858500 -- (-772.937) (-775.237) (-772.963) [-771.392] * [-773.877] (-772.387) (-770.471) (-772.915) -- 0:00:09
859000 -- (-772.587) [-775.942] (-771.457) (-773.808) * (-773.719) (-774.595) [-771.304] (-771.974) -- 0:00:09
859500 -- (-774.467) [-777.099] (-773.160) (-774.496) * (-772.962) [-772.648] (-770.430) (-770.655) -- 0:00:09
860000 -- (-774.407) (-773.529) (-771.864) [-772.393] * [-770.894] (-776.839) (-773.970) (-771.561) -- 0:00:09
Average standard deviation of split frequencies: 0.006500
860500 -- (-775.308) [-773.932] (-773.977) (-771.989) * [-773.509] (-775.018) (-773.231) (-772.790) -- 0:00:09
861000 -- (-775.770) [-772.613] (-773.458) (-773.945) * (-777.879) [-777.972] (-779.255) (-773.306) -- 0:00:09
861500 -- (-772.296) (-773.172) [-772.542] (-772.280) * [-770.467] (-772.647) (-774.897) (-773.440) -- 0:00:09
862000 -- (-774.769) (-771.769) (-769.450) [-771.593] * (-772.222) (-771.306) (-780.711) [-773.348] -- 0:00:09
862500 -- (-778.492) [-770.839] (-771.620) (-771.482) * [-774.632] (-770.578) (-775.292) (-773.017) -- 0:00:09
863000 -- [-773.811] (-771.311) (-777.207) (-781.118) * (-775.223) [-769.274] (-776.584) (-772.924) -- 0:00:09
863500 -- [-773.256] (-771.896) (-777.528) (-775.692) * (-771.625) (-772.262) (-779.231) [-771.892] -- 0:00:09
864000 -- [-769.852] (-773.084) (-777.204) (-770.819) * (-772.677) (-774.521) (-773.942) [-773.115] -- 0:00:08
864500 -- (-775.471) (-773.316) [-770.582] (-773.440) * [-772.393] (-775.772) (-773.170) (-772.840) -- 0:00:08
865000 -- (-779.760) (-774.363) (-774.246) [-774.202] * [-773.688] (-771.945) (-773.481) (-770.234) -- 0:00:08
Average standard deviation of split frequencies: 0.006568
865500 -- [-770.880] (-774.106) (-773.342) (-771.719) * [-769.947] (-771.687) (-775.079) (-776.280) -- 0:00:08
866000 -- (-770.634) (-772.959) (-773.655) [-772.838] * [-773.979] (-774.502) (-773.050) (-775.513) -- 0:00:08
866500 -- [-771.409] (-772.054) (-773.273) (-774.642) * (-774.904) [-773.744] (-773.895) (-772.020) -- 0:00:08
867000 -- [-773.111] (-773.371) (-770.558) (-771.229) * (-772.009) [-771.721] (-773.190) (-776.557) -- 0:00:08
867500 -- (-772.297) (-770.461) (-772.812) [-772.707] * [-773.574] (-771.747) (-775.891) (-770.668) -- 0:00:08
868000 -- [-773.704] (-772.213) (-772.289) (-770.891) * (-773.189) (-774.848) [-773.063] (-771.983) -- 0:00:08
868500 -- (-771.438) [-770.988] (-774.333) (-774.524) * (-771.078) [-772.425] (-773.644) (-773.811) -- 0:00:08
869000 -- (-771.739) [-775.670] (-772.194) (-772.421) * (-772.510) (-773.701) (-774.699) [-772.423] -- 0:00:08
869500 -- (-769.968) [-772.022] (-772.332) (-773.866) * (-771.968) [-773.476] (-772.177) (-770.895) -- 0:00:08
870000 -- (-774.091) (-774.337) (-775.366) [-774.830] * [-771.020] (-773.001) (-772.336) (-776.475) -- 0:00:08
Average standard deviation of split frequencies: 0.006533
870500 -- (-773.519) (-774.272) [-770.673] (-771.600) * (-773.620) (-772.822) (-773.593) [-770.279] -- 0:00:08
871000 -- [-772.425] (-773.536) (-769.964) (-773.444) * (-773.852) (-774.180) (-771.445) [-771.069] -- 0:00:08
871500 -- (-772.419) [-772.206] (-781.057) (-772.034) * (-773.451) (-771.885) (-770.364) [-770.235] -- 0:00:08
872000 -- (-774.718) [-770.833] (-772.257) (-777.850) * (-772.185) (-777.283) (-773.695) [-775.578] -- 0:00:08
872500 -- [-774.490] (-774.652) (-774.306) (-775.473) * [-775.821] (-769.772) (-771.495) (-774.256) -- 0:00:08
873000 -- (-771.681) [-773.161] (-774.632) (-775.440) * (-773.011) (-772.289) [-770.309] (-777.462) -- 0:00:08
873500 -- (-771.966) (-774.006) (-772.769) [-773.262] * (-772.186) (-770.349) (-771.052) [-774.250] -- 0:00:08
874000 -- (-775.504) (-773.830) (-771.951) [-773.638] * (-771.241) (-771.626) [-776.310] (-771.893) -- 0:00:08
874500 -- (-772.716) [-772.341] (-771.550) (-773.473) * (-771.896) (-773.473) (-772.634) [-771.888] -- 0:00:08
875000 -- [-770.965] (-773.300) (-773.401) (-774.076) * [-770.641] (-770.595) (-772.254) (-772.946) -- 0:00:08
Average standard deviation of split frequencies: 0.006493
875500 -- (-771.999) (-775.715) (-775.092) [-772.253] * (-770.773) (-774.832) [-771.535] (-772.091) -- 0:00:08
876000 -- (-770.443) (-774.033) (-772.237) [-776.381] * (-775.978) (-774.160) (-776.287) [-772.341] -- 0:00:08
876500 -- [-769.916] (-773.217) (-774.352) (-778.317) * (-777.055) (-774.980) (-774.780) [-771.913] -- 0:00:08
877000 -- [-772.781] (-772.282) (-773.694) (-778.118) * (-775.830) (-773.468) (-771.496) [-770.624] -- 0:00:08
877500 -- (-773.881) [-770.979] (-772.073) (-774.731) * (-778.061) (-772.416) [-772.152] (-771.924) -- 0:00:08
878000 -- (-773.730) (-773.651) [-770.423] (-772.611) * (-775.617) (-773.014) (-773.446) [-773.922] -- 0:00:08
878500 -- (-774.141) (-772.307) (-771.019) [-771.708] * (-772.664) (-770.446) [-774.085] (-772.472) -- 0:00:08
879000 -- [-775.474] (-772.897) (-773.367) (-776.546) * (-775.105) (-773.074) [-772.796] (-771.437) -- 0:00:07
879500 -- (-774.821) (-774.638) [-772.644] (-772.622) * (-771.821) [-772.551] (-773.457) (-776.115) -- 0:00:07
880000 -- (-777.625) (-772.986) [-771.289] (-771.775) * (-771.915) (-771.877) [-773.987] (-774.911) -- 0:00:07
Average standard deviation of split frequencies: 0.006316
880500 -- (-775.931) [-771.185] (-775.792) (-774.088) * (-772.778) (-774.676) (-775.121) [-772.040] -- 0:00:07
881000 -- (-771.809) (-772.930) [-773.112] (-773.819) * (-770.122) (-775.264) (-774.882) [-769.919] -- 0:00:07
881500 -- [-771.687] (-775.207) (-771.896) (-772.279) * [-769.321] (-774.503) (-775.871) (-771.097) -- 0:00:07
882000 -- (-772.805) (-774.160) [-773.917] (-771.978) * [-771.985] (-772.635) (-778.047) (-771.383) -- 0:00:07
882500 -- (-772.382) [-770.761] (-774.828) (-772.234) * (-772.945) (-773.806) [-771.612] (-776.532) -- 0:00:07
883000 -- (-774.771) [-773.458] (-775.026) (-772.330) * (-774.465) (-770.358) (-771.777) [-773.884] -- 0:00:07
883500 -- (-772.914) (-774.089) [-774.537] (-774.689) * (-771.413) [-771.523] (-773.637) (-776.173) -- 0:00:07
884000 -- (-772.051) [-770.930] (-775.105) (-774.924) * (-773.195) (-772.743) [-774.275] (-777.692) -- 0:00:07
884500 -- [-772.544] (-777.267) (-773.095) (-772.649) * (-772.265) (-771.701) [-774.122] (-771.273) -- 0:00:07
885000 -- [-772.905] (-775.208) (-776.026) (-773.030) * (-771.345) [-772.802] (-774.569) (-772.962) -- 0:00:07
Average standard deviation of split frequencies: 0.006562
885500 -- (-772.933) (-773.423) (-772.787) [-771.432] * (-774.131) (-772.767) (-773.571) [-772.967] -- 0:00:07
886000 -- [-772.446] (-773.793) (-772.398) (-772.796) * (-775.575) (-775.700) [-771.403] (-771.599) -- 0:00:07
886500 -- (-775.086) (-772.541) (-773.684) [-772.439] * (-774.298) (-778.841) [-774.005] (-774.133) -- 0:00:07
887000 -- (-775.379) (-772.444) (-776.484) [-773.190] * (-776.454) (-776.764) (-778.069) [-773.784] -- 0:00:07
887500 -- (-776.568) (-773.529) (-772.066) [-770.391] * [-772.086] (-774.231) (-778.480) (-771.803) -- 0:00:07
888000 -- (-773.694) [-772.456] (-772.191) (-779.365) * (-772.511) (-772.649) (-772.879) [-771.984] -- 0:00:07
888500 -- [-773.297] (-773.421) (-771.151) (-774.938) * (-773.648) (-774.901) [-772.572] (-773.373) -- 0:00:07
889000 -- (-772.846) (-770.336) [-772.391] (-773.408) * (-776.661) [-773.121] (-772.045) (-776.830) -- 0:00:07
889500 -- (-776.386) (-771.114) [-771.025] (-772.155) * (-772.490) (-774.877) [-771.945] (-772.872) -- 0:00:07
890000 -- [-773.293] (-771.681) (-776.150) (-772.512) * (-777.217) [-771.689] (-775.837) (-773.394) -- 0:00:07
Average standard deviation of split frequencies: 0.006387
890500 -- (-776.159) (-770.799) (-773.616) [-773.326] * (-772.436) (-772.972) [-771.733] (-774.277) -- 0:00:07
891000 -- (-773.798) (-769.811) [-772.071] (-772.113) * (-772.694) (-772.542) [-772.280] (-775.496) -- 0:00:07
891500 -- [-773.418] (-773.462) (-772.866) (-772.316) * (-770.802) (-774.709) (-772.538) [-770.761] -- 0:00:07
892000 -- (-771.358) [-777.905] (-772.801) (-775.543) * (-775.634) (-774.371) (-773.635) [-771.488] -- 0:00:07
892500 -- (-774.069) (-770.864) [-773.075] (-773.334) * (-773.094) [-772.350] (-774.600) (-774.002) -- 0:00:07
893000 -- (-778.299) (-772.435) [-771.698] (-773.470) * [-775.674] (-774.149) (-772.349) (-774.714) -- 0:00:07
893500 -- (-774.264) (-771.639) [-771.631] (-773.839) * (-772.379) (-775.481) (-772.147) [-772.701] -- 0:00:07
894000 -- (-771.061) [-772.950] (-772.672) (-774.394) * (-770.293) (-773.926) (-774.709) [-771.879] -- 0:00:06
894500 -- (-772.948) (-772.500) (-773.302) [-772.077] * [-773.798] (-775.632) (-772.046) (-772.623) -- 0:00:06
895000 -- (-775.487) (-775.467) (-773.928) [-772.085] * (-772.006) (-774.437) (-770.605) [-772.274] -- 0:00:06
Average standard deviation of split frequencies: 0.006208
895500 -- (-775.706) [-777.054] (-772.767) (-770.500) * (-770.914) (-774.120) [-772.426] (-774.113) -- 0:00:06
896000 -- (-774.406) (-774.819) [-771.290] (-770.936) * (-773.181) [-772.754] (-771.580) (-774.517) -- 0:00:06
896500 -- (-779.413) (-772.421) [-772.834] (-773.138) * (-771.763) (-772.840) (-774.283) [-773.216] -- 0:00:06
897000 -- [-774.293] (-778.065) (-773.884) (-773.115) * (-772.549) (-776.988) (-774.393) [-771.328] -- 0:00:06
897500 -- [-774.196] (-772.741) (-773.580) (-774.782) * (-773.520) (-786.406) (-770.992) [-774.688] -- 0:00:06
898000 -- (-775.024) [-775.039] (-775.089) (-771.685) * [-774.303] (-775.737) (-774.425) (-773.333) -- 0:00:06
898500 -- (-773.191) (-774.547) (-775.904) [-770.570] * (-772.362) [-772.892] (-772.058) (-774.542) -- 0:00:06
899000 -- (-772.918) [-772.257] (-772.965) (-772.178) * (-770.643) (-782.622) (-772.984) [-772.267] -- 0:00:06
899500 -- [-772.841] (-771.796) (-774.590) (-770.848) * (-775.766) [-775.320] (-772.067) (-772.473) -- 0:00:06
900000 -- (-772.160) (-770.305) [-771.512] (-771.563) * (-777.090) (-772.409) [-771.720] (-773.264) -- 0:00:06
Average standard deviation of split frequencies: 0.006036
900500 -- (-772.432) [-776.860] (-774.192) (-772.317) * (-776.702) (-771.902) [-773.179] (-772.104) -- 0:00:06
901000 -- [-771.324] (-776.277) (-772.846) (-775.058) * [-774.328] (-773.913) (-772.397) (-777.677) -- 0:00:06
901500 -- (-771.059) (-773.511) (-773.369) [-774.097] * [-771.082] (-773.143) (-772.196) (-773.096) -- 0:00:06
902000 -- (-771.095) (-772.840) [-770.994] (-776.062) * (-771.985) (-771.793) [-771.718] (-772.380) -- 0:00:06
902500 -- (-771.922) (-769.738) (-773.462) [-774.324] * (-775.372) [-770.991] (-773.168) (-772.376) -- 0:00:06
903000 -- (-772.183) (-770.595) (-775.965) [-772.719] * (-773.381) [-770.725] (-775.299) (-776.381) -- 0:00:06
903500 -- (-770.019) (-774.967) (-774.184) [-774.375] * (-772.275) [-772.851] (-776.256) (-776.813) -- 0:00:06
904000 -- (-771.268) [-776.275] (-772.149) (-772.804) * (-773.463) (-772.371) (-773.098) [-770.825] -- 0:00:06
904500 -- (-770.285) (-774.722) (-771.682) [-773.676] * (-774.552) (-775.540) [-774.868] (-773.753) -- 0:00:06
