--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:47:49 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2604/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1013.94 -1017.51
2 -1013.91 -1016.98
--------------------------------------
TOTAL -1013.93 -1017.28
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894533 0.088077 0.380438 1.485567 0.862434 1427.60 1455.70 1.000
r(A<->C){all} 0.168308 0.020530 0.000163 0.468959 0.134348 223.51 314.42 1.002
r(A<->G){all} 0.163213 0.019852 0.000116 0.443303 0.123767 90.13 227.60 1.002
r(A<->T){all} 0.158229 0.018722 0.000015 0.426112 0.122208 115.65 205.24 1.005
r(C<->G){all} 0.171803 0.019783 0.000094 0.457705 0.138501 195.54 204.68 1.005
r(C<->T){all} 0.176929 0.021904 0.000126 0.469276 0.137723 197.35 249.44 1.000
r(G<->T){all} 0.161519 0.018401 0.000030 0.445547 0.124672 166.94 190.11 1.000
pi(A){all} 0.194434 0.000205 0.164416 0.220746 0.194244 1224.75 1292.69 1.000
pi(C){all} 0.305094 0.000285 0.272260 0.337951 0.305271 1073.75 1212.52 1.000
pi(G){all} 0.318106 0.000275 0.284874 0.348482 0.318069 1230.32 1267.09 1.000
pi(T){all} 0.182366 0.000198 0.155661 0.209723 0.182517 1277.92 1352.30 1.000
alpha{1,2} 0.423614 0.234739 0.000146 1.388243 0.264944 1293.17 1327.20 1.000
alpha{3} 0.458522 0.253838 0.000249 1.409712 0.301136 1265.90 1334.85 1.000
pinvar{all} 0.997898 0.000007 0.993232 0.999998 0.998722 1401.36 1410.05 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -986.705355
Model 2: PositiveSelection -986.705256
Model 0: one-ratio -986.705266
Model 7: beta -986.705355
Model 8: beta&w>1 -986.705255
Model 0 vs 1 1.7800000000534055E-4
Model 2 vs 1 1.9800000018221908E-4
Model 8 vs 7 2.0000000017716957E-4
>C1
MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
>C2
MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
>C3
MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
>C4
MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
>C5
MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
>C6
MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=249
C1 MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
C2 MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
C3 MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
C4 MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
C5 MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
C6 MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
**************************************************
C1 VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
C2 VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
C3 VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
C4 VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
C5 VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
C6 VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
**************************************************
C1 FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
C2 FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
C3 FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
C4 FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
C5 FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
C6 FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
**************************************************
C1 QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
C2 QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
C3 QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
C4 QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
C5 QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
C6 QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
**************************************************
C1 ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
C2 ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
C3 ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
C4 ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
C5 ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
C6 ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
*************************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 249 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 249 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7470]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [7470]--->[7470]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.493 Mb, Max= 30.801 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
C2 MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
C3 MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
C4 MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
C5 MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
C6 MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
**************************************************
C1 VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
C2 VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
C3 VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
C4 VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
C5 VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
C6 VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
**************************************************
C1 FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
C2 FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
C3 FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