905000 -- [-774.449] (-775.539) (-775.269) (-771.202) * [-772.560] (-773.036) (-773.800) (-775.522) -- 0:00:06
Average standard deviation of split frequencies: 0.006244
905500 -- (-775.771) [-771.612] (-774.256) (-775.238) * (-772.708) [-770.407] (-774.357) (-776.578) -- 0:00:06
906000 -- (-771.293) [-770.964] (-771.860) (-774.438) * (-774.777) [-772.655] (-772.539) (-780.102) -- 0:00:06
906500 -- [-770.640] (-771.668) (-774.293) (-772.053) * (-772.398) (-775.887) (-772.231) [-773.869] -- 0:00:06
907000 -- (-770.866) [-774.255] (-771.244) (-772.667) * (-774.924) (-777.088) [-772.322] (-773.768) -- 0:00:06
907500 -- (-773.687) [-772.459] (-771.765) (-770.075) * [-776.376] (-778.842) (-771.507) (-772.860) -- 0:00:06
908000 -- (-771.207) (-776.038) (-773.833) [-772.932] * (-775.497) [-773.329] (-773.114) (-773.912) -- 0:00:06
908500 -- (-771.972) [-774.038] (-771.072) (-772.194) * (-774.949) [-773.719] (-776.723) (-773.491) -- 0:00:06
909000 -- (-773.613) (-773.437) (-774.410) [-771.276] * [-777.415] (-773.880) (-780.907) (-772.436) -- 0:00:06
909500 -- [-772.214] (-774.336) (-772.844) (-772.651) * [-777.561] (-770.188) (-778.580) (-772.260) -- 0:00:05
910000 -- [-774.795] (-775.380) (-770.818) (-776.821) * (-774.127) [-770.605] (-776.053) (-772.242) -- 0:00:05
Average standard deviation of split frequencies: 0.006384
910500 -- (-772.660) (-776.196) [-770.819] (-775.918) * (-774.721) (-776.882) (-773.074) [-774.865] -- 0:00:05
911000 -- (-771.846) [-777.464] (-775.010) (-777.265) * (-771.007) (-773.503) (-772.852) [-772.143] -- 0:00:05
911500 -- (-773.970) (-773.180) (-776.322) [-771.088] * [-770.412] (-773.209) (-774.076) (-773.537) -- 0:00:05
912000 -- (-772.850) (-773.002) [-775.254] (-772.432) * [-773.483] (-772.305) (-774.964) (-772.187) -- 0:00:05
912500 -- [-771.262] (-774.474) (-775.445) (-774.953) * (-772.488) (-773.707) (-777.944) [-773.846] -- 0:00:05
913000 -- (-771.516) [-773.923] (-772.266) (-770.422) * (-772.573) [-773.856] (-775.835) (-771.402) -- 0:00:05
913500 -- (-769.657) [-773.085] (-775.451) (-772.402) * (-777.412) [-774.780] (-773.324) (-771.057) -- 0:00:05
914000 -- (-774.226) (-771.221) [-774.781] (-773.026) * (-773.913) [-774.150] (-773.985) (-773.838) -- 0:00:05
914500 -- (-773.525) [-772.224] (-778.934) (-774.672) * (-774.577) [-772.104] (-774.882) (-772.960) -- 0:00:05
915000 -- (-773.015) [-772.845] (-776.220) (-773.756) * (-774.243) (-770.866) (-776.555) [-772.065] -- 0:00:05
Average standard deviation of split frequencies: 0.006690
915500 -- [-773.044] (-771.604) (-775.815) (-773.389) * [-776.012] (-772.094) (-777.132) (-772.870) -- 0:00:05
916000 -- (-775.076) (-776.708) (-773.512) [-774.058] * (-771.539) [-772.220] (-773.292) (-772.059) -- 0:00:05
916500 -- (-773.316) (-773.423) (-772.827) [-771.038] * (-773.339) (-770.264) [-773.318] (-774.290) -- 0:00:05
917000 -- [-772.365] (-773.240) (-776.667) (-772.015) * (-774.294) (-773.402) [-773.414] (-777.601) -- 0:00:05
917500 -- (-772.011) [-773.341] (-773.526) (-773.801) * [-770.680] (-774.504) (-773.522) (-774.540) -- 0:00:05
918000 -- (-774.673) (-771.910) [-774.352] (-771.755) * (-772.837) (-775.403) (-770.820) [-770.482] -- 0:00:05
918500 -- (-773.214) (-776.367) [-772.000] (-773.434) * [-770.212] (-775.709) (-771.692) (-774.018) -- 0:00:05
919000 -- (-774.968) [-773.893] (-772.337) (-771.425) * (-772.080) [-771.521] (-774.913) (-776.128) -- 0:00:05
919500 -- (-775.049) [-772.217] (-772.133) (-775.801) * (-774.423) [-772.687] (-773.828) (-773.097) -- 0:00:05
920000 -- (-772.437) (-771.123) (-772.196) [-773.167] * [-774.955] (-771.348) (-770.483) (-774.321) -- 0:00:05
Average standard deviation of split frequencies: 0.006622
920500 -- (-772.944) [-772.778] (-776.493) (-772.607) * (-775.973) (-777.265) (-771.403) [-772.070] -- 0:00:05
921000 -- [-772.094] (-771.776) (-772.520) (-772.098) * (-773.003) (-771.761) [-770.298] (-771.982) -- 0:00:05
921500 -- (-770.161) (-771.176) [-771.323] (-771.102) * [-773.844] (-770.767) (-773.174) (-773.342) -- 0:00:05
922000 -- (-772.469) (-770.987) [-772.771] (-771.999) * (-772.373) (-772.469) (-777.456) [-771.999] -- 0:00:05
922500 -- [-773.035] (-771.489) (-773.318) (-775.184) * [-772.573] (-772.682) (-772.615) (-771.826) -- 0:00:05
923000 -- [-771.951] (-771.066) (-776.713) (-772.647) * (-771.908) (-773.902) [-774.170] (-771.740) -- 0:00:05
923500 -- (-776.481) (-772.638) [-770.707] (-774.978) * [-773.191] (-772.141) (-771.013) (-771.476) -- 0:00:05
924000 -- (-773.356) (-773.043) [-770.902] (-772.721) * [-772.085] (-772.725) (-772.255) (-772.708) -- 0:00:05
924500 -- [-771.489] (-773.963) (-775.037) (-773.703) * (-773.050) (-774.029) [-773.188] (-772.985) -- 0:00:04
925000 -- (-772.721) (-779.258) [-769.899] (-772.991) * (-773.493) (-770.955) (-774.987) [-772.170] -- 0:00:04
Average standard deviation of split frequencies: 0.006686
925500 -- (-774.101) (-772.042) [-771.464] (-773.687) * (-771.489) [-774.593] (-772.980) (-780.227) -- 0:00:04
926000 -- (-775.697) [-771.256] (-773.287) (-774.280) * (-774.675) (-774.334) (-772.501) [-772.108] -- 0:00:04
926500 -- [-771.514] (-772.208) (-774.388) (-775.519) * [-771.866] (-772.266) (-772.339) (-775.071) -- 0:00:04
927000 -- (-771.690) [-772.644] (-770.462) (-773.766) * [-771.178] (-771.583) (-770.880) (-776.469) -- 0:00:04
927500 -- (-771.783) (-773.553) (-772.896) [-776.083] * [-776.049] (-772.705) (-772.768) (-771.304) -- 0:00:04
928000 -- (-772.994) [-770.494] (-771.607) (-772.340) * [-773.507] (-771.662) (-772.954) (-771.273) -- 0:00:04
928500 -- (-775.701) [-779.088] (-777.495) (-774.408) * [-777.372] (-771.799) (-773.483) (-776.181) -- 0:00:04
929000 -- (-772.222) (-771.517) [-776.031] (-774.309) * (-773.630) (-774.901) [-771.654] (-773.246) -- 0:00:04
929500 -- [-772.732] (-771.529) (-775.000) (-773.002) * (-773.533) (-773.635) [-771.980] (-772.510) -- 0:00:04
930000 -- (-771.741) (-776.394) [-771.835] (-772.422) * (-774.723) (-770.282) (-770.667) [-771.401] -- 0:00:04
Average standard deviation of split frequencies: 0.006450
930500 -- [-773.739] (-771.073) (-774.755) (-772.923) * [-775.626] (-769.956) (-772.816) (-774.922) -- 0:00:04
931000 -- (-776.613) (-772.613) (-774.095) [-772.569] * (-772.032) [-770.616] (-772.787) (-773.074) -- 0:00:04
931500 -- (-772.436) (-772.366) [-773.342] (-772.783) * [-771.669] (-771.323) (-773.091) (-773.420) -- 0:00:04
932000 -- (-773.542) (-772.987) [-772.384] (-773.193) * (-772.980) (-774.071) [-775.347] (-770.862) -- 0:00:04
932500 -- (-774.719) (-771.244) (-775.823) [-772.191] * (-774.189) (-773.796) (-772.308) [-771.400] -- 0:00:04
933000 -- (-772.970) (-775.037) [-772.350] (-771.945) * (-775.721) [-772.490] (-774.768) (-770.897) -- 0:00:04
933500 -- (-771.720) (-773.029) [-772.020] (-774.367) * (-773.906) (-778.776) [-774.001] (-772.182) -- 0:00:04
934000 -- (-770.875) [-775.078] (-771.447) (-777.089) * (-773.709) [-777.459] (-775.510) (-771.168) -- 0:00:04
934500 -- (-774.043) (-774.273) [-770.064] (-771.931) * (-772.277) (-773.255) [-771.308] (-771.502) -- 0:00:04
935000 -- (-772.183) [-772.193] (-772.791) (-772.449) * [-774.354] (-773.622) (-774.092) (-770.274) -- 0:00:04
Average standard deviation of split frequencies: 0.006178
935500 -- (-772.599) (-775.952) (-782.865) [-772.276] * [-776.836] (-771.547) (-770.126) (-770.748) -- 0:00:04
936000 -- (-773.595) [-774.002] (-774.385) (-772.174) * (-777.286) (-772.427) (-771.245) [-772.743] -- 0:00:04
936500 -- (-772.180) (-774.790) (-772.151) [-771.027] * (-776.570) (-771.031) (-771.960) [-772.991] -- 0:00:04
937000 -- (-774.046) [-772.704] (-775.816) (-775.879) * (-774.179) [-771.952] (-774.573) (-773.250) -- 0:00:04
937500 -- (-774.055) (-774.110) (-770.036) [-772.906] * (-774.891) [-772.726] (-774.332) (-774.731) -- 0:00:04
938000 -- [-776.914] (-772.956) (-773.544) (-771.634) * [-773.871] (-771.480) (-772.806) (-774.314) -- 0:00:04
938500 -- (-777.316) (-772.788) (-774.904) [-774.020] * (-772.863) [-773.367] (-773.061) (-771.884) -- 0:00:04
939000 -- [-772.909] (-775.020) (-773.744) (-773.435) * (-775.263) (-774.744) [-770.340] (-778.679) -- 0:00:04
939500 -- [-771.828] (-772.225) (-773.524) (-777.456) * (-774.256) (-774.017) [-771.787] (-775.468) -- 0:00:03
940000 -- (-771.812) (-775.767) (-774.192) [-771.685] * (-772.802) (-771.831) [-773.025] (-776.241) -- 0:00:03
Average standard deviation of split frequencies: 0.006281
940500 -- (-776.884) [-773.349] (-772.730) (-773.128) * (-772.542) (-773.179) (-770.995) [-773.092] -- 0:00:03
941000 -- [-772.484] (-773.645) (-769.975) (-774.394) * (-773.115) (-774.006) [-773.527] (-777.785) -- 0:00:03
941500 -- (-774.756) (-774.378) (-775.502) [-772.222] * (-777.572) (-771.852) (-773.407) [-772.305] -- 0:00:03
942000 -- (-773.841) [-773.488] (-773.531) (-773.983) * [-775.813] (-771.927) (-774.826) (-772.003) -- 0:00:03
942500 -- (-771.588) (-773.069) [-773.903] (-772.865) * (-773.086) [-774.596] (-773.324) (-773.596) -- 0:00:03
943000 -- [-773.029] (-771.617) (-777.323) (-773.577) * (-771.970) (-771.172) (-774.066) [-773.938] -- 0:00:03
943500 -- (-771.892) (-774.617) [-772.030] (-774.136) * (-774.745) (-773.370) [-771.717] (-772.651) -- 0:00:03
944000 -- (-777.210) (-773.174) [-773.492] (-771.948) * (-772.067) (-772.873) [-773.429] (-776.721) -- 0:00:03
944500 -- (-773.136) (-771.494) (-772.963) [-772.381] * (-773.535) (-772.377) [-771.205] (-771.876) -- 0:00:03
945000 -- [-774.895] (-772.412) (-775.506) (-774.311) * (-772.827) [-773.549] (-772.615) (-774.200) -- 0:00:03
Average standard deviation of split frequencies: 0.006478
945500 -- (-773.158) (-774.010) (-774.413) [-774.695] * [-773.488] (-773.359) (-770.698) (-777.818) -- 0:00:03
946000 -- (-774.698) (-773.912) (-774.431) [-774.673] * (-773.612) (-773.935) [-770.679] (-775.568) -- 0:00:03
946500 -- (-771.830) (-774.112) (-774.680) [-773.453] * (-775.392) (-774.181) (-772.146) [-773.743] -- 0:00:03
947000 -- (-770.677) [-773.392] (-773.628) (-772.635) * [-774.279] (-772.231) (-773.006) (-771.611) -- 0:00:03
947500 -- (-772.906) [-770.830] (-776.349) (-771.632) * (-772.463) [-771.780] (-773.184) (-773.777) -- 0:00:03
948000 -- (-773.263) [-771.813] (-775.269) (-772.763) * (-775.113) (-773.457) [-773.173] (-771.630) -- 0:00:03
948500 -- (-776.438) (-772.798) [-774.814] (-773.807) * (-773.260) [-773.105] (-772.789) (-772.530) -- 0:00:03
949000 -- (-773.271) [-773.413] (-774.043) (-772.964) * (-770.446) [-773.807] (-774.116) (-772.965) -- 0:00:03
949500 -- [-774.095] (-773.034) (-773.167) (-771.120) * (-773.554) [-774.042] (-772.297) (-775.454) -- 0:00:03
950000 -- (-772.793) [-772.200] (-773.488) (-772.673) * (-777.017) [-772.995] (-774.228) (-771.787) -- 0:00:03
Average standard deviation of split frequencies: 0.006446
950500 -- [-773.711] (-774.661) (-775.829) (-771.341) * (-771.907) (-772.811) [-772.333] (-772.311) -- 0:00:03