C4 FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
C5 FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
C6 FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
**************************************************
C1 QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
C2 QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
C3 QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
C4 QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
C5 QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
C6 QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
**************************************************
C1 ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
C2 ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
C3 ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
C4 ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
C5 ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
C6 ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
*************************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC
C2 ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC
C3 ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC
C4 ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC
C5 ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC
C6 ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC
**************************************************
C1 TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC
C2 TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC
C3 TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC
C4 TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC
C5 TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC
C6 TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC
**************************************************
C1 AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT
C2 AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT
C3 AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT
C4 AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT
C5 AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT
C6 AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT
**************************************************
C1 GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT
C2 GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT
C3 GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT
C4 GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT
C5 GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT
C6 GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT
**************************************************
C1 CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC
C2 CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC
C3 CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC
C4 CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC
C5 CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC
C6 CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC
**************************************************
C1 TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG
C2 TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG
C3 TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG
C4 TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG
C5 TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG
C6 TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG
**************************************************
C1 TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT
C2 TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT
C3 TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT
C4 TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT
C5 TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT
C6 TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT
**************************************************
C1 GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG
C2 GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG
C3 GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG
C4 GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG
C5 GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG
C6 GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG
**************************************************
C1 CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT
C2 CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT
C3 CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT
C4 CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT
C5 CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT
C6 CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT
**************************************************
C1 CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA
C2 CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA
C3 CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA
C4 CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA
C5 CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA
C6 CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA
**************************************************
C1 TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG
C2 TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG
C3 TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG
C4 TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG
C5 TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG
C6 TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG
**************************************************
C1 CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC
C2 CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC
C3 CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC
C4 CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC
C5 CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC
C6 CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC
**************************************************
C1 GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA
C2 GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA
C3 GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA
C4 GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA
C5 GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA
C6 GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA
**************************************************
C1 TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA
C2 TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA
C3 TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA
C4 TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA
C5 TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA
C6 TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA
**************************************************
C1 TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA
C2 TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA
C3 TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA
C4 TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA
C5 TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA
C6 TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA
***********************************************
>C1
ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC
TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC
AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT
GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT
CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC
TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG
TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT
GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG
CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT
CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA
TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG
CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC
GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA
TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA
TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA
>C2
ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC
TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC
AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT
GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT
CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC
TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG
TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT
GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG
CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT
CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA
TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG
CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC
GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA
TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA
TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA
>C3
ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC
TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC
AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT
GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT
CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC
TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG
TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT
GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG
CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT
CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA
TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG
CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC
GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA
TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA
TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA
>C4
ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC
TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC
AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT
GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT
CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC
TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG
TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT
GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG
CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT
CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA
TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG
CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC
GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA
TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA
TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA
>C5
ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC
TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC
AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT
GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT
CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC
TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG
TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT
GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG
CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT
CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA
TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG
CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC
GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA
TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA
TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA
>C6
ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC
TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC
AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT
GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT
CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC
TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG
TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT
GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG
CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT
CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA
TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG
CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC
GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA
TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA
TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA
>C1
MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
>C2
MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
>C3
MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
>C4
MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
>C5
MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
>C6
MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 747 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579859181
Setting output file names to "/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1145055631
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5247378630
Seed = 1496053548
Swapseed = 1579859181
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1671.821813 -- -24.965149
Chain 2 -- -1671.821717 -- -24.965149
Chain 3 -- -1671.821813 -- -24.965149
Chain 4 -- -1671.821813 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1671.821558 -- -24.965149
Chain 2 -- -1671.821813 -- -24.965149
Chain 3 -- -1671.821717 -- -24.965149
Chain 4 -- -1671.821813 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1671.822] (-1671.822) (-1671.822) (-1671.822) * [-1671.822] (-1671.822) (-1671.822) (-1671.822)
500 -- (-1030.775) [-1024.763] (-1049.860) (-1030.407) * [-1040.443] (-1038.218) (-1023.938) (-1035.746) -- 0:33:19
1000 -- (-1025.229) (-1022.453) [-1021.468] (-1025.769) * (-1030.012) (-1033.233) [-1024.705] (-1023.949) -- 0:16:39
1500 -- (-1019.874) (-1024.686) [-1023.045] (-1021.346) * (-1035.425) [-1021.547] (-1028.195) (-1024.844) -- 0:11:05
2000 -- (-1025.576) (-1026.317) [-1021.232] (-1027.739) * [-1024.605] (-1026.493) (-1027.146) (-1025.907) -- 0:08:19
2500 -- (-1030.793) [-1017.605] (-1030.636) (-1034.633) * [-1027.167] (-1026.644) (-1019.727) (-1026.799) -- 0:06:39
3000 -- [-1020.493] (-1028.382) (-1021.251) (-1022.601) * [-1020.345] (-1028.087) (-1026.655) (-1025.161) -- 0:05:32
3500 -- (-1021.815) [-1026.121] (-1018.811) (-1023.262) * [-1021.600] (-1025.263) (-1029.489) (-1024.375) -- 0:04:44
4000 -- (-1018.953) (-1023.743) [-1020.836] (-1023.952) * (-1025.834) (-1024.069) [-1031.387] (-1031.568) -- 0:04:09
4500 -- (-1034.298) (-1023.456) [-1020.367] (-1019.112) * (-1024.105) (-1033.788) (-1023.895) [-1023.687] -- 0:03:41
5000 -- (-1027.907) (-1024.522) [-1021.503] (-1022.551) * (-1027.456) [-1020.561] (-1022.480) (-1021.861) -- 0:03:19
Average standard deviation of split frequencies: 0.088815
5500 -- [-1022.247] (-1022.847) (-1032.300) (-1022.925) * (-1028.722) [-1018.151] (-1022.442) (-1032.151) -- 0:03:00
6000 -- [-1022.440] (-1023.726) (-1025.493) (-1024.303) * (-1021.491) [-1026.038] (-1031.384) (-1023.228) -- 0:02:45
6500 -- (-1028.771) [-1020.837] (-1034.521) (-1019.789) * [-1021.688] (-1029.398) (-1027.007) (-1021.854) -- 0:02:32
7000 -- [-1016.754] (-1023.509) (-1025.791) (-1027.243) * (-1031.955) (-1022.155) [-1027.988] (-1022.568) -- 0:02:21
7500 -- (-1020.968) [-1017.588] (-1026.210) (-1036.104) * (-1027.264) (-1020.305) [-1024.084] (-1025.321) -- 0:02:12
8000 -- (-1023.135) (-1024.415) (-1042.005) [-1023.274] * [-1026.310] (-1029.163) (-1022.546) (-1022.174) -- 0:02:04
8500 -- (-1043.130) (-1023.398) [-1030.103] (-1021.329) * [-1029.163] (-1020.707) (-1019.398) (-1025.909) -- 0:01:56
9000 -- (-1021.040) [-1022.557] (-1033.295) (-1025.723) * (-1027.114) (-1033.859) [-1018.598] (-1019.418) -- 0:01:50
9500 -- (-1025.912) (-1022.076) (-1021.854) [-1021.117] * (-1021.644) (-1022.131) [-1024.377] (-1027.054) -- 0:01:44
10000 -- (-1021.902) (-1024.746) (-1032.411) [-1019.868] * (-1023.976) (-1023.152) [-1025.697] (-1022.349) -- 0:01:39
Average standard deviation of split frequencies: 0.081410
10500 -- (-1030.491) (-1028.441) (-1025.316) [-1021.848] * (-1016.904) (-1025.575) [-1021.665] (-1029.342) -- 0:01:34
11000 -- (-1022.685) (-1022.432) (-1022.444) [-1022.140] * [-1017.352] (-1027.262) (-1023.968) (-1031.102) -- 0:01:29
11500 -- (-1022.796) (-1020.064) [-1021.955] (-1023.961) * (-1035.712) (-1023.866) (-1017.821) [-1026.424] -- 0:01:25