951000 -- (-774.679) (-773.406) [-776.750] (-770.411) * (-769.388) (-771.852) [-773.468] (-774.365) -- 0:00:03
951500 -- (-772.912) (-776.686) (-772.039) [-775.515] * (-771.547) [-773.925] (-772.696) (-777.056) -- 0:00:03
952000 -- [-772.265] (-771.551) (-774.592) (-769.929) * [-771.817] (-772.683) (-773.847) (-771.269) -- 0:00:03
952500 -- [-772.861] (-773.799) (-772.059) (-772.513) * (-774.876) (-773.122) (-773.065) [-771.378] -- 0:00:03
953000 -- [-772.148] (-773.324) (-775.222) (-771.466) * (-770.991) [-774.967] (-778.094) (-769.516) -- 0:00:03
953500 -- [-771.438] (-775.561) (-773.547) (-772.638) * [-775.301] (-772.510) (-773.481) (-771.152) -- 0:00:03
954000 -- [-773.091] (-778.513) (-772.397) (-773.601) * [-770.167] (-774.231) (-772.073) (-772.536) -- 0:00:03
954500 -- [-773.199] (-776.150) (-772.281) (-774.216) * (-775.661) [-775.064] (-771.034) (-776.647) -- 0:00:03
955000 -- [-773.451] (-773.604) (-775.166) (-772.998) * [-775.427] (-773.527) (-772.933) (-776.672) -- 0:00:02
Average standard deviation of split frequencies: 0.006838
955500 -- (-774.835) (-772.356) [-772.805] (-770.158) * (-775.747) (-774.942) (-772.737) [-774.980] -- 0:00:02
956000 -- (-777.400) (-774.704) [-771.077] (-772.398) * (-773.929) (-777.087) [-771.731] (-773.682) -- 0:00:02
956500 -- (-775.286) [-770.933] (-771.175) (-771.274) * (-774.432) (-775.947) (-773.659) [-772.080] -- 0:00:02
957000 -- (-774.002) (-773.138) (-772.263) [-773.914] * [-775.466] (-776.561) (-773.550) (-776.602) -- 0:00:02
957500 -- (-778.570) (-774.747) (-775.441) [-772.660] * (-769.396) (-776.342) [-772.322] (-775.477) -- 0:00:02
958000 -- (-774.245) (-771.350) [-770.603] (-771.979) * (-772.980) (-773.999) [-773.124] (-770.713) -- 0:00:02
958500 -- [-772.810] (-770.859) (-772.899) (-774.001) * (-771.466) (-771.351) [-773.196] (-772.235) -- 0:00:02
959000 -- [-774.607] (-772.217) (-772.599) (-773.373) * [-773.745] (-777.598) (-771.744) (-770.736) -- 0:00:02
959500 -- (-775.567) [-772.636] (-772.469) (-775.065) * (-772.555) [-775.050] (-770.946) (-771.366) -- 0:00:02
960000 -- (-774.602) (-777.345) [-772.664] (-772.858) * [-772.115] (-775.745) (-772.987) (-772.734) -- 0:00:02
Average standard deviation of split frequencies: 0.006346
960500 -- (-772.417) [-775.420] (-777.271) (-772.037) * (-772.857) [-772.703] (-772.080) (-774.000) -- 0:00:02
961000 -- (-771.911) (-774.928) (-776.042) [-771.935] * (-773.824) (-775.667) [-771.777] (-776.441) -- 0:00:02
961500 -- (-773.496) (-771.400) (-773.428) [-770.654] * (-772.201) [-775.687] (-773.913) (-774.721) -- 0:00:02
962000 -- (-773.907) [-773.049] (-772.630) (-771.977) * (-773.978) (-770.458) [-772.019] (-774.149) -- 0:00:02
962500 -- (-775.465) (-776.552) (-773.479) [-770.753] * (-772.516) (-772.313) [-772.369] (-770.987) -- 0:00:02
963000 -- (-775.962) [-773.542] (-771.877) (-774.092) * (-772.530) (-772.423) (-772.396) [-772.708] -- 0:00:02
963500 -- (-772.501) (-780.385) [-774.079] (-776.536) * (-775.296) [-771.914] (-774.435) (-772.118) -- 0:00:02
964000 -- (-771.496) [-774.911] (-773.195) (-772.649) * [-773.046] (-772.307) (-772.787) (-776.608) -- 0:00:02
964500 -- (-778.237) (-772.144) (-769.759) [-771.844] * (-773.280) [-776.911] (-772.733) (-774.170) -- 0:00:02
965000 -- (-775.210) (-775.243) (-772.408) [-771.246] * [-769.665] (-771.646) (-772.142) (-771.937) -- 0:00:02
Average standard deviation of split frequencies: 0.006149
965500 -- (-773.000) (-775.872) (-772.240) [-772.766] * (-775.839) [-771.859] (-773.043) (-772.210) -- 0:00:02
966000 -- (-771.840) [-774.511] (-772.227) (-772.070) * (-772.596) [-773.664] (-773.091) (-772.948) -- 0:00:02
966500 -- (-773.129) (-775.810) [-772.002] (-772.139) * (-774.591) (-774.435) [-776.317] (-771.020) -- 0:00:02
967000 -- (-772.292) (-773.750) (-772.614) [-772.463] * (-775.507) (-775.955) [-772.490] (-773.088) -- 0:00:02
967500 -- (-775.478) (-772.963) [-769.911] (-771.631) * [-773.829] (-776.233) (-773.981) (-772.827) -- 0:00:02
968000 -- (-772.823) (-774.130) (-773.396) [-771.762] * (-775.286) (-774.729) (-773.204) [-770.125] -- 0:00:02
968500 -- (-776.406) (-774.402) [-773.137] (-776.320) * [-772.047] (-775.025) (-775.761) (-773.775) -- 0:00:02
969000 -- (-776.160) (-771.976) [-771.332] (-774.727) * [-771.170] (-771.942) (-773.122) (-771.814) -- 0:00:02
969500 -- (-776.164) (-772.706) (-772.175) [-774.600] * (-780.489) [-772.030] (-775.731) (-771.392) -- 0:00:02
970000 -- (-773.876) (-772.505) (-770.422) [-771.327] * [-773.774] (-772.742) (-773.978) (-772.903) -- 0:00:01
Average standard deviation of split frequencies: 0.006054
970500 -- (-771.094) [-772.993] (-770.389) (-773.201) * (-770.356) [-770.840] (-771.378) (-771.908) -- 0:00:01
971000 -- (-771.389) (-776.023) (-773.153) [-773.150] * [-771.495] (-772.671) (-772.071) (-771.701) -- 0:00:01
971500 -- (-771.480) (-776.973) (-773.581) [-770.341] * (-773.804) (-775.481) [-771.287] (-772.716) -- 0:00:01
972000 -- (-773.547) [-774.846] (-771.762) (-772.563) * [-773.745] (-772.161) (-771.797) (-771.333) -- 0:00:01
972500 -- (-773.885) (-772.730) [-773.448] (-773.589) * (-772.836) (-769.827) (-774.170) [-772.813] -- 0:00:01
973000 -- (-773.358) [-776.360] (-772.954) (-773.354) * [-772.307] (-772.980) (-771.780) (-770.725) -- 0:00:01
973500 -- [-772.167] (-774.959) (-773.343) (-773.732) * [-770.614] (-772.654) (-773.981) (-772.907) -- 0:00:01
974000 -- (-771.427) (-774.966) [-773.282] (-771.546) * (-771.567) [-772.139] (-773.271) (-772.235) -- 0:00:01
974500 -- [-771.097] (-775.485) (-775.250) (-771.502) * (-773.593) (-771.959) [-773.127] (-775.364) -- 0:00:01
975000 -- (-772.164) [-775.525] (-774.797) (-772.297) * (-774.452) (-771.507) (-773.066) [-774.420] -- 0:00:01
Average standard deviation of split frequencies: 0.006376
975500 -- [-774.735] (-773.659) (-773.315) (-771.408) * (-774.838) [-771.636] (-776.045) (-776.742) -- 0:00:01
976000 -- (-773.085) (-773.548) [-773.204] (-772.216) * (-774.133) [-770.985] (-775.624) (-777.717) -- 0:00:01
976500 -- (-777.226) (-774.133) (-772.260) [-770.650] * [-774.236] (-774.453) (-775.420) (-774.608) -- 0:00:01
977000 -- (-775.879) [-776.186] (-777.414) (-774.255) * (-774.417) [-770.410] (-770.625) (-772.358) -- 0:00:01
977500 -- (-772.627) [-773.864] (-773.566) (-771.263) * (-776.308) (-774.847) (-772.433) [-776.288] -- 0:00:01
978000 -- (-773.250) (-772.074) [-773.787] (-773.558) * (-774.247) [-771.027] (-774.011) (-771.914) -- 0:00:01
978500 -- (-774.429) (-772.425) [-773.627] (-776.062) * [-771.808] (-770.095) (-773.344) (-772.804) -- 0:00:01
979000 -- [-771.924] (-774.103) (-772.879) (-775.573) * [-770.471] (-772.634) (-776.400) (-771.350) -- 0:00:01
979500 -- [-773.795] (-774.264) (-771.968) (-778.314) * (-771.575) [-775.242] (-771.527) (-776.294) -- 0:00:01
980000 -- (-774.625) (-774.046) (-772.279) [-773.705] * [-777.783] (-780.029) (-771.743) (-771.454) -- 0:00:01
Average standard deviation of split frequencies: 0.006409
980500 -- (-776.349) (-774.474) (-773.436) [-776.262] * [-771.324] (-776.091) (-771.730) (-772.774) -- 0:00:01
981000 -- [-772.349] (-773.238) (-773.814) (-775.356) * (-778.244) [-777.624] (-774.415) (-774.912) -- 0:00:01
981500 -- (-773.664) (-773.659) [-771.481] (-773.543) * [-771.250] (-771.602) (-774.839) (-772.956) -- 0:00:01
982000 -- (-776.430) (-772.861) [-773.100] (-772.726) * (-770.461) [-772.255] (-773.581) (-771.291) -- 0:00:01
982500 -- (-772.113) [-776.148] (-774.256) (-771.272) * [-771.144] (-777.109) (-771.141) (-772.931) -- 0:00:01
983000 -- (-774.613) (-773.875) (-772.682) [-773.202] * (-772.800) (-773.638) (-772.634) [-773.068] -- 0:00:01
983500 -- (-772.178) (-775.709) [-772.296] (-772.866) * (-775.157) (-774.447) (-772.690) [-774.185] -- 0:00:01
984000 -- [-772.550] (-772.613) (-772.224) (-773.190) * (-778.500) (-772.124) (-773.622) [-773.999] -- 0:00:01
984500 -- [-770.566] (-771.613) (-769.807) (-773.590) * (-776.171) (-772.529) (-772.871) [-774.180] -- 0:00:01
985000 -- [-778.191] (-773.677) (-772.964) (-771.229) * (-776.830) (-772.240) (-771.888) [-771.728] -- 0:00:00
Average standard deviation of split frequencies: 0.006120
985500 -- (-772.974) (-773.727) (-771.241) [-776.172] * [-774.778] (-772.942) (-777.533) (-772.717) -- 0:00:00
986000 -- [-770.742] (-772.754) (-773.023) (-777.506) * (-773.609) [-771.316] (-776.792) (-775.403) -- 0:00:00
986500 -- [-772.297] (-772.185) (-771.880) (-775.480) * (-776.833) (-775.402) (-776.426) [-770.763] -- 0:00:00
987000 -- [-774.101] (-773.482) (-772.449) (-770.249) * [-773.924] (-773.301) (-779.896) (-772.462) -- 0:00:00
987500 -- (-772.713) (-773.824) (-773.287) [-774.685] * [-773.705] (-775.550) (-772.895) (-771.190) -- 0:00:00
988000 -- [-771.832] (-773.102) (-771.614) (-770.974) * (-774.768) [-774.315] (-772.817) (-771.202) -- 0:00:00
988500 -- (-771.811) [-771.166] (-777.215) (-770.748) * (-773.089) (-772.862) [-774.674] (-772.354) -- 0:00:00
989000 -- [-772.142] (-773.495) (-771.272) (-770.721) * [-774.133] (-772.305) (-773.405) (-773.028) -- 0:00:00
989500 -- [-773.528] (-772.498) (-770.964) (-774.877) * [-775.763] (-776.648) (-774.384) (-772.508) -- 0:00:00
990000 -- (-771.375) (-773.233) (-772.060) [-771.800] * (-774.729) (-772.636) [-771.920] (-773.110) -- 0:00:00
Average standard deviation of split frequencies: 0.006154
990500 -- [-772.380] (-771.665) (-772.240) (-773.659) * (-773.359) (-773.851) (-773.053) [-772.124] -- 0:00:00
991000 -- (-773.637) [-772.113] (-773.370) (-774.517) * (-772.491) (-775.050) (-771.591) [-769.600] -- 0:00:00
991500 -- (-773.107) (-772.544) [-775.454] (-775.377) * (-774.069) (-773.488) [-775.396] (-770.561) -- 0:00:00
992000 -- (-773.079) (-773.716) (-775.157) [-774.349] * (-776.975) (-775.030) (-774.996) [-770.374] -- 0:00:00
992500 -- [-772.156] (-771.361) (-774.433) (-771.571) * [-774.376] (-774.895) (-772.658) (-775.596) -- 0:00:00
993000 -- (-776.467) [-772.374] (-774.102) (-774.197) * (-775.053) (-777.338) [-772.647] (-772.452) -- 0:00:00
993500 -- (-774.038) [-771.693] (-772.372) (-774.984) * (-773.720) [-772.851] (-771.117) (-772.758) -- 0:00:00
994000 -- (-773.375) [-772.741] (-774.962) (-776.751) * (-774.940) [-772.400] (-774.753) (-775.734) -- 0:00:00
994500 -- [-773.155] (-773.636) (-776.576) (-776.830) * (-772.812) [-771.810] (-774.083) (-773.718) -- 0:00:00
995000 -- (-773.244) (-772.627) [-772.347] (-771.261) * [-772.327] (-772.071) (-772.289) (-773.978) -- 0:00:00
Average standard deviation of split frequencies: 0.005743
995500 -- (-775.302) (-772.737) (-776.584) [-773.418] * (-773.033) (-771.458) (-779.894) [-774.641] -- 0:00:00
996000 -- (-775.096) (-773.333) [-772.400] (-772.019) * [-771.628] (-772.755) (-777.418) (-776.289) -- 0:00:00
996500 -- (-771.298) [-774.722] (-770.968) (-772.387) * [-774.027] (-772.815) (-776.432) (-772.770) -- 0:00:00
997000 -- (-773.355) [-774.312] (-773.284) (-771.356) * (-775.163) (-776.922) [-775.165] (-774.173) -- 0:00:00
997500 -- [-771.087] (-772.667) (-776.519) (-779.613) * (-774.157) (-771.151) [-774.003] (-774.857) -- 0:00:00
998000 -- (-775.384) (-770.464) (-775.268) [-772.758] * (-773.877) (-775.620) (-772.371) [-770.888] -- 0:00:00
998500 -- (-777.811) (-773.755) (-772.413) [-772.136] * [-773.511] (-773.073) (-772.853) (-771.381) -- 0:00:00
999000 -- (-772.744) (-774.577) [-770.717] (-771.877) * (-772.434) [-775.525] (-772.552) (-772.836) -- 0:00:00
999500 -- (-774.385) (-776.967) (-770.778) [-774.746] * [-773.243] (-776.310) (-771.214) (-772.478) -- 0:00:00
1000000 -- (-773.803) [-772.240] (-774.004) (-775.012) * (-773.879) (-773.399) (-775.506) [-775.224] -- 0:00:00
Average standard deviation of split frequencies: 0.005622
Analysis completed in 1 mins 6 seconds
Analysis used 65.11 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -768.37
Likelihood of best state for "cold" chain of run 2 was -768.37
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.5 % ( 65 %) Dirichlet(Revmat{all})
98.5 % (100 %) Slider(Revmat{all})
30.0 % ( 27 %) Dirichlet(Pi{all})
31.6 % ( 28 %) Slider(Pi{all})
69.2 % ( 46 %) Multiplier(Alpha{1,2})
78.8 % ( 49 %) Multiplier(Alpha{3})
25.9 % ( 24 %) Slider(Pinvar{all})
97.1 % ( 99 %) ExtSPR(Tau{all},V{all})
69.1 % ( 74 %) ExtTBR(Tau{all},V{all})
98.0 % ( 97 %) NNI(Tau{all},V{all})
87.6 % ( 88 %) ParsSPR(Tau{all},V{all})
28.1 % ( 25 %) Multiplier(V{all})
93.0 % ( 96 %) Nodeslider(V{all})
30.7 % ( 29 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.6 % ( 78 %) Dirichlet(Revmat{all})
98.7 % ( 98 %) Slider(Revmat{all})
30.0 % ( 29 %) Dirichlet(Pi{all})
31.9 % ( 20 %) Slider(Pi{all})
68.9 % ( 41 %) Multiplier(Alpha{1,2})
78.9 % ( 54 %) Multiplier(Alpha{3})
27.2 % ( 26 %) Slider(Pinvar{all})
97.3 % ( 96 %) ExtSPR(Tau{all},V{all})
69.1 % ( 67 %) ExtTBR(Tau{all},V{all})
98.1 % ( 97 %) NNI(Tau{all},V{all})
87.8 % ( 89 %) ParsSPR(Tau{all},V{all})
28.1 % ( 26 %) Multiplier(V{all})
92.9 % ( 94 %) Nodeslider(V{all})
30.5 % ( 16 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166579 0.82 0.66
3 | 166976 166905 0.83
4 | 167082 165787 166671
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166216 0.82 0.66
3 | 167063 166950 0.83
4 | 166577 165569 167625
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -772.14
| 1 2 2 |
| 1 1 |
|1 * 1 * * |
| 1 1 2 2 1 2 1 2 |
|2 211 12 1 1 2 2 1 2 1 |
| 2 11 1 2 1 1 |
| 1 11 22 2 2122 1 * 12 22 2 2 1|
| 2 1 11 2 11 1 12 1 |
| 2 1 2 1 2 2 2 1 2 1* 2 2 |
| 2 2 2 1 |
| 2 2 11 1 12 1 |
| 2 2 22 2 1 1 212 2|
| 22 2 1 |
| 1 1 2 |
| 2 1 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -773.71
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -771.88 -774.91
2 -771.82 -775.09
--------------------------------------
TOTAL -771.85 -775.01
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.871841 0.087314 0.363610 1.491818 0.840720 1358.78 1429.89 1.000
r(A<->C){all} 0.149477 0.018691 0.000033 0.427651 0.106999 236.90 269.80 1.001
r(A<->G){all} 0.171693 0.020970 0.000009 0.454093 0.135379 282.35 288.04 1.007
r(A<->T){all} 0.173728 0.021312 0.000054 0.460789 0.133242 232.78 243.98 1.001
r(C<->G){all} 0.206965 0.024694 0.000029 0.512302 0.175238 239.62 261.25 1.015
r(C<->T){all} 0.149258 0.018095 0.000107 0.427759 0.110361 152.13 240.80 1.000
r(G<->T){all} 0.148879 0.017693 0.000022 0.423379 0.109521 70.98 244.09 1.001
pi(A){all} 0.211490 0.000302 0.178346 0.245948 0.211430 719.56 1026.87 1.000
pi(C){all} 0.295202 0.000357 0.259749 0.334807 0.295052 1290.12 1352.05 1.000
pi(G){all} 0.283839 0.000362 0.248819 0.323340 0.283073 1182.17 1271.97 1.000
pi(T){all} 0.209469 0.000286 0.175039 0.240427 0.209211 1164.01 1197.19 1.000
alpha{1,2} 0.321347 0.148539 0.000220 1.060694 0.204396 1289.74 1383.35 1.000
alpha{3} 0.397009 0.216032 0.000106 1.376974 0.224708 1225.87 1252.46 1.001
pinvar{all} 0.993724 0.000028 0.984290 0.999857 0.995073 1141.79 1151.32 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .***.*
8 -- ...*.*
9 -- .**...
10 -- .****.
11 -- ..*.*.
12 -- .*..*.
13 -- ...**.
14 -- .*...*
15 -- ..*..*
16 -- .**.**
17 -- ..****
18 -- ..**..
19 -- .*.*..
20 -- .*.***
21 -- ....**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 472 0.157229 0.007537 0.151899 0.162558 2
8 472 0.157229 0.012248 0.148568 0.165889 2
9 447 0.148901 0.004240 0.145903 0.151899 2
10 442 0.147235 0.005653 0.143238 0.151233 2
11 435 0.144903 0.003298 0.142572 0.147235 2
12 434 0.144570 0.000000 0.144570 0.144570 2
13 429 0.142905 0.005182 0.139241 0.146569 2
14 427 0.142239 0.010835 0.134577 0.149900 2
15 427 0.142239 0.003298 0.139907 0.144570 2
16 427 0.142239 0.005182 0.138574 0.145903 2
17 423 0.140906 0.002355 0.139241 0.142572 2
18 415 0.138241 0.008951 0.131912 0.144570 2
19 414 0.137908 0.010364 0.130580 0.145237 2
20 413 0.137575 0.000471 0.137242 0.137908 2
21 376 0.125250 0.004711 0.121919 0.128581 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.140006 0.014204 0.000010 0.385219 0.110059 1.000 2
length{all}[2] 0.092087 0.008601 0.000073 0.279666 0.062642 1.000 2
length{all}[3] 0.089764 0.008625 0.000037 0.272291 0.061934 1.000 2
length{all}[4] 0.091610 0.008603 0.000002 0.276115 0.063213 1.000 2
length{all}[5] 0.088647 0.008000 0.000002 0.269362 0.060516 1.000 2
length{all}[6] 0.093241 0.008791 0.000020 0.274156 0.066976 1.000 2
length{all}[7] 0.097517 0.010042 0.000027 0.266132 0.073451 1.005 2
length{all}[8] 0.091211 0.008440 0.000188 0.278779 0.060060 0.998 2
length{all}[9] 0.090335 0.008677 0.000338 0.269006 0.060288 1.002 2
length{all}[10] 0.093261 0.009206 0.000773 0.284160 0.063775 1.004 2
length{all}[11] 0.084576 0.007833 0.000125 0.259775 0.057465 1.000 2
length{all}[12] 0.094266 0.009782 0.000259 0.281908 0.064537 0.998 2
length{all}[13] 0.095716 0.009388 0.000025 0.293553 0.068134 1.000 2
length{all}[14] 0.090947 0.008421 0.000150 0.270058 0.064405 0.998 2
length{all}[15] 0.086587 0.007771 0.000054 0.266549 0.061528 1.001 2
length{all}[16] 0.098691 0.009897 0.000278 0.296736 0.066792 0.998 2
length{all}[17] 0.097192 0.010648 0.000317 0.310223 0.060361 0.998 2
length{all}[18] 0.097121 0.010173 0.000094 0.277420 0.063184 1.001 2
length{all}[19] 0.093983 0.008387 0.000011 0.259820 0.067380 1.002 2
length{all}[20] 0.095109 0.008645 0.000061 0.288861 0.063506 0.999 2
length{all}[21] 0.095625 0.010842 0.000026 0.294969 0.063783 1.004 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005622
Maximum standard deviation of split frequencies = 0.012248
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|----------------------------------------- C2 (2)
|
|----------------------------------------- C3 (3)
+
|----------------------------------------- C4 (4)
|
|---------------------------------------- C5 (5)
|
\-------------------------------------------- C6 (6)
|------------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 552
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 51 patterns at 184 / 184 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 51 patterns at 184 / 184 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
49776 bytes for conP
4488 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.055855 0.082867 0.093445 0.056138 0.096591 0.060602 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -812.367649
Iterating by ming2
Initial: fx= 812.367649
x= 0.05586 0.08287 0.09344 0.05614 0.09659 0.06060 0.30000 1.30000
1 h-m-p 0.0000 0.0003 431.3664 +++ 755.350761 m 0.0003 14 | 1/8
2 h-m-p 0.0000 0.0000 2335.4503 ++ 752.109773 m 0.0000 25 | 2/8
3 h-m-p 0.0000 0.0000 1159.4587 ++ 740.000113 m 0.0000 36 | 3/8
4 h-m-p 0.0000 0.0001 190.9106 ++ 736.125352 m 0.0001 47 | 4/8
5 h-m-p 0.0000 0.0000 514321.2315 ++ 735.549156 m 0.0000 58 | 5/8
6 h-m-p 0.0013 0.5397 0.6121 +++++ 735.296965 m 0.5397 72 | 6/8
7 h-m-p 0.5873 8.0000 0.2476 +CCC 735.225816 2 2.1808 91 | 6/8
8 h-m-p 1.6000 8.0000 0.0948 ++ 735.169421 m 8.0000 104 | 6/8
9 h-m-p 0.9185 8.0000 0.8257 +CCC 735.116512 2 3.6117 122 | 6/8
10 h-m-p 1.6000 8.0000 0.7409 CYC 735.091790 2 1.6994 138 | 6/8
11 h-m-p 1.5360 8.0000 0.8197 ++ 735.065947 m 8.0000 151 | 6/8
12 h-m-p 1.6000 8.0000 2.1716 YCCC 735.057075 3 3.0985 169 | 6/8
13 h-m-p 1.6000 8.0000 2.5779 YC 735.050007 1 3.7546 181 | 6/8
14 h-m-p 1.6000 8.0000 4.4157 YC 735.045555 1 3.5304 193 | 6/8
15 h-m-p 1.6000 8.0000 6.6094 YC 735.042551 1 2.9651 205 | 6/8
16 h-m-p 1.6000 8.0000 9.6368 YC 735.040419 1 3.8205 217 | 6/8
17 h-m-p 1.6000 8.0000 14.6845 YC 735.039101 1 2.7601 229 | 6/8
18 h-m-p 1.6000 8.0000 20.8555 +YC 735.038097 1 4.1418 242 | 6/8
19 h-m-p 1.6000 8.0000 32.7270 YC 735.037518 1 2.5942 254 | 6/8
20 h-m-p 1.6000 8.0000 45.4618 +YC 735.037050 1 4.4787 267 | 6/8
21 h-m-p 1.3193 6.5966 73.0099 YC 735.036797 1 2.4472 279 | 6/8
22 h-m-p 0.6108 3.0542 99.1917 ++ 735.036605 m 3.0542 290 | 7/8
23 h-m-p 1.6000 8.0000 0.0000 Y 735.036601 0 0.9900 301 | 7/8
24 h-m-p 1.6000 8.0000 0.0000 --------------N 735.036601 0 0.0000 327
Out..
lnL = -735.036601
328 lfun, 328 eigenQcodon, 1968 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.072572 0.107499 0.093272 0.025468 0.086138 0.106116 0.000100 0.669082 0.524647
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.813185
np = 9
lnL0 = -819.439413
Iterating by ming2
Initial: fx= 819.439413
x= 0.07257 0.10750 0.09327 0.02547 0.08614 0.10612 0.00011 0.66908 0.52465
1 h-m-p 0.0000 0.0000 422.4639 ++ 819.101843 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0001 963.0954 ++ 794.746838 m 0.0001 26 | 1/9
3 h-m-p 0.0000 0.0000 319.9082 ++ 793.974826 m 0.0000 38 | 2/9
4 h-m-p 0.0000 0.0002 1224.1676 +++ 750.507213 m 0.0002 51 | 3/9
5 h-m-p 0.0001 0.0003 286.1059 ++ 746.091428 m 0.0003 63 | 4/9
6 h-m-p 0.0005 0.0025 88.2964 ++ 745.780137 m 0.0025 75 | 4/9
7 h-m-p 0.0000 0.0000 13.5704
h-m-p: 4.49344506e-19 2.24672253e-18 1.35703941e+01 745.780137
.. | 4/9
8 h-m-p 0.0000 0.0001 201756.6018 --CYCYCCCC 739.722879 7 0.0000 111 | 4/9
9 h-m-p 0.0000 0.0001 256.7332 ++ 736.224855 m 0.0001 123 | 5/9
10 h-m-p 0.0008 0.0554 11.2673 -----------.. | 5/9
11 h-m-p 0.0000 0.0000 183.5955 ++ 735.704669 m 0.0000 156 | 6/9
12 h-m-p 0.0007 0.3307 2.0629 ++CYC 735.687051 2 0.0136 173 | 6/9
13 h-m-p 0.0489 0.2444 0.0944 ++ 735.675481 m 0.2444 185 | 7/9
14 h-m-p 0.0199 0.5993 0.9090 +++ 735.367037 m 0.5993 201 | 8/9
15 h-m-p 1.6000 8.0000 0.0003 YC 735.366084 1 0.9181 216 | 8/9
16 h-m-p 1.6000 8.0000 0.0000 Y 735.366084 0 1.0333 229 | 8/9
17 h-m-p 1.6000 8.0000 0.0000 ----Y 735.366084 0 0.0016 246 | 7/9
18 h-m-p -0.0000 -0.0000 0.0002
h-m-p: -9.25340975e-16 -4.62670487e-15 1.58875918e-04 735.366084
.. | 8/9
19 h-m-p 0.0160 8.0000 0.0062 ----------Y 735.366084 0 0.0000 280 | 8/9
20 h-m-p 0.0160 8.0000 0.0000 Y 735.366084 0 0.0040 293 | 7/9
21 h-m-p 0.0160 8.0000 0.0000 ----------Y 735.366084 0 0.0000 316
Out..