12000 -- (-1018.970) [-1024.680] (-1022.748) (-1028.705) * [-1024.794] (-1027.140) (-1026.732) (-1023.320) -- 0:01:22
12500 -- (-1024.818) [-1025.068] (-1023.042) (-1022.572) * (-1026.926) (-1021.070) [-1021.264] (-1027.812) -- 0:01:19
13000 -- [-1028.454] (-1024.766) (-1021.825) (-1016.945) * (-1027.629) [-1019.732] (-1026.277) (-1020.150) -- 0:01:15
13500 -- [-1022.324] (-1026.317) (-1017.304) (-1023.751) * (-1020.405) (-1039.708) [-1020.531] (-1021.778) -- 0:01:13
14000 -- [-1023.881] (-1022.612) (-1025.080) (-1026.213) * (-1029.452) (-1017.751) (-1030.195) [-1020.880] -- 0:01:10
14500 -- (-1019.731) (-1032.505) [-1023.316] (-1023.724) * [-1020.262] (-1023.899) (-1031.795) (-1023.360) -- 0:01:07
15000 -- (-1019.686) [-1018.217] (-1027.127) (-1021.853) * [-1026.159] (-1023.649) (-1028.092) (-1023.677) -- 0:01:05
Average standard deviation of split frequencies: 0.081841
15500 -- [-1019.432] (-1015.856) (-1024.925) (-1020.576) * (-1027.103) (-1022.293) [-1019.840] (-1027.511) -- 0:02:07
16000 -- (-1020.028) (-1022.698) [-1028.237] (-1027.085) * (-1026.076) (-1023.250) [-1024.497] (-1023.972) -- 0:02:03
16500 -- (-1025.662) (-1021.593) [-1024.907] (-1021.985) * (-1021.196) (-1023.024) (-1027.437) [-1021.466] -- 0:01:59
17000 -- [-1024.596] (-1031.974) (-1028.849) (-1020.931) * (-1019.158) [-1024.094] (-1036.270) (-1025.458) -- 0:01:55
17500 -- (-1034.469) (-1026.463) (-1020.076) [-1021.781] * (-1028.597) (-1026.761) [-1026.471] (-1022.676) -- 0:01:52
18000 -- (-1032.116) (-1024.394) [-1020.800] (-1021.651) * (-1025.473) (-1029.404) [-1027.906] (-1024.786) -- 0:01:49
18500 -- (-1023.067) (-1023.760) [-1016.653] (-1022.748) * (-1022.302) (-1033.279) (-1031.234) [-1017.765] -- 0:01:46
19000 -- (-1019.638) (-1025.132) [-1020.349] (-1029.683) * (-1024.187) [-1024.124] (-1024.265) (-1021.447) -- 0:01:43
19500 -- (-1021.521) (-1021.379) (-1025.036) [-1026.718] * (-1035.594) (-1015.520) [-1023.555] (-1020.400) -- 0:01:40
20000 -- (-1027.649) (-1021.143) (-1020.492) [-1024.927] * (-1032.235) (-1014.962) [-1018.985] (-1029.976) -- 0:01:38
Average standard deviation of split frequencies: 0.057025
20500 -- (-1022.881) (-1022.722) (-1025.458) [-1018.986] * (-1023.562) (-1021.132) (-1021.486) [-1025.848] -- 0:01:35
21000 -- (-1027.802) [-1018.317] (-1028.819) (-1023.722) * [-1024.076] (-1022.703) (-1024.113) (-1024.719) -- 0:01:33
21500 -- (-1022.555) (-1029.644) (-1024.888) [-1019.449] * (-1027.367) (-1013.786) [-1022.930] (-1028.340) -- 0:01:31
22000 -- [-1023.360] (-1024.526) (-1027.545) (-1025.308) * (-1026.327) (-1015.328) (-1022.763) [-1022.172] -- 0:01:28
22500 -- (-1021.161) (-1020.645) [-1018.477] (-1021.335) * [-1022.608] (-1019.904) (-1023.563) (-1020.804) -- 0:01:26
23000 -- (-1021.225) [-1021.409] (-1020.507) (-1024.334) * (-1025.222) (-1017.150) [-1020.753] (-1028.606) -- 0:01:24
23500 -- (-1027.769) (-1027.929) (-1025.769) [-1021.300] * (-1028.942) (-1012.803) [-1026.445] (-1023.590) -- 0:01:23
24000 -- (-1027.712) (-1021.192) [-1021.872] (-1025.902) * (-1025.729) (-1015.416) (-1024.497) [-1024.140] -- 0:01:21
24500 -- (-1018.612) (-1022.780) (-1029.691) [-1024.424] * (-1022.521) (-1014.102) (-1023.948) [-1022.095] -- 0:01:19
25000 -- (-1017.264) (-1035.133) [-1021.487] (-1025.343) * (-1019.177) (-1013.585) (-1021.895) [-1023.692] -- 0:01:18
Average standard deviation of split frequencies: 0.051240
25500 -- (-1014.980) (-1035.915) [-1022.824] (-1022.150) * (-1028.093) [-1013.476] (-1017.359) (-1029.431) -- 0:01:16
26000 -- [-1012.800] (-1014.796) (-1023.160) (-1028.228) * [-1022.532] (-1013.398) (-1021.707) (-1025.226) -- 0:01:14
26500 -- (-1013.585) [-1014.403] (-1023.414) (-1036.249) * (-1026.851) (-1013.630) [-1020.952] (-1025.079) -- 0:01:13
27000 -- [-1015.300] (-1014.305) (-1025.840) (-1022.069) * (-1034.817) (-1014.190) (-1022.935) [-1021.077] -- 0:01:12
27500 -- (-1013.374) [-1015.663] (-1021.660) (-1023.556) * (-1024.691) [-1013.911] (-1023.303) (-1023.133) -- 0:01:10
28000 -- (-1013.421) (-1014.696) (-1020.135) [-1023.418] * [-1022.369] (-1014.372) (-1021.166) (-1035.028) -- 0:01:09
28500 -- (-1016.534) (-1014.339) (-1019.823) [-1020.508] * (-1025.215) [-1014.524] (-1020.843) (-1017.655) -- 0:01:08
29000 -- [-1015.768] (-1015.438) (-1019.872) (-1019.687) * (-1023.107) (-1013.652) [-1020.602] (-1024.552) -- 0:01:06
29500 -- (-1014.806) (-1015.220) (-1022.380) [-1018.088] * (-1018.812) (-1017.111) [-1027.154] (-1028.023) -- 0:01:05
30000 -- [-1015.863] (-1014.848) (-1022.602) (-1023.125) * (-1025.884) (-1013.886) (-1023.508) [-1024.560] -- 0:01:04
Average standard deviation of split frequencies: 0.046884
30500 -- [-1015.820] (-1015.490) (-1021.636) (-1023.673) * (-1023.811) (-1013.617) (-1020.761) [-1012.622] -- 0:01:03
31000 -- (-1012.778) (-1015.853) (-1021.518) [-1023.250] * (-1030.963) (-1014.167) (-1026.002) [-1012.427] -- 0:01:02
31500 -- [-1015.079] (-1018.586) (-1033.271) (-1021.377) * (-1019.063) (-1016.386) [-1020.120] (-1013.068) -- 0:01:32
32000 -- [-1012.948] (-1014.272) (-1020.264) (-1025.619) * (-1016.632) (-1016.059) (-1025.014) [-1018.417] -- 0:01:30
32500 -- [-1016.155] (-1015.894) (-1026.217) (-1023.534) * (-1018.254) [-1013.332] (-1031.374) (-1013.980) -- 0:01:29
33000 -- (-1014.015) [-1014.928] (-1022.483) (-1022.858) * [-1017.925] (-1013.718) (-1020.562) (-1018.019) -- 0:01:27