lnL = -735.366084
317 lfun, 951 eigenQcodon, 3804 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.097562 0.101594 0.031080 0.072436 0.033610 0.032440 0.000100 1.172193 0.594472 0.270530 1152.637167
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.078327
np = 11
lnL0 = -761.276375
Iterating by ming2
Initial: fx= 761.276375
x= 0.09756 0.10159 0.03108 0.07244 0.03361 0.03244 0.00011 1.17219 0.59447 0.27053 951.42857
1 h-m-p 0.0000 0.0000 74.0156 ++ 761.260002 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0207 19.8886 +++++ 754.012672 m 0.0207 33 | 2/11
3 h-m-p 0.0000 0.0000 557.2752 ++ 753.836415 m 0.0000 47 | 3/11
4 h-m-p 0.0000 0.0001 161.4265 ++ 753.664412 m 0.0001 61 | 4/11
5 h-m-p 0.0001 0.0010 198.1500 ++ 750.294378 m 0.0010 75 | 5/11
6 h-m-p 0.0000 0.0000 10174.2956 ++ 748.632477 m 0.0000 89 | 6/11
7 h-m-p 0.0011 0.0718 149.4100 ++YCCC 740.382650 3 0.0146 110 | 6/11
8 h-m-p 0.0194 0.0971 2.2706 ++ 740.118400 m 0.0971 124 | 6/11
9 h-m-p 0.4527 8.0000 0.4868 +YCCC 739.982921 3 1.1905 144 | 6/11
10 h-m-p 0.6566 8.0000 0.8827 YCC 739.881264 2 1.1065 166 | 6/11
11 h-m-p 0.7255 8.0000 1.3463 ++ 736.257395 m 8.0000 185 | 6/11
12 h-m-p 0.1846 0.9232 12.9465 ---------------.. | 6/11
13 h-m-p 0.0000 0.0012 27.0911 +++YYCYCYCC 735.306710 7 0.0010 240 | 6/11
14 h-m-p 0.1013 2.2058 0.2677 +YYC 735.293647 2 0.3423 257 | 6/11
15 h-m-p 0.0379 0.6749 2.4197 +++ 735.108049 m 0.6749 277 | 7/11
16 h-m-p 1.6000 8.0000 0.2225 CCCCC 735.068962 4 2.0984 299 | 7/11
17 h-m-p 1.3438 8.0000 0.3475 +YYC 735.043392 2 5.8376 320 | 7/11
18 h-m-p 1.6000 8.0000 0.3735 YCC 735.039496 2 0.9971 341 | 7/11
19 h-m-p 1.5456 8.0000 0.2410 ++ 735.037124 m 8.0000 359 | 7/11
20 h-m-p 1.6000 8.0000 0.3321 C 735.036892 0 1.4358 377 | 7/11
21 h-m-p 1.6000 8.0000 0.2873 +C 735.036695 0 5.7551 396 | 7/11
22 h-m-p 1.6000 8.0000 0.3052 C 735.036652 0 1.5335 414 | 7/11
23 h-m-p 1.5982 8.0000 0.2928 +C 735.036629 0 6.0986 433 | 7/11
24 h-m-p 1.6000 8.0000 0.2908 C 735.036624 0 1.4532 451 | 7/11
25 h-m-p 1.5504 8.0000 0.2725 +C 735.036621 0 6.2014 470 | 7/11
26 h-m-p 1.6000 8.0000 0.3134 C 735.036621 0 1.5425 488 | 7/11
27 h-m-p 1.6000 8.0000 0.2735 +Y 735.036621 0 4.4518 507 | 7/11
28 h-m-p 1.6000 8.0000 0.3803 C 735.036620 0 2.0986 525 | 7/11
29 h-m-p 1.6000 8.0000 0.2816 C 735.036620 0 2.1763 543 | 7/11
30 h-m-p 1.4356 8.0000 0.4270 +C 735.036620 0 5.6838 562 | 7/11
31 h-m-p 1.6000 8.0000 0.1514 Y 735.036620 0 0.8319 580 | 7/11
32 h-m-p 0.4701 8.0000 0.2680 C 735.036620 0 0.3805 598 | 7/11
33 h-m-p 0.2208 8.0000 0.4619 Y 735.036620 0 0.4190 616 | 7/11
34 h-m-p 0.2532 8.0000 0.7643 Y 735.036620 0 0.4121 634 | 7/11
35 h-m-p 0.7845 8.0000 0.4014 Y 735.036620 0 1.8817 652 | 7/11
36 h-m-p 1.0279 8.0000 0.7348 ++ 735.036620 m 8.0000 670 | 7/11
37 h-m-p 1.6000 8.0000 0.4469 ++ 735.036620 m 8.0000 688 | 7/11
38 h-m-p 1.6000 8.0000 1.8669 ---------N 735.036620 0 0.0000 715 | 7/11
39 h-m-p 0.0160 8.0000 1.0030 Y 735.036620 0 0.0040 729 | 7/11
40 h-m-p 1.6000 8.0000 0.0022 +Y 735.036620 0 3.6923 744 | 7/11
41 h-m-p 1.6000 8.0000 0.0036 -------------N 735.036620 0 0.0000 775 | 7/11
42 h-m-p 0.0160 8.0000 0.0001 --------Y 735.036620 0 0.0000 801 | 7/11
43 h-m-p 0.0160 8.0000 0.0101 --------Y 735.036620 0 0.0000 827 | 7/11
44 h-m-p 0.0160 8.0000 0.0000 --------Y 735.036620 0 0.0000 853 | 7/11
45 h-m-p 0.0160 8.0000 0.0060 ------------- | 7/11
46 h-m-p 0.0160 8.0000 0.0060 -------------
Out..
lnL = -735.036620
912 lfun, 3648 eigenQcodon, 16416 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -739.978256 S = -738.539407 -2.367411
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 51 patterns 0:06
did 20 / 51 patterns 0:06
did 30 / 51 patterns 0:06
did 40 / 51 patterns 0:06
did 50 / 51 patterns 0:06
did 51 / 51 patterns 0:06
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.103839 0.062471 0.047457 0.045702 0.086710 0.067683 0.000100 0.351478 1.452410
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 22.145350
np = 9
lnL0 = -805.263298
Iterating by ming2
Initial: fx= 805.263298
x= 0.10384 0.06247 0.04746 0.04570 0.08671 0.06768 0.00011 0.35148 1.45241
1 h-m-p 0.0000 0.0000 408.2454 ++ 805.021574 m 0.0000 23 | 1/9
2 h-m-p 0.0000 0.0020 60.6082 +++CYYYYCCCCC 800.846183 9 0.0017 62 | 1/9
3 h-m-p 0.0042 0.0608 24.6263 ------------.. | 1/9
4 h-m-p 0.0000 0.0001 390.0176 ++ 787.080919 m 0.0001 112 | 1/9
5 h-m-p 0.0000 0.0000 5649.5370
h-m-p: 1.68258161e-19 8.41290805e-19 5.64953695e+03 787.080919
.. | 1/9
6 h-m-p 0.0000 0.0002 105652.5011 --YCYYCYCYC 780.827279 8 0.0000 162 | 1/9
7 h-m-p 0.0000 0.0002 388.5131 ++ 751.855171 m 0.0002 182 | 2/9
8 h-m-p 0.0040 0.1177 16.3918 ------------.. | 2/9
9 h-m-p 0.0000 0.0000 362.1433 ++ 750.520897 m 0.0000 231 | 3/9
10 h-m-p 0.0000 0.0000 2624.8524 +YYYYYCCCCC 747.576276 9 0.0000 264 | 3/9
11 h-m-p 0.0008 0.1812 16.4133 -----------.. | 3/9
12 h-m-p 0.0000 0.0000 892.1779 YYCCCC 745.746696 5 0.0000 317 | 3/9
13 h-m-p 0.0000 0.0000 361.2159 ++ 742.720967 m 0.0000 335 | 4/9
14 h-m-p 0.0005 0.2385 16.1743 -----------.. | 4/9
15 h-m-p 0.0000 0.0000 285.2368 ++ 740.288274 m 0.0000 379 | 5/9
16 h-m-p 0.0000 0.0000 739.8317 ++ 736.439408 m 0.0000 396 | 6/9
17 h-m-p 0.0111 0.8651 0.1007 ++YCYCCC 736.045184 5 0.4646 422 | 6/9
18 h-m-p 0.0307 3.6776 1.5236 ++YYCCC 735.641729 4 0.7506 445 | 6/9
19 h-m-p 0.5429 2.7143 0.2353 CYCCC 735.515222 4 0.9974 467 | 6/9
20 h-m-p 1.0103 5.0513 0.2207 +
QuantileBeta(0.85, 2.27054, 0.00500) = 1.000000e+00 2000 rounds
+ 735.366089 m 5.0513 482
QuantileBeta(0.85, 2.27054, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.27054, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.27054, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.27054, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.27054, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.27054, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.27054, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.27054, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.27066, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.27041, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
21 h-m-p 1.6000 8.0000 0.0008
QuantileBeta(0.85, 2.27181, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.27565, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.27119, 0.00500) = 1.000000e+00 2000 rounds
Y 735.366082 0 0.8148 497
QuantileBeta(0.85, 2.27119, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.27119, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.27119, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.27119, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.27119, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.27119, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.27119, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.27119, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.27131, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.27106, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.27119, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
22 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 2.27118, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.27119, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.27119, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.27119, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.27119, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.27119, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.27119, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.27119, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.27119, 0.00500) = 1.000000e+00 2000 rounds
N 735.366082 0 0.0001 517
QuantileBeta(0.85, 2.27119, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -735.366082
518 lfun, 5698 eigenQcodon, 31080 P(t)
QuantileBeta(0.85, 2.27119, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.27119, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:13
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.062290 0.099695 0.080799 0.054483 0.081550 0.094775 0.000100 0.900000 0.675676 1.441755 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.129436
np = 11
lnL0 = -755.261676
Iterating by ming2
Initial: fx= 755.261676
x= 0.06229 0.09970 0.08080 0.05448 0.08155 0.09478 0.00011 0.90000 0.67568 1.44176 951.42857
1 h-m-p 0.0000 0.0000 145.9066 ++ 755.135195 m 0.0000 27 | 1/11
2 h-m-p 0.0000 0.0001 1313.5847 +YCYYYYYYCC 741.397848 10 0.0001 66 | 1/11
3 h-m-p 0.0023 0.0113 17.1398 ++ 740.276710 m 0.0113 90 | 2/11
4 h-m-p 0.0017 0.0084 6.1452 ++ 739.166659 m 0.0084 114 | 3/11
5 h-m-p 0.0000 0.0000 100.3375 ++ 739.138920 m 0.0000 137 | 4/11
6 h-m-p 0.0007 0.0144 1.8364 +++ 739.019334 m 0.0144 160 | 5/11
7 h-m-p 0.0009 0.0045 6.7720 ++ 738.453929 m 0.0045 181 | 6/11
8 h-m-p 0.0014 0.1848 2.3586 +++YCYCYCYYCY 735.188374 10 0.1800 218 | 6/11
9 h-m-p 0.0542 0.2712 4.0279 --------------.. | 6/11
10 h-m-p 0.0000 0.0005 15.5313 +CCC 735.179375 2 0.0001 273 | 6/11
11 h-m-p 0.0002 0.0894 10.9832 ++YYYC 735.094942 3 0.0033 297 | 6/11
12 h-m-p 1.2729 6.3646 0.0045 YYCC 735.077794 3 1.1078 320 | 6/11
13 h-m-p 1.1357 8.0000 0.0043 ++ 735.061477 m 8.0000 339 | 6/11
14 h-m-p 1.5190 8.0000 0.0229 ++ 735.044110 m 8.0000 358 | 6/11
15 h-m-p 1.6000 8.0000 0.0249 YC 735.042667 1 0.9911 378 | 6/11
16 h-m-p 0.9520 8.0000 0.0259 ++ 735.039171 m 8.0000 397 | 6/11
17 h-m-p 0.9063 4.5314 0.1081 ++ 735.037053 m 4.5314 416 | 7/11
18 h-m-p 1.4297 8.0000 0.0081 YC 735.036620 1 1.0447 436 | 7/11
19 h-m-p 1.6000 8.0000 0.0000 C 735.036620 0 1.4489 454 | 7/11
20 h-m-p 1.6000 8.0000 0.0000 --Y 735.036620 0 0.0250 474
Out..