33500 -- (-1016.348) (-1014.304) [-1023.767] (-1023.181) * (-1013.239) [-1014.423] (-1025.011) (-1015.039) -- 0:01:26
34000 -- (-1013.796) [-1018.459] (-1025.070) (-1028.869) * (-1013.169) (-1014.639) [-1022.834] (-1013.518) -- 0:01:25
34500 -- [-1013.152] (-1018.127) (-1030.561) (-1027.379) * [-1013.514] (-1014.395) (-1027.864) (-1016.446) -- 0:01:23
35000 -- [-1012.339] (-1015.135) (-1019.915) (-1026.610) * [-1013.077] (-1018.675) (-1022.662) (-1014.278) -- 0:01:22
Average standard deviation of split frequencies: 0.043419
35500 -- (-1013.792) [-1013.352] (-1023.136) (-1016.459) * (-1015.570) [-1021.996] (-1022.540) (-1014.594) -- 0:01:21
36000 -- (-1014.975) (-1013.163) (-1023.631) [-1013.640] * (-1013.676) [-1014.600] (-1025.818) (-1015.300) -- 0:01:20
36500 -- (-1014.276) (-1014.870) (-1028.597) [-1014.370] * (-1015.555) (-1015.967) (-1029.046) [-1012.415] -- 0:01:19
37000 -- [-1013.140] (-1018.936) (-1030.994) (-1012.911) * (-1014.019) (-1014.466) [-1021.711] (-1015.187) -- 0:01:18
37500 -- (-1013.294) [-1015.719] (-1022.215) (-1012.990) * [-1013.871] (-1013.957) (-1032.530) (-1017.671) -- 0:01:17
38000 -- [-1013.669] (-1015.491) (-1026.732) (-1014.226) * (-1016.457) [-1013.152] (-1019.005) (-1018.739) -- 0:01:15
38500 -- [-1014.435] (-1019.663) (-1027.327) (-1013.115) * (-1016.641) [-1015.715] (-1021.763) (-1016.736) -- 0:01:14
39000 -- (-1013.831) [-1017.359] (-1019.710) (-1015.627) * [-1016.621] (-1015.510) (-1027.833) (-1016.356) -- 0:01:13
39500 -- [-1014.182] (-1020.904) (-1021.307) (-1018.577) * [-1016.345] (-1013.457) (-1020.081) (-1014.434) -- 0:01:12
40000 -- (-1014.703) [-1015.574] (-1019.784) (-1013.602) * (-1017.088) (-1016.389) [-1023.827] (-1013.336) -- 0:01:12
Average standard deviation of split frequencies: 0.045147
40500 -- (-1016.383) (-1015.372) (-1019.529) [-1013.825] * (-1013.001) [-1014.929] (-1038.192) (-1014.314) -- 0:01:11
41000 -- (-1013.302) (-1013.969) (-1015.334) [-1013.352] * (-1013.434) (-1015.575) (-1027.645) [-1015.308] -- 0:01:10
41500 -- (-1013.830) [-1014.055] (-1014.871) (-1015.231) * (-1014.867) (-1018.173) (-1020.194) [-1017.704] -- 0:01:09
42000 -- (-1015.386) (-1014.781) [-1016.124] (-1017.097) * [-1013.811] (-1013.833) (-1015.330) (-1014.019) -- 0:01:08
42500 -- (-1017.054) [-1013.327] (-1014.792) (-1018.532) * [-1014.962] (-1013.239) (-1014.644) (-1013.153) -- 0:01:07
43000 -- (-1016.654) (-1014.128) [-1015.495] (-1020.127) * [-1012.720] (-1017.852) (-1014.321) (-1013.255) -- 0:01:06
43500 -- (-1014.451) (-1016.519) (-1015.810) [-1017.206] * (-1014.985) (-1018.742) [-1014.670] (-1013.224) -- 0:01:05
44000 -- (-1013.071) [-1013.432] (-1015.331) (-1014.243) * [-1013.493] (-1017.461) (-1015.323) (-1013.773) -- 0:01:05
44500 -- [-1012.833] (-1014.449) (-1015.801) (-1016.144) * [-1015.075] (-1015.892) (-1015.230) (-1015.742) -- 0:01:04
45000 -- [-1016.539] (-1013.511) (-1019.676) (-1014.954) * (-1017.181) [-1016.447] (-1020.461) (-1013.956) -- 0:01:03
Average standard deviation of split frequencies: 0.040526
45500 -- [-1012.902] (-1012.758) (-1015.759) (-1017.568) * (-1014.662) (-1012.306) (-1017.894) [-1013.226] -- 0:01:02
46000 -- (-1013.112) (-1014.231) [-1014.526] (-1017.254) * (-1015.582) (-1013.157) (-1016.234) [-1013.765] -- 0:01:02
46500 -- [-1019.001] (-1014.052) (-1014.526) (-1014.118) * (-1018.287) (-1013.894) (-1013.675) [-1015.233] -- 0:01:01
47000 -- (-1016.685) [-1013.452] (-1014.341) (-1013.379) * (-1015.266) (-1014.808) (-1013.321) [-1014.681] -- 0:01:00
47500 -- (-1017.776) (-1014.251) [-1015.777] (-1014.206) * (-1013.823) (-1014.062) [-1013.718] (-1013.856) -- 0:01:20
48000 -- [-1014.895] (-1017.446) (-1015.672) (-1013.329) * (-1014.390) (-1015.824) [-1014.098] (-1016.809) -- 0:01:19
48500 -- (-1013.860) (-1015.940) [-1015.119] (-1015.231) * (-1013.874) (-1013.030) [-1013.003] (-1013.635) -- 0:01:18
49000 -- (-1013.875) [-1013.733] (-1012.396) (-1013.945) * (-1014.121) [-1013.068] (-1018.738) (-1014.277) -- 0:01:17
49500 -- (-1015.848) [-1013.738] (-1018.592) (-1013.698) * (-1013.535) (-1013.174) [-1015.927] (-1013.213) -- 0:01:16
50000 -- (-1018.758) (-1012.941) [-1016.951] (-1016.835) * (-1015.811) (-1013.069) (-1017.259) [-1013.407] -- 0:01:16
Average standard deviation of split frequencies: 0.041868
50500 -- [-1020.419] (-1013.119) (-1016.921) (-1018.323) * (-1014.297) [-1012.721] (-1016.852) (-1014.375) -- 0:01:15
51000 -- [-1019.045] (-1012.520) (-1015.609) (-1013.990) * (-1013.458) [-1012.898] (-1015.842) (-1013.255) -- 0:01:14
51500 -- (-1019.149) (-1013.840) [-1014.490] (-1014.722) * (-1012.536) [-1013.755] (-1016.277) (-1013.916) -- 0:01:13
52000 -- [-1015.754] (-1012.545) (-1014.567) (-1013.462) * (-1012.740) [-1013.570] (-1015.513) (-1014.701) -- 0:01:12
52500 -- (-1013.907) (-1013.031) (-1013.404) [-1015.716] * (-1013.099) (-1014.864) (-1016.311) [-1014.415] -- 0:01:12
53000 -- (-1012.836) (-1014.409) (-1014.879) [-1013.122] * (-1015.848) (-1014.826) (-1014.572) [-1017.129] -- 0:01:11
53500 -- (-1014.028) (-1012.489) [-1013.304] (-1015.556) * (-1014.162) [-1013.898] (-1013.491) (-1014.721) -- 0:01:10
54000 -- (-1014.678) (-1016.659) [-1013.826] (-1013.186) * (-1019.060) (-1013.360) [-1013.665] (-1014.004) -- 0:01:10
54500 -- (-1014.505) (-1012.400) (-1014.283) [-1013.533] * [-1015.842] (-1014.135) (-1014.049) (-1013.266) -- 0:01:09