lnL = -735.036620
475 lfun, 5700 eigenQcodon, 31350 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -739.717098 S = -738.539347 -1.981225
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 51 patterns 0:22
did 20 / 51 patterns 0:22
did 30 / 51 patterns 0:22
did 40 / 51 patterns 0:22
did 50 / 51 patterns 0:23
did 51 / 51 patterns 0:23
Time used: 0:23
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=184
NC_011896_1_WP_012634450_1_2780_MLBR_RS13230 VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
NC_002677_1_NP_302665_1_1537_ML2598 VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
NZ_LVXE01000045_1_WP_010908984_1_1929_A3216_RS10880 VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
NZ_LYPH01000051_1_WP_010908984_1_1946_A8144_RS09300 VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
NZ_CP029543_1_WP_010908984_1_2809_DIJ64_RS14300 VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
NZ_AP014567_1_WP_010908984_1_2877_JK2ML_RS14640 VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT
**************************************************
NC_011896_1_WP_012634450_1_2780_MLBR_RS13230 VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYVSGDFGAQYRKFVD
NC_002677_1_NP_302665_1_1537_ML2598 VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD
NZ_LVXE01000045_1_WP_010908984_1_1929_A3216_RS10880 VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD
NZ_LYPH01000051_1_WP_010908984_1_1946_A8144_RS09300 VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD
NZ_CP029543_1_WP_010908984_1_2809_DIJ64_RS14300 VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD
NZ_AP014567_1_WP_010908984_1_2877_JK2ML_RS14640 VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD
************************************:*************
NC_011896_1_WP_012634450_1_2780_MLBR_RS13230 AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
NC_002677_1_NP_302665_1_1537_ML2598 AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
NZ_LVXE01000045_1_WP_010908984_1_1929_A3216_RS10880 AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
NZ_LYPH01000051_1_WP_010908984_1_1946_A8144_RS09300 AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
NZ_CP029543_1_WP_010908984_1_2809_DIJ64_RS14300 AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
NZ_AP014567_1_WP_010908984_1_2877_JK2ML_RS14640 AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA
**************************************************
NC_011896_1_WP_012634450_1_2780_MLBR_RS13230 LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
NC_002677_1_NP_302665_1_1537_ML2598 LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
NZ_LVXE01000045_1_WP_010908984_1_1929_A3216_RS10880 LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
NZ_LYPH01000051_1_WP_010908984_1_1946_A8144_RS09300 LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
NZ_CP029543_1_WP_010908984_1_2809_DIJ64_RS14300 LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
NZ_AP014567_1_WP_010908984_1_2877_JK2ML_RS14640 LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
**********************************
>NC_011896_1_WP_012634450_1_2780_MLBR_RS13230 GTGGCAGCCGCTGAAGGCGGTGGTTCCTGGAGGAATCGACGAGCCGGTCA GAGGACGGCTATCGCCGTCGTGGTTGCCGCGGTGCTATTCGTTGGTTCCG CAGCGTTTGCGGGCGCGGCCGTGCAGCCCTACCTGGCTGATCGCGCTACC GTCGCAGTCAAGCTCGAAGTGGCGCGGACAGCGGCTAACGCGATCACGGT TCTGTGGACTTATACCCCGGAGAACATGGACACTCTAGCTGACCGTGCGG CGACCTACGTCAGCGGCGATTTTGGGGCCCAGTACCGCAAATTCGTCGAT GCTATCGTCGGCCCCAACAAACAGGCCAAGATAACCAACAGCACTGAAGT CACTGGCGTGGCAGTCGAATCGCTGGATGCTTCGAATGCCATCGCTATTG TGTATACCAACACCACATCCACCAGCCCGCTGACCAAAAACATTCCGGCA CTTAAATATCTGTCCTACCGGTTGTTTATGAAACGTAGTGCTGTCCGCTG GTTGGTGACCAGAATGACGACCATCACTTCACTGGATTTGACGCCGCAGC TA >NC_002677_1_NP_302665_1_1537_ML2598 GTGGCAGCCGCTGAAGGCGGTGGTTCCTGGAGGAATCGACGAGCCGGTCA GAGGACGGCTATCGCCGTCGTGGTTGCCGCGGTGCTATTCGTTGGTTCCG CAGCGTTTGCGGGCGCGGCCGTGCAGCCCTACCTGGCTGATCGCGCTACC GTCGCAGTCAAGCTCGAAGTGGCGCGGACAGCGGCTAACGCGATCACGGT TCTGTGGACTTATACCCCGGAGAACATGGACACTCTAGCTGACCGTGCGG CGACCTACCTCAGCGGCGATTTTGGGGCCCAGTACCGCAAATTCGTCGAT GCTATCGTCGGCCCCAACAAACAGGCCAAGATAACCAACAGCACTGAAGT CACTGGCGTGGCAGTCGAATCGCTGGATGCTTCGAATGCCATCGCTATTG TGTATACCAACACCACATCCACCAGCCCGCTGACCAAAAACATTCCGGCA CTTAAATATCTGTCCTACCGGTTGTTTATGAAACGTAGTGCTGTCCGCTG GTTGGTGACCAGAATGACGACCATCACTTCACTGGATTTGACGCCGCAGC TA >NZ_LVXE01000045_1_WP_010908984_1_1929_A3216_RS10880 GTGGCAGCCGCTGAAGGCGGTGGTTCCTGGAGGAATCGACGAGCCGGTCA GAGGACGGCTATCGCCGTCGTGGTTGCCGCGGTGCTATTCGTTGGTTCCG CAGCGTTTGCGGGCGCGGCCGTGCAGCCCTACCTGGCTGATCGCGCTACC GTCGCAGTCAAGCTCGAAGTGGCGCGGACAGCGGCTAACGCGATCACGGT TCTGTGGACTTATACCCCGGAGAACATGGACACTCTAGCTGACCGTGCGG CGACCTACCTCAGCGGCGATTTTGGGGCCCAGTACCGCAAATTCGTCGAT GCTATCGTCGGCCCCAACAAACAGGCCAAGATAACCAACAGCACTGAAGT CACTGGCGTGGCAGTCGAATCGCTGGATGCTTCGAATGCCATCGCTATTG TGTATACCAACACCACATCCACCAGCCCGCTGACCAAAAACATTCCGGCA CTTAAATATCTGTCCTACCGGTTGTTTATGAAACGTAGTGCTGTCCGCTG GTTGGTGACCAGAATGACGACCATCACTTCACTGGATTTGACGCCGCAGC TA >NZ_LYPH01000051_1_WP_010908984_1_1946_A8144_RS09300 GTGGCAGCCGCTGAAGGCGGTGGTTCCTGGAGGAATCGACGAGCCGGTCA GAGGACGGCTATCGCCGTCGTGGTTGCCGCGGTGCTATTCGTTGGTTCCG CAGCGTTTGCGGGCGCGGCCGTGCAGCCCTACCTGGCTGATCGCGCTACC GTCGCAGTCAAGCTCGAAGTGGCGCGGACAGCGGCTAACGCGATCACGGT TCTGTGGACTTATACCCCGGAGAACATGGACACTCTAGCTGACCGTGCGG CGACCTACCTCAGCGGCGATTTTGGGGCCCAGTACCGCAAATTCGTCGAT GCTATCGTCGGCCCCAACAAACAGGCCAAGATAACCAACAGCACTGAAGT CACTGGCGTGGCAGTCGAATCGCTGGATGCTTCGAATGCCATCGCTATTG TGTATACCAACACCACATCCACCAGCCCGCTGACCAAAAACATTCCGGCA CTTAAATATCTGTCCTACCGGTTGTTTATGAAACGTAGTGCTGTCCGCTG GTTGGTGACCAGAATGACGACCATCACTTCACTGGATTTGACGCCGCAGC TA >NZ_CP029543_1_WP_010908984_1_2809_DIJ64_RS14300 GTGGCAGCCGCTGAAGGCGGTGGTTCCTGGAGGAATCGACGAGCCGGTCA GAGGACGGCTATCGCCGTCGTGGTTGCCGCGGTGCTATTCGTTGGTTCCG CAGCGTTTGCGGGCGCGGCCGTGCAGCCCTACCTGGCTGATCGCGCTACC GTCGCAGTCAAGCTCGAAGTGGCGCGGACAGCGGCTAACGCGATCACGGT TCTGTGGACTTATACCCCGGAGAACATGGACACTCTAGCTGACCGTGCGG CGACCTACCTCAGCGGCGATTTTGGGGCCCAGTACCGCAAATTCGTCGAT GCTATCGTCGGCCCCAACAAACAGGCCAAGATAACCAACAGCACTGAAGT CACTGGCGTGGCAGTCGAATCGCTGGATGCTTCGAATGCCATCGCTATTG TGTATACCAACACCACATCCACCAGCCCGCTGACCAAAAACATTCCGGCA CTTAAATATCTGTCCTACCGGTTGTTTATGAAACGTAGTGCTGTCCGCTG GTTGGTGACCAGAATGACGACCATCACTTCACTGGATTTGACGCCGCAGC TA >NZ_AP014567_1_WP_010908984_1_2877_JK2ML_RS14640 GTGGCAGCCGCTGAAGGCGGTGGTTCCTGGAGGAATCGACGAGCCGGTCA GAGGACGGCTATCGCCGTCGTGGTTGCCGCGGTGCTATTCGTTGGTTCCG CAGCGTTTGCGGGCGCGGCCGTGCAGCCCTACCTGGCTGATCGCGCTACC GTCGCAGTCAAGCTCGAAGTGGCGCGGACAGCGGCTAACGCGATCACGGT TCTGTGGACTTATACCCCGGAGAACATGGACACTCTAGCTGACCGTGCGG CGACCTACCTCAGCGGCGATTTTGGGGCCCAGTACCGCAAATTCGTCGAT GCTATCGTCGGCCCCAACAAACAGGCCAAGATAACCAACAGCACTGAAGT CACTGGCGTGGCAGTCGAATCGCTGGATGCTTCGAATGCCATCGCTATTG TGTATACCAACACCACATCCACCAGCCCGCTGACCAAAAACATTCCGGCA CTTAAATATCTGTCCTACCGGTTGTTTATGAAACGTAGTGCTGTCCGCTG GTTGGTGACCAGAATGACGACCATCACTTCACTGGATTTGACGCCGCAGC TA
>NC_011896_1_WP_012634450_1_2780_MLBR_RS13230 VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYVSGDFGAQYRKFVD AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL >NC_002677_1_NP_302665_1_1537_ML2598 VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL >NZ_LVXE01000045_1_WP_010908984_1_1929_A3216_RS10880 VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL >NZ_LYPH01000051_1_WP_010908984_1_1946_A8144_RS09300 VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL >NZ_CP029543_1_WP_010908984_1_2809_DIJ64_RS14300 VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL >NZ_AP014567_1_WP_010908984_1_2877_JK2ML_RS14640 VAAAEGGGSWRNRRAGQRTAIAVVVAAVLFVGSAAFAGAAVQPYLADRAT VAVKLEVARTAANAITVLWTYTPENMDTLADRAATYLSGDFGAQYRKFVD AIVGPNKQAKITNSTEVTGVAVESLDASNAIAIVYTNTTSTSPLTKNIPA LKYLSYRLFMKRSAVRWLVTRMTTITSLDLTPQL
#NEXUS
[ID: 5979260411]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_012634450_1_2780_MLBR_RS13230
NC_002677_1_NP_302665_1_1537_ML2598
NZ_LVXE01000045_1_WP_010908984_1_1929_A3216_RS10880
NZ_LYPH01000051_1_WP_010908984_1_1946_A8144_RS09300
NZ_CP029543_1_WP_010908984_1_2809_DIJ64_RS14300
NZ_AP014567_1_WP_010908984_1_2877_JK2ML_RS14640
;
end;
begin trees;
translate
1 NC_011896_1_WP_012634450_1_2780_MLBR_RS13230,
2 NC_002677_1_NP_302665_1_1537_ML2598,
3 NZ_LVXE01000045_1_WP_010908984_1_1929_A3216_RS10880,
4 NZ_LYPH01000051_1_WP_010908984_1_1946_A8144_RS09300,
5 NZ_CP029543_1_WP_010908984_1_2809_DIJ64_RS14300,
6 NZ_AP014567_1_WP_010908984_1_2877_JK2ML_RS14640
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.1100592,2:0.06264209,3:0.06193396,4:0.0632131,5:0.06051631,6:0.06697553);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.1100592,2:0.06264209,3:0.06193396,4:0.0632131,5:0.06051631,6:0.06697553);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -771.88 -774.91
2 -771.82 -775.09
--------------------------------------
TOTAL -771.85 -775.01
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2598/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.871841 0.087314 0.363610 1.491818 0.840720 1358.78 1429.89 1.000
r(A<->C){all} 0.149477 0.018691 0.000033 0.427651 0.106999 236.90 269.80 1.001
r(A<->G){all} 0.171693 0.020970 0.000009 0.454093 0.135379 282.35 288.04 1.007
r(A<->T){all} 0.173728 0.021312 0.000054 0.460789 0.133242 232.78 243.98 1.001
r(C<->G){all} 0.206965 0.024694 0.000029 0.512302 0.175238 239.62 261.25 1.015
r(C<->T){all} 0.149258 0.018095 0.000107 0.427759 0.110361 152.13 240.80 1.000
r(G<->T){all} 0.148879 0.017693 0.000022 0.423379 0.109521 70.98 244.09 1.001
pi(A){all} 0.211490 0.000302 0.178346 0.245948 0.211430 719.56 1026.87 1.000
pi(C){all} 0.295202 0.000357 0.259749 0.334807 0.295052 1290.12 1352.05 1.000
pi(G){all} 0.283839 0.000362 0.248819 0.323340 0.283073 1182.17 1271.97 1.000
pi(T){all} 0.209469 0.000286 0.175039 0.240427 0.209211 1164.01 1197.19 1.000
alpha{1,2} 0.321347 0.148539 0.000220 1.060694 0.204396 1289.74 1383.35 1.000
alpha{3} 0.397009 0.216032 0.000106 1.376974 0.224708 1225.87 1252.46 1.001
pinvar{all} 0.993724 0.000028 0.984290 0.999857 0.995073 1141.79 1151.32 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2598/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 184
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 4 4 4 4 4 4 | TAC 4 4 4 4 4 4 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 2 2 2 2 2 2
CTC 1 2 2 2 2 2 | CCC 2 2 2 2 2 2 | CAC 0 0 0 0 0 0 | CGC 3 3 3 3 3 3
CTA 3 3 3 3 3 3 | CCA 0 0 0 0 0 0 | Gln CAA 0 0 0 0 0 0 | CGA 2 2 2 2 2 2
CTG 6 6 6 6 6 6 | CCG 4 4 4 4 4 4 | CAG 5 5 5 5 5 5 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 5 5 5 5 5 5 | Asn AAT 2 2 2 2 2 2 | Ser AGT 1 1 1 1 1 1
ATC 5 5 5 5 5 5 | ACC 10 10 10 10 10 10 | AAC 6 6 6 6 6 6 | AGC 3 3 3 3 3 3
ATA 1 1 1 1 1 1 | ACA 2 2 2 2 2 2 | Lys AAA 5 5 5 5 5 5 | Arg AGA 1 1 1 1 1 1
Met ATG 3 3 3 3 3 3 | ACG 4 4 4 4 4 4 | AAG 2 2 2 2 2 2 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 10 10 10 10 10 10 | Asp GAT 5 5 5 5 5 5 | Gly GGT 4 4 4 4 4 4
GTC 9 8 8 8 8 8 | GCC 8 8 8 8 8 8 | GAC 2 2 2 2 2 2 | GGC 5 5 5 5 5 5
GTA 0 0 0 0 0 0 | GCA 5 5 5 5 5 5 | Glu GAA 4 4 4 4 4 4 | GGA 0 0 0 0 0 0
GTG 8 8 8 8 8 8 | GCG 9 9 9 9 9 9 | GAG 1 1 1 1 1 1 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_012634450_1_2780_MLBR_RS13230
position 1: T:0.13587 C:0.16848 A:0.29348 G:0.40217
position 2: T:0.27174 C:0.35870 A:0.21196 G:0.15761
position 3: T:0.22283 C:0.34783 A:0.13043 G:0.29891
Average T:0.21014 C:0.29167 A:0.21196 G:0.28623
#2: NC_002677_1_NP_302665_1_1537_ML2598
position 1: T:0.13587 C:0.17391 A:0.29348 G:0.39674
position 2: T:0.27174 C:0.35870 A:0.21196 G:0.15761
position 3: T:0.22283 C:0.34783 A:0.13043 G:0.29891
Average T:0.21014 C:0.29348 A:0.21196 G:0.28442
#3: NZ_LVXE01000045_1_WP_010908984_1_1929_A3216_RS10880
position 1: T:0.13587 C:0.17391 A:0.29348 G:0.39674
position 2: T:0.27174 C:0.35870 A:0.21196 G:0.15761
position 3: T:0.22283 C:0.34783 A:0.13043 G:0.29891
Average T:0.21014 C:0.29348 A:0.21196 G:0.28442
#4: NZ_LYPH01000051_1_WP_010908984_1_1946_A8144_RS09300
position 1: T:0.13587 C:0.17391 A:0.29348 G:0.39674
position 2: T:0.27174 C:0.35870 A:0.21196 G:0.15761
position 3: T:0.22283 C:0.34783 A:0.13043 G:0.29891
Average T:0.21014 C:0.29348 A:0.21196 G:0.28442
#5: NZ_CP029543_1_WP_010908984_1_2809_DIJ64_RS14300
position 1: T:0.13587 C:0.17391 A:0.29348 G:0.39674
position 2: T:0.27174 C:0.35870 A:0.21196 G:0.15761
position 3: T:0.22283 C:0.34783 A:0.13043 G:0.29891
Average T:0.21014 C:0.29348 A:0.21196 G:0.28442
#6: NZ_AP014567_1_WP_010908984_1_2877_JK2ML_RS14640
position 1: T:0.13587 C:0.17391 A:0.29348 G:0.39674
position 2: T:0.27174 C:0.35870 A:0.21196 G:0.15761
position 3: T:0.22283 C:0.34783 A:0.13043 G:0.29891
Average T:0.21014 C:0.29348 A:0.21196 G:0.28442
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 18 | Ser S TCT 0 | Tyr Y TAT 18 | Cys C TGT 0
TTC 12 | TCC 24 | TAC 24 | TGC 0
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 12 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 0 | Arg R CGT 12
CTC 11 | CCC 12 | CAC 0 | CGC 18
CTA 18 | CCA 0 | Gln Q CAA 0 | CGA 12
CTG 36 | CCG 24 | CAG 30 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 30 | Asn N AAT 12 | Ser S AGT 6
ATC 30 | ACC 60 | AAC 36 | AGC 18
ATA 6 | ACA 12 | Lys K AAA 30 | Arg R AGA 6
Met M ATG 18 | ACG 24 | AAG 12 | AGG 12
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 60 | Asp D GAT 30 | Gly G GGT 24
GTC 49 | GCC 48 | GAC 12 | GGC 30
GTA 0 | GCA 30 | Glu E GAA 24 | GGA 0
GTG 48 | GCG 54 | GAG 6 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13587 C:0.17301 A:0.29348 G:0.39764
position 2: T:0.27174 C:0.35870 A:0.21196 G:0.15761
position 3: T:0.22283 C:0.34783 A:0.13043 G:0.29891
Average T:0.21014 C:0.29318 A:0.21196 G:0.28472
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 8): -735.036601 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.005609 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.005629
(1: 0.005609, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634450_1_2780_MLBR_RS13230: 0.005609, NC_002677_1_NP_302665_1_1537_ML2598: 0.000004, NZ_LVXE01000045_1_WP_010908984_1_1929_A3216_RS10880: 0.000004, NZ_LYPH01000051_1_WP_010908984_1_1946_A8144_RS09300: 0.000004, NZ_CP029543_1_WP_010908984_1_2809_DIJ64_RS14300: 0.000004, NZ_AP014567_1_WP_010908984_1_2877_JK2ML_RS14640: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.006 403.6 148.4 999.0000 0.0026 0.0000 1.0 0.0
7..2 0.000 403.6 148.4 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 403.6 148.4 999.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 403.6 148.4 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 403.6 148.4 999.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 403.6 148.4 999.0000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0026
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -735.366084 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.005515 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.005535
(1: 0.005515, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634450_1_2780_MLBR_RS13230: 0.005515, NC_002677_1_NP_302665_1_1537_ML2598: 0.000004, NZ_LVXE01000045_1_WP_010908984_1_1929_A3216_RS10880: 0.000004, NZ_LYPH01000051_1_WP_010908984_1_1946_A8144_RS09300: 0.000004, NZ_CP029543_1_WP_010908984_1_2809_DIJ64_RS14300: 0.000004, NZ_AP014567_1_WP_010908984_1_2877_JK2ML_RS14640: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.006 403.6 148.4 1.0000 0.0018 0.0018 0.7 0.3
7..2 0.000 403.6 148.4 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 403.6 148.4 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 403.6 148.4 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 403.6 148.4 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 403.6 148.4 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
check convergence..