55000 -- (-1015.057) (-1012.844) [-1014.840] (-1019.644) * (-1013.090) (-1015.671) [-1015.102] (-1014.291) -- 0:01:08
Average standard deviation of split frequencies: 0.038081
55500 -- (-1015.182) [-1014.017] (-1014.062) (-1016.615) * (-1017.323) (-1016.877) (-1014.090) [-1016.546] -- 0:01:08
56000 -- [-1014.246] (-1014.140) (-1014.008) (-1013.928) * (-1014.055) (-1014.057) [-1013.788] (-1013.055) -- 0:01:07
56500 -- (-1013.445) (-1015.274) (-1015.563) [-1014.701] * (-1014.761) (-1016.371) [-1014.885] (-1013.846) -- 0:01:06
57000 -- [-1013.677] (-1012.514) (-1017.484) (-1013.018) * (-1013.097) [-1017.832] (-1017.958) (-1014.146) -- 0:01:06
57500 -- [-1013.744] (-1012.476) (-1016.992) (-1013.620) * (-1014.407) (-1014.603) [-1016.896] (-1013.898) -- 0:01:05
58000 -- (-1013.738) (-1012.345) [-1014.542] (-1015.917) * [-1017.450] (-1018.702) (-1016.039) (-1013.214) -- 0:01:04
58500 -- (-1016.678) [-1012.333] (-1015.214) (-1017.127) * (-1014.772) (-1017.893) [-1015.606] (-1013.135) -- 0:01:04
59000 -- (-1015.611) (-1014.171) (-1014.187) [-1016.059] * (-1012.895) (-1014.775) (-1014.617) [-1016.123] -- 0:01:03
59500 -- (-1015.863) (-1012.952) (-1014.324) [-1016.061] * (-1013.896) (-1013.830) (-1013.339) [-1015.889] -- 0:01:03
60000 -- [-1015.364] (-1015.298) (-1012.714) (-1012.489) * (-1016.682) [-1013.312] (-1013.606) (-1013.798) -- 0:01:02
Average standard deviation of split frequencies: 0.040018
60500 -- (-1013.115) (-1015.810) (-1019.148) [-1012.473] * (-1018.088) (-1012.790) [-1016.720] (-1013.786) -- 0:01:02
61000 -- (-1015.101) [-1015.190] (-1021.241) (-1013.252) * (-1012.876) (-1013.288) (-1014.095) [-1013.897] -- 0:01:01
61500 -- (-1018.828) (-1013.079) (-1019.574) [-1012.693] * (-1014.531) (-1012.821) [-1014.131] (-1016.567) -- 0:01:01
62000 -- (-1015.670) (-1017.316) [-1015.178] (-1014.260) * [-1015.438] (-1016.000) (-1022.936) (-1012.594) -- 0:01:15
62500 -- (-1015.503) (-1013.976) (-1015.572) [-1012.995] * (-1016.188) [-1015.320] (-1016.442) (-1013.582) -- 0:01:15
63000 -- (-1016.781) [-1013.893] (-1014.239) (-1013.194) * [-1014.562] (-1012.507) (-1014.135) (-1016.832) -- 0:01:14
63500 -- [-1013.748] (-1014.176) (-1014.929) (-1012.738) * [-1016.463] (-1016.246) (-1013.746) (-1013.135) -- 0:01:13
64000 -- (-1014.285) (-1013.548) [-1014.832] (-1014.388) * (-1018.766) [-1014.494] (-1013.756) (-1013.789) -- 0:01:13
64500 -- (-1015.802) (-1015.111) (-1014.096) [-1016.950] * (-1013.799) [-1013.742] (-1015.495) (-1013.780) -- 0:01:12
65000 -- [-1014.317] (-1015.817) (-1012.993) (-1017.144) * (-1012.640) (-1012.944) [-1014.182] (-1013.239) -- 0:01:11
Average standard deviation of split frequencies: 0.034284
65500 -- [-1013.156] (-1014.469) (-1013.442) (-1014.391) * (-1013.962) [-1013.197] (-1014.328) (-1014.202) -- 0:01:11
66000 -- (-1014.838) (-1015.878) [-1014.620] (-1013.067) * (-1014.998) (-1015.251) (-1014.440) [-1013.427] -- 0:01:10
66500 -- (-1014.354) (-1015.925) (-1014.180) [-1013.550] * (-1014.214) [-1014.771] (-1013.609) (-1014.940) -- 0:01:10
67000 -- (-1015.698) (-1015.046) [-1015.889] (-1017.898) * (-1016.727) (-1015.335) [-1013.331] (-1015.047) -- 0:01:09
67500 -- (-1014.683) (-1014.454) [-1016.442] (-1012.775) * (-1020.479) (-1016.377) (-1015.257) [-1013.653] -- 0:01:09
68000 -- (-1015.936) (-1012.972) [-1018.748] (-1017.589) * (-1015.119) [-1016.128] (-1017.664) (-1015.962) -- 0:01:08
68500 -- (-1014.168) [-1016.072] (-1013.417) (-1013.245) * (-1018.102) (-1014.583) [-1014.798] (-1014.002) -- 0:01:07
69000 -- (-1020.853) (-1016.191) (-1016.520) [-1015.626] * [-1015.725] (-1015.834) (-1015.179) (-1014.113) -- 0:01:07
69500 -- (-1016.155) (-1014.589) [-1013.746] (-1013.781) * (-1015.597) (-1019.720) [-1013.877] (-1013.965) -- 0:01:06
70000 -- (-1016.203) [-1013.244] (-1016.101) (-1014.315) * (-1013.453) (-1013.774) (-1012.496) [-1013.301] -- 0:01:06
Average standard deviation of split frequencies: 0.032719
70500 -- [-1014.132] (-1013.461) (-1017.998) (-1014.780) * (-1019.619) (-1014.558) [-1015.102] (-1012.847) -- 0:01:05
71000 -- (-1014.339) (-1012.818) (-1013.742) [-1015.615] * (-1015.321) (-1016.069) [-1017.166] (-1016.716) -- 0:01:05
71500 -- (-1013.937) (-1013.485) (-1015.795) [-1013.402] * (-1015.291) (-1014.884) [-1017.164] (-1014.932) -- 0:01:04
72000 -- [-1013.026] (-1013.840) (-1014.820) (-1014.969) * (-1013.508) [-1014.599] (-1018.181) (-1013.242) -- 0:01:04
72500 -- [-1014.596] (-1015.816) (-1015.381) (-1014.071) * (-1014.628) (-1013.960) [-1013.808] (-1013.378) -- 0:01:03
73000 -- (-1018.841) (-1015.431) (-1017.424) [-1014.398] * (-1014.265) [-1014.436] (-1019.349) (-1013.251) -- 0:01:03
73500 -- (-1016.563) (-1018.212) (-1014.267) [-1016.854] * (-1016.323) [-1013.389] (-1014.607) (-1014.143) -- 0:01:03
74000 -- (-1016.994) (-1014.289) [-1015.164] (-1014.064) * (-1014.337) [-1014.460] (-1014.628) (-1016.510) -- 0:01:02
74500 -- (-1014.732) (-1015.656) (-1014.774) [-1014.153] * (-1013.986) (-1020.431) (-1022.846) [-1018.524] -- 0:01:02
75000 -- (-1014.078) (-1017.440) [-1013.385] (-1012.866) * (-1012.892) (-1015.464) [-1016.264] (-1015.821) -- 0:01:01
Average standard deviation of split frequencies: 0.030034
75500 -- [-1013.626] (-1014.891) (-1015.959) (-1013.097) * [-1013.012] (-1015.658) (-1014.774) (-1013.739) -- 0:01:01
76000 -- (-1013.751) (-1013.627) (-1014.961) [-1015.348] * [-1015.761] (-1013.839) (-1016.033) (-1013.949) -- 0:01:00