lnL(ntime: 6 np: 11): -735.036620 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.005609 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000000 0.000029 1.000000 951.503525
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.005629
(1: 0.005609, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634450_1_2780_MLBR_RS13230: 0.005609, NC_002677_1_NP_302665_1_1537_ML2598: 0.000004, NZ_LVXE01000045_1_WP_010908984_1_1929_A3216_RS10880: 0.000004, NZ_LYPH01000051_1_WP_010908984_1_1946_A8144_RS09300: 0.000004, NZ_CP029543_1_WP_010908984_1_2809_DIJ64_RS14300: 0.000004, NZ_AP014567_1_WP_010908984_1_2877_JK2ML_RS14640: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00003 0.99997
w: 1.00000 1.00000 951.50352
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.006 403.6 148.4 951.4755 0.0026 0.0000 1.0 0.0
7..2 0.000 403.6 148.4 951.4755 0.0000 0.0000 0.0 0.0
7..3 0.000 403.6 148.4 951.4755 0.0000 0.0000 0.0 0.0
7..4 0.000 403.6 148.4 951.4755 0.0000 0.0000 0.0 0.0
7..5 0.000 403.6 148.4 951.4755 0.0000 0.0000 0.0 0.0
7..6 0.000 403.6 148.4 951.4755 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634450_1_2780_MLBR_RS13230)
Pr(w>1) post mean +- SE for w
1 V 1.000** 951.475
2 A 1.000** 951.475
3 A 1.000** 951.475
4 A 1.000** 951.475
5 E 1.000** 951.475
6 G 1.000** 951.475
7 G 1.000** 951.475
8 G 1.000** 951.475
9 S 1.000** 951.475
10 W 1.000** 951.475
11 R 1.000** 951.475
12 N 1.000** 951.475
13 R 1.000** 951.475
14 R 1.000** 951.475
15 A 1.000** 951.475
16 G 1.000** 951.475
17 Q 1.000** 951.475
18 R 1.000** 951.475
19 T 1.000** 951.475
20 A 1.000** 951.475
21 I 1.000** 951.475
22 A 1.000** 951.475
23 V 1.000** 951.475
24 V 1.000** 951.475
25 V 1.000** 951.475
26 A 1.000** 951.475
27 A 1.000** 951.475
28 V 1.000** 951.475
29 L 1.000** 951.475
30 F 1.000** 951.475
31 V 1.000** 951.475
32 G 1.000** 951.475
33 S 1.000** 951.475
34 A 1.000** 951.475
35 A 1.000** 951.475
36 F 1.000** 951.475
37 A 1.000** 951.475
38 G 1.000** 951.475
39 A 1.000** 951.475
40 A 1.000** 951.475
41 V 1.000** 951.475
42 Q 1.000** 951.475
43 P 1.000** 951.475
44 Y 1.000** 951.475
45 L 1.000** 951.475
46 A 1.000** 951.475
47 D 1.000** 951.475
48 R 1.000** 951.475
49 A 1.000** 951.475
50 T 1.000** 951.475
51 V 1.000** 951.475
52 A 1.000** 951.475
53 V 1.000** 951.475
54 K 1.000** 951.475
55 L 1.000** 951.475
56 E 1.000** 951.475
57 V 1.000** 951.475
58 A 1.000** 951.475
59 R 1.000** 951.475
60 T 1.000** 951.475
61 A 1.000** 951.475
62 A 1.000** 951.475
63 N 1.000** 951.475
64 A 1.000** 951.475
65 I 1.000** 951.475
66 T 1.000** 951.475
67 V 1.000** 951.475
68 L 1.000** 951.475
69 W 1.000** 951.475
70 T 1.000** 951.475
71 Y 1.000** 951.475
72 T 1.000** 951.475
73 P 1.000** 951.475
74 E 1.000** 951.475
75 N 1.000** 951.475
76 M 1.000** 951.475
77 D 1.000** 951.475
78 T 1.000** 951.475
79 L 1.000** 951.475
80 A 1.000** 951.475
81 D 1.000** 951.475
82 R 1.000** 951.475
83 A 1.000** 951.475
84 A 1.000** 951.475
85 T 1.000** 951.475
86 Y 1.000** 951.475
87 V 1.000** 951.503
88 S 1.000** 951.475
89 G 1.000** 951.475
90 D 1.000** 951.475
91 F 1.000** 951.475
92 G 1.000** 951.475
93 A 1.000** 951.475
94 Q 1.000** 951.475
95 Y 1.000** 951.475
96 R 1.000** 951.475
97 K 1.000** 951.475
98 F 1.000** 951.475
99 V 1.000** 951.475
100 D 1.000** 951.475
101 A 1.000** 951.475
102 I 1.000** 951.475
103 V 1.000** 951.475
104 G 1.000** 951.475
105 P 1.000** 951.475
106 N 1.000** 951.475
107 K 1.000** 951.475
108 Q 1.000** 951.475
109 A 1.000** 951.475
110 K 1.000** 951.475
111 I 1.000** 951.475
112 T 1.000** 951.475
113 N 1.000** 951.475
114 S 1.000** 951.475
115 T 1.000** 951.475
116 E 1.000** 951.475
117 V 1.000** 951.475
118 T 1.000** 951.475
119 G 1.000** 951.475
120 V 1.000** 951.475
121 A 1.000** 951.475
122 V 1.000** 951.475
123 E 1.000** 951.475
124 S 1.000** 951.475
125 L 1.000** 951.475
126 D 1.000** 951.475
127 A 1.000** 951.475
128 S 1.000** 951.475
129 N 1.000** 951.475
130 A 1.000** 951.475
131 I 1.000** 951.475
132 A 1.000** 951.475
133 I 1.000** 951.475
134 V 1.000** 951.475
135 Y 1.000** 951.475
136 T 1.000** 951.475
137 N 1.000** 951.475
138 T 1.000** 951.475
139 T 1.000** 951.475
140 S 1.000** 951.475
141 T 1.000** 951.475
142 S 1.000** 951.475
143 P 1.000** 951.475
144 L 1.000** 951.475
145 T 1.000** 951.475
146 K 1.000** 951.475
147 N 1.000** 951.475
148 I 1.000** 951.475
149 P 1.000** 951.475
150 A 1.000** 951.475
151 L 1.000** 951.475
152 K 1.000** 951.475
153 Y 1.000** 951.475
154 L 1.000** 951.475
155 S 1.000** 951.475
156 Y 1.000** 951.475
157 R 1.000** 951.475
158 L 1.000** 951.475
159 F 1.000** 951.475
160 M 1.000** 951.475
161 K 1.000** 951.475
162 R 1.000** 951.475
163 S 1.000** 951.475
164 A 1.000** 951.475
165 V 1.000** 951.475
166 R 1.000** 951.475
167 W 1.000** 951.475
168 L 1.000** 951.475
169 V 1.000** 951.475
170 T 1.000** 951.475
171 R 1.000** 951.475
172 M 1.000** 951.475
173 T 1.000** 951.475
174 T 1.000** 951.475
175 I 1.000** 951.475
176 T 1.000** 951.475
177 S 1.000** 951.475
178 L 1.000** 951.475
179 D 1.000** 951.475
180 L 1.000** 951.475
181 T 1.000** 951.475
182 P 1.000** 951.475
183 Q 1.000** 951.475
184 L 1.000** 951.475
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634450_1_2780_MLBR_RS13230)
Pr(w>1) post mean +- SE for w
87 V 0.800 6.073 +- 3.440
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.094 0.095 0.097 0.098 0.099 0.101 0.102 0.103 0.105 0.106
w2: 0.040 0.053 0.067 0.080 0.093 0.107 0.120 0.133 0.146 0.160
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.005
0.007 0.005 0.004
0.009 0.007 0.006 0.005 0.004
0.011 0.009 0.008 0.007 0.006 0.005 0.004
0.013 0.011 0.010 0.009 0.008 0.007 0.006 0.005 0.004
0.015 0.013 0.012 0.011 0.010 0.009 0.008 0.007 0.006 0.004 0.004
0.017 0.015 0.014 0.013 0.012 0.011 0.010 0.009 0.008 0.006 0.006 0.004 0.003
0.019 0.017 0.016 0.015 0.014 0.013 0.012 0.011 0.010 0.008 0.008 0.006 0.005 0.004 0.003
0.021 0.019 0.018 0.017 0.016 0.015 0.014 0.013 0.012 0.010 0.010 0.008 0.007 0.006 0.005 0.004 0.003
0.023 0.021 0.020 0.019 0.018 0.017 0.016 0.015 0.014 0.012 0.012 0.010 0.009 0.008 0.007 0.006 0.005 0.004 0.003
sum of density on p0-p1 = 1.000000
Time used: 0:06
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -735.366082 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.005515 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 2.271188 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.005535
(1: 0.005515, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634450_1_2780_MLBR_RS13230: 0.005515, NC_002677_1_NP_302665_1_1537_ML2598: 0.000004, NZ_LVXE01000045_1_WP_010908984_1_1929_A3216_RS10880: 0.000004, NZ_LYPH01000051_1_WP_010908984_1_1946_A8144_RS09300: 0.000004, NZ_CP029543_1_WP_010908984_1_2809_DIJ64_RS14300: 0.000004, NZ_AP014567_1_WP_010908984_1_2877_JK2ML_RS14640: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 2.27119 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.99999 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.006 403.6 148.4 1.0000 0.0018 0.0018 0.7 0.3
7..2 0.000 403.6 148.4 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 403.6 148.4 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 403.6 148.4 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 403.6 148.4 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 403.6 148.4 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:13
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -735.036620 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.005609 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 1.010226 1.413532 951.428536
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.005629
(1: 0.005609, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634450_1_2780_MLBR_RS13230: 0.005609, NC_002677_1_NP_302665_1_1537_ML2598: 0.000004, NZ_LVXE01000045_1_WP_010908984_1_1929_A3216_RS10880: 0.000004, NZ_LYPH01000051_1_WP_010908984_1_1946_A8144_RS09300: 0.000004, NZ_CP029543_1_WP_010908984_1_2809_DIJ64_RS14300: 0.000004, NZ_AP014567_1_WP_010908984_1_2877_JK2ML_RS14640: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 1.01023 q = 1.41353
(p1 = 0.99999) w = 951.42854
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.03678 0.11088 0.18704 0.26593 0.34824 0.43488 0.52723 0.62761 0.74071 0.88089 951.42854
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.006 403.6 148.4 951.4190 0.0026 0.0000 1.0 0.0
7..2 0.000 403.6 148.4 951.4190 0.0000 0.0000 0.0 0.0
7..3 0.000 403.6 148.4 951.4190 0.0000 0.0000 0.0 0.0
7..4 0.000 403.6 148.4 951.4190 0.0000 0.0000 0.0 0.0
7..5 0.000 403.6 148.4 951.4190 0.0000 0.0000 0.0 0.0
7..6 0.000 403.6 148.4 951.4190 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634450_1_2780_MLBR_RS13230)
Pr(w>1) post mean +- SE for w
1 V 1.000** 951.419
2 A 1.000** 951.419
3 A 1.000** 951.419
4 A 1.000** 951.419
5 E 1.000** 951.419
6 G 1.000** 951.419
7 G 1.000** 951.419
8 G 1.000** 951.419
9 S 1.000** 951.419
10 W 1.000** 951.419
11 R 1.000** 951.419
12 N 1.000** 951.419
13 R 1.000** 951.419
14 R 1.000** 951.419
15 A 1.000** 951.419
16 G 1.000** 951.419
17 Q 1.000** 951.419
18 R 1.000** 951.419
19 T 1.000** 951.419
20 A 1.000** 951.419
21 I 1.000** 951.419
22 A 1.000** 951.419
23 V 1.000** 951.419
24 V 1.000** 951.419
25 V 1.000** 951.419
26 A 1.000** 951.419
27 A 1.000** 951.419
28 V 1.000** 951.419
29 L 1.000** 951.419
30 F 1.000** 951.419
31 V 1.000** 951.419
32 G 1.000** 951.419
33 S 1.000** 951.419
34 A 1.000** 951.419
35 A 1.000** 951.419
36 F 1.000** 951.419
37 A 1.000** 951.419
38 G 1.000** 951.419
39 A 1.000** 951.419
40 A 1.000** 951.419
41 V 1.000** 951.419
42 Q 1.000** 951.419
43 P 1.000** 951.419
44 Y 1.000** 951.419
45 L 1.000** 951.419
46 A 1.000** 951.419
47 D 1.000** 951.419
48 R 1.000** 951.419
49 A 1.000** 951.419
50 T 1.000** 951.419
51 V 1.000** 951.419
52 A 1.000** 951.419
53 V 1.000** 951.419
54 K 1.000** 951.419
55 L 1.000** 951.419
56 E 1.000** 951.419
57 V 1.000** 951.419
58 A 1.000** 951.419
59 R 1.000** 951.419
60 T 1.000** 951.419
61 A 1.000** 951.419
62 A 1.000** 951.419
63 N 1.000** 951.419
64 A 1.000** 951.419
65 I 1.000** 951.419
66 T 1.000** 951.419
67 V 1.000** 951.419
68 L 1.000** 951.419
69 W 1.000** 951.419
70 T 1.000** 951.419
71 Y 1.000** 951.419
72 T 1.000** 951.419
73 P 1.000** 951.419
74 E 1.000** 951.419
75 N 1.000** 951.419
76 M 1.000** 951.419
77 D 1.000** 951.419
78 T 1.000** 951.419
79 L 1.000** 951.419
80 A 1.000** 951.419
81 D 1.000** 951.419
82 R 1.000** 951.419
83 A 1.000** 951.419
84 A 1.000** 951.419
85 T 1.000** 951.419
86 Y 1.000** 951.419
87 V 1.000** 951.429
88 S 1.000** 951.419
89 G 1.000** 951.419
90 D 1.000** 951.419
91 F 1.000** 951.419
92 G 1.000** 951.419
93 A 1.000** 951.419
94 Q 1.000** 951.419
95 Y 1.000** 951.419
96 R 1.000** 951.419
97 K 1.000** 951.419
98 F 1.000** 951.419
99 V 1.000** 951.419
100 D 1.000** 951.419
101 A 1.000** 951.419
102 I 1.000** 951.419
103 V 1.000** 951.419
104 G 1.000** 951.419
105 P 1.000** 951.419
106 N 1.000** 951.419
107 K 1.000** 951.419
108 Q 1.000** 951.419
109 A 1.000** 951.419
110 K 1.000** 951.419
111 I 1.000** 951.419
112 T 1.000** 951.419
113 N 1.000** 951.419
114 S 1.000** 951.419
115 T 1.000** 951.419
116 E 1.000** 951.419
117 V 1.000** 951.419
118 T 1.000** 951.419
119 G 1.000** 951.419
120 V 1.000** 951.419
121 A 1.000** 951.419
122 V 1.000** 951.419
123 E 1.000** 951.419
124 S 1.000** 951.419
125 L 1.000** 951.419
126 D 1.000** 951.419
127 A 1.000** 951.419
128 S 1.000** 951.419
129 N 1.000** 951.419
130 A 1.000** 951.419
131 I 1.000** 951.419
132 A 1.000** 951.419
133 I 1.000** 951.419
134 V 1.000** 951.419
135 Y 1.000** 951.419
136 T 1.000** 951.419
137 N 1.000** 951.419
138 T 1.000** 951.419
139 T 1.000** 951.419
140 S 1.000** 951.419
141 T 1.000** 951.419
142 S 1.000** 951.419
143 P 1.000** 951.419
144 L 1.000** 951.419
145 T 1.000** 951.419
146 K 1.000** 951.419
147 N 1.000** 951.419
148 I 1.000** 951.419
149 P 1.000** 951.419
150 A 1.000** 951.419
151 L 1.000** 951.419
152 K 1.000** 951.419
153 Y 1.000** 951.419
154 L 1.000** 951.419
155 S 1.000** 951.419
156 Y 1.000** 951.419
157 R 1.000** 951.419
158 L 1.000** 951.419
159 F 1.000** 951.419
160 M 1.000** 951.419
161 K 1.000** 951.419
162 R 1.000** 951.419
163 S 1.000** 951.419
164 A 1.000** 951.419
165 V 1.000** 951.419
166 R 1.000** 951.419
167 W 1.000** 951.419
168 L 1.000** 951.419
169 V 1.000** 951.419
170 T 1.000** 951.419
171 R 1.000** 951.419
172 M 1.000** 951.419
173 T 1.000** 951.419
174 T 1.000** 951.419
175 I 1.000** 951.419
176 T 1.000** 951.419
177 S 1.000** 951.419
178 L 1.000** 951.419
179 D 1.000** 951.419
180 L 1.000** 951.419
181 T 1.000** 951.419
182 P 1.000** 951.419
183 Q 1.000** 951.419
184 L 1.000** 951.419
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634450_1_2780_MLBR_RS13230)
Pr(w>1) post mean +- SE for w
1 V 0.639 4.860 +- 3.856
2 A 0.639 4.860 +- 3.856
3 A 0.639 4.860 +- 3.856
4 A 0.639 4.860 +- 3.856
5 E 0.639 4.860 +- 3.856
6 G 0.639 4.860 +- 3.856
7 G 0.639 4.860 +- 3.856
8 G 0.639 4.860 +- 3.856
9 S 0.639 4.860 +- 3.856
10 W 0.639 4.860 +- 3.856
11 R 0.639 4.860 +- 3.856
12 N 0.639 4.860 +- 3.856
13 R 0.639 4.860 +- 3.856
14 R 0.639 4.860 +- 3.856
15 A 0.639 4.860 +- 3.856
16 G 0.639 4.860 +- 3.856
17 Q 0.639 4.860 +- 3.856
18 R 0.639 4.860 +- 3.856
19 T 0.639 4.860 +- 3.856
20 A 0.639 4.860 +- 3.856
21 I 0.639 4.860 +- 3.856
22 A 0.639 4.860 +- 3.856
23 V 0.639 4.860 +- 3.856
24 V 0.639 4.860 +- 3.856
25 V 0.639 4.860 +- 3.856
26 A 0.639 4.860 +- 3.856
27 A 0.639 4.860 +- 3.856
28 V 0.639 4.860 +- 3.856
29 L 0.639 4.860 +- 3.856
30 F 0.639 4.860 +- 3.856
31 V 0.639 4.860 +- 3.856
32 G 0.639 4.860 +- 3.856
33 S 0.639 4.860 +- 3.856
34 A 0.639 4.860 +- 3.856
35 A 0.639 4.860 +- 3.856
36 F 0.639 4.860 +- 3.856
37 A 0.639 4.860 +- 3.856
38 G 0.639 4.860 +- 3.856
39 A 0.639 4.860 +- 3.856
40 A 0.639 4.860 +- 3.856
41 V 0.639 4.860 +- 3.856
42 Q 0.639 4.860 +- 3.856
43 P 0.639 4.860 +- 3.856
44 Y 0.639 4.860 +- 3.856
45 L 0.639 4.860 +- 3.856
46 A 0.639 4.860 +- 3.856
47 D 0.639 4.860 +- 3.856
48 R 0.639 4.860 +- 3.856
49 A 0.639 4.860 +- 3.856
50 T 0.639 4.860 +- 3.856
51 V 0.639 4.860 +- 3.856
52 A 0.639 4.860 +- 3.856
53 V 0.639 4.860 +- 3.856
54 K 0.639 4.860 +- 3.856
55 L 0.639 4.860 +- 3.856
56 E 0.639 4.860 +- 3.856
57 V 0.639 4.860 +- 3.856
58 A 0.639 4.860 +- 3.856
59 R 0.639 4.860 +- 3.856
60 T 0.639 4.860 +- 3.856
61 A 0.639 4.860 +- 3.856
62 A 0.639 4.860 +- 3.856
63 N 0.639 4.860 +- 3.856
64 A 0.639 4.860 +- 3.856
65 I 0.639 4.860 +- 3.856
66 T 0.639 4.860 +- 3.856
67 V 0.639 4.860 +- 3.856
68 L 0.639 4.860 +- 3.856
69 W 0.639 4.860 +- 3.856
70 T 0.639 4.860 +- 3.856
71 Y 0.639 4.860 +- 3.856
72 T 0.639 4.860 +- 3.856
73 P 0.639 4.860 +- 3.856
74 E 0.639 4.860 +- 3.856
75 N 0.639 4.860 +- 3.856
76 M 0.639 4.860 +- 3.856
77 D 0.639 4.860 +- 3.856
78 T 0.639 4.860 +- 3.856
79 L 0.639 4.860 +- 3.856
80 A 0.639 4.860 +- 3.856
81 D 0.639 4.860 +- 3.856
82 R 0.639 4.860 +- 3.856
83 A 0.639 4.860 +- 3.856
84 A 0.639 4.860 +- 3.856
85 T 0.639 4.860 +- 3.856
86 Y 0.639 4.860 +- 3.856
87 V 0.923 6.858 +- 3.003
88 S 0.639 4.860 +- 3.856
89 G 0.639 4.860 +- 3.856
90 D 0.639 4.860 +- 3.856
91 F 0.639 4.860 +- 3.856
92 G 0.639 4.860 +- 3.856
93 A 0.639 4.860 +- 3.856
94 Q 0.639 4.860 +- 3.856
95 Y 0.639 4.860 +- 3.856
96 R 0.639 4.860 +- 3.856
97 K 0.639 4.860 +- 3.856
98 F 0.639 4.860 +- 3.856
99 V 0.639 4.860 +- 3.856
100 D 0.639 4.860 +- 3.856
101 A 0.639 4.860 +- 3.856
102 I 0.639 4.860 +- 3.856
103 V 0.639 4.860 +- 3.856
104 G 0.639 4.860 +- 3.856
105 P 0.639 4.860 +- 3.856
106 N 0.639 4.860 +- 3.856
107 K 0.639 4.860 +- 3.856
108 Q 0.639 4.860 +- 3.856
109 A 0.639 4.860 +- 3.856
110 K 0.639 4.860 +- 3.856
111 I 0.639 4.860 +- 3.856
112 T 0.639 4.860 +- 3.856
113 N 0.639 4.860 +- 3.856
114 S 0.639 4.860 +- 3.856
115 T 0.639 4.860 +- 3.856
116 E 0.639 4.860 +- 3.856
117 V 0.639 4.860 +- 3.856
118 T 0.639 4.860 +- 3.856
119 G 0.639 4.860 +- 3.856
120 V 0.639 4.860 +- 3.856
121 A 0.639 4.860 +- 3.856
122 V 0.639 4.860 +- 3.856
123 E 0.639 4.860 +- 3.856
124 S 0.639 4.860 +- 3.856
125 L 0.639 4.860 +- 3.856
126 D 0.639 4.860 +- 3.856
127 A 0.639 4.860 +- 3.856
128 S 0.639 4.860 +- 3.856
129 N 0.639 4.860 +- 3.856
130 A 0.639 4.860 +- 3.856
131 I 0.639 4.860 +- 3.856
132 A 0.639 4.860 +- 3.856
133 I 0.639 4.860 +- 3.856
134 V 0.639 4.860 +- 3.856
135 Y 0.639 4.860 +- 3.856
136 T 0.639 4.860 +- 3.856
137 N 0.639 4.860 +- 3.856
138 T 0.639 4.860 +- 3.856
139 T 0.639 4.860 +- 3.856
140 S 0.639 4.860 +- 3.856
141 T 0.639 4.860 +- 3.856
142 S 0.639 4.860 +- 3.856
143 P 0.639 4.860 +- 3.856
144 L 0.639 4.860 +- 3.856
145 T 0.639 4.860 +- 3.856
146 K 0.639 4.860 +- 3.856
147 N 0.639 4.860 +- 3.856
148 I 0.639 4.860 +- 3.856
149 P 0.639 4.860 +- 3.856
150 A 0.639 4.860 +- 3.856
151 L 0.639 4.860 +- 3.856
152 K 0.639 4.860 +- 3.856
153 Y 0.639 4.860 +- 3.856
154 L 0.639 4.860 +- 3.856
155 S 0.639 4.860 +- 3.856
156 Y 0.639 4.860 +- 3.856
157 R 0.639 4.860 +- 3.856
158 L 0.639 4.860 +- 3.856
159 F 0.639 4.860 +- 3.856
160 M 0.639 4.860 +- 3.856
161 K 0.639 4.860 +- 3.856
162 R 0.639 4.860 +- 3.856
163 S 0.639 4.860 +- 3.856
164 A 0.639 4.860 +- 3.856
165 V 0.639 4.860 +- 3.856
166 R 0.639 4.860 +- 3.856
167 W 0.639 4.860 +- 3.856
168 L 0.639 4.860 +- 3.856
169 V 0.639 4.860 +- 3.856
170 T 0.639 4.860 +- 3.856
171 R 0.639 4.860 +- 3.856
172 M 0.639 4.860 +- 3.856
173 T 0.639 4.860 +- 3.856
174 T 0.639 4.860 +- 3.856
175 I 0.639 4.860 +- 3.856
176 T 0.639 4.860 +- 3.856
177 S 0.639 4.860 +- 3.856
178 L 0.639 4.860 +- 3.856
179 D 0.639 4.860 +- 3.856
180 L 0.639 4.860 +- 3.856
181 T 0.639 4.860 +- 3.856
182 P 0.639 4.860 +- 3.856
183 Q 0.639 4.860 +- 3.856
184 L 0.639 4.860 +- 3.856
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.176 0.159 0.142 0.125 0.109 0.092 0.075 0.058 0.041 0.024
p : 0.095 0.097 0.098 0.100 0.100 0.101 0.102 0.102 0.102 0.103
q : 0.105 0.103 0.102 0.100 0.100 0.099 0.098 0.098 0.098 0.097
ws: 0.031 0.046 0.062 0.077 0.092 0.108 0.123 0.138 0.154 0.169
Time used: 0:23
Model 1: NearlyNeutral -735.366084 Model 2: PositiveSelection -735.03662 Model 0: one-ratio -735.036601 Model 7: beta -735.366082 Model 8: beta&w>1 -735.03662 Model 0 vs 1 0.658965999999964 Model 2 vs 1 0.6589280000000599 Model 8 vs 7 0.65892400000007
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