76500 -- (-1017.062) (-1013.358) [-1013.990] (-1015.485) * (-1014.699) (-1012.589) [-1016.007] (-1015.641) -- 0:01:00
77000 -- (-1016.749) [-1013.394] (-1015.769) (-1016.256) * (-1015.757) (-1012.555) [-1015.682] (-1015.133) -- 0:00:59
77500 -- (-1015.767) (-1012.811) (-1014.497) [-1014.511] * (-1014.495) (-1014.866) [-1013.503] (-1015.443) -- 0:00:59
78000 -- [-1019.600] (-1013.923) (-1014.304) (-1014.231) * (-1013.204) [-1015.087] (-1012.926) (-1014.749) -- 0:00:59
78500 -- (-1020.718) [-1013.272] (-1017.058) (-1016.271) * (-1012.301) [-1014.738] (-1013.471) (-1013.026) -- 0:01:10
79000 -- (-1016.119) (-1013.842) [-1015.950] (-1015.824) * (-1013.738) [-1013.648] (-1014.117) (-1013.406) -- 0:01:09
79500 -- (-1015.393) [-1013.934] (-1018.824) (-1014.728) * [-1013.768] (-1014.453) (-1013.801) (-1013.259) -- 0:01:09
80000 -- (-1018.280) [-1013.755] (-1016.351) (-1015.806) * (-1014.479) [-1014.650] (-1014.437) (-1014.415) -- 0:01:09
Average standard deviation of split frequencies: 0.027066
80500 -- [-1025.521] (-1017.727) (-1016.044) (-1012.764) * (-1014.945) [-1012.810] (-1015.165) (-1016.099) -- 0:01:08
81000 -- (-1018.518) (-1014.840) (-1015.155) [-1015.160] * (-1016.834) [-1012.438] (-1014.877) (-1014.187) -- 0:01:08
81500 -- (-1019.937) (-1014.634) (-1018.496) [-1016.080] * (-1013.773) [-1013.765] (-1014.482) (-1019.048) -- 0:01:07
82000 -- (-1013.840) [-1013.626] (-1017.397) (-1014.337) * (-1013.560) (-1015.062) (-1020.166) [-1014.400] -- 0:01:07
82500 -- [-1013.708] (-1015.821) (-1017.990) (-1012.434) * (-1013.436) (-1013.310) [-1017.220] (-1014.199) -- 0:01:06
83000 -- (-1013.452) (-1015.625) [-1016.578] (-1016.349) * [-1014.018] (-1013.649) (-1017.077) (-1015.379) -- 0:01:06
83500 -- (-1017.406) (-1015.468) [-1022.584] (-1013.420) * (-1013.926) (-1014.160) (-1014.296) [-1013.680] -- 0:01:05
84000 -- (-1013.256) [-1014.754] (-1019.067) (-1013.516) * (-1013.446) (-1014.803) (-1012.826) [-1013.465] -- 0:01:05
84500 -- (-1014.693) (-1014.692) [-1018.559] (-1013.516) * (-1013.380) [-1014.768] (-1016.138) (-1017.811) -- 0:01:05
85000 -- (-1013.681) (-1013.437) [-1018.444] (-1014.667) * [-1013.085] (-1013.264) (-1013.813) (-1013.743) -- 0:01:04
Average standard deviation of split frequencies: 0.026885
85500 -- (-1015.049) (-1013.478) [-1014.578] (-1013.731) * [-1012.946] (-1014.628) (-1015.831) (-1016.322) -- 0:01:04
86000 -- (-1012.922) (-1020.559) [-1013.089] (-1013.744) * (-1016.627) (-1013.319) (-1016.043) [-1016.399] -- 0:01:03
86500 -- (-1014.358) (-1015.374) (-1012.324) [-1014.929] * (-1018.018) [-1013.310] (-1014.055) (-1015.808) -- 0:01:03
87000 -- (-1017.647) (-1016.208) (-1012.645) [-1015.794] * (-1018.657) (-1014.717) (-1013.811) [-1015.225] -- 0:01:02
87500 -- (-1015.241) (-1016.376) [-1013.408] (-1014.108) * (-1017.454) [-1012.552] (-1014.175) (-1018.538) -- 0:01:02
88000 -- (-1015.941) [-1014.927] (-1013.672) (-1015.403) * (-1013.746) (-1014.329) [-1016.200] (-1015.642) -- 0:01:02
88500 -- [-1014.677] (-1014.743) (-1015.756) (-1012.681) * [-1013.123] (-1013.246) (-1016.006) (-1016.564) -- 0:01:01
89000 -- (-1016.967) (-1015.521) (-1014.199) [-1012.696] * (-1013.394) (-1014.011) (-1014.388) [-1020.027] -- 0:01:01
89500 -- (-1019.620) [-1018.611] (-1012.908) (-1013.307) * (-1015.448) (-1017.157) [-1014.377] (-1015.892) -- 0:01:01
90000 -- (-1021.650) (-1017.949) [-1013.006] (-1015.218) * (-1015.651) (-1017.023) [-1013.972] (-1016.315) -- 0:01:00
Average standard deviation of split frequencies: 0.023917
90500 -- (-1013.479) (-1014.824) [-1014.577] (-1014.626) * (-1016.655) (-1014.652) (-1017.565) [-1013.431] -- 0:01:00
91000 -- (-1019.351) (-1017.591) [-1016.513] (-1019.909) * (-1018.715) [-1014.559] (-1014.093) (-1014.433) -- 0:00:59
91500 -- (-1016.012) (-1019.459) (-1013.594) [-1017.191] * (-1022.049) [-1014.562] (-1015.633) (-1014.628) -- 0:00:59
92000 -- (-1014.059) (-1014.208) [-1013.845] (-1015.250) * [-1015.112] (-1016.445) (-1016.799) (-1014.651) -- 0:00:59
92500 -- [-1013.105] (-1016.729) (-1013.407) (-1016.751) * (-1016.542) (-1013.947) [-1014.084] (-1013.099) -- 0:00:58
93000 -- [-1014.402] (-1014.438) (-1014.061) (-1014.057) * [-1014.993] (-1014.528) (-1014.501) (-1015.506) -- 0:00:58
93500 -- (-1021.859) (-1015.456) [-1013.453] (-1014.337) * (-1014.596) (-1014.908) (-1013.575) [-1014.193] -- 0:00:58
94000 -- (-1019.603) (-1015.626) [-1016.755] (-1013.305) * (-1018.664) [-1015.482] (-1012.924) (-1014.146) -- 0:00:57
94500 -- (-1014.035) [-1013.863] (-1017.916) (-1012.873) * (-1014.537) (-1012.907) [-1013.084] (-1013.088) -- 0:01:07
95000 -- (-1013.462) (-1013.578) (-1015.087) [-1012.896] * (-1018.103) (-1018.511) (-1014.045) [-1013.067] -- 0:01:06
Average standard deviation of split frequencies: 0.021006
95500 -- (-1013.231) (-1015.799) (-1013.367) [-1013.418] * [-1013.619] (-1016.270) (-1014.952) (-1017.108) -- 0:01:06
96000 -- (-1015.536) (-1013.975) [-1020.389] (-1012.980) * [-1014.611] (-1014.691) (-1017.731) (-1019.263) -- 0:01:05
96500 -- (-1013.527) [-1014.063] (-1014.410) (-1014.064) * [-1014.252] (-1017.638) (-1017.123) (-1018.122) -- 0:01:05
97000 -- (-1013.575) [-1013.895] (-1014.856) (-1013.416) * (-1021.599) [-1014.142] (-1019.470) (-1016.281) -- 0:01:05
97500 -- (-1018.078) (-1014.378) [-1012.981] (-1013.515) * (-1014.490) [-1014.671] (-1014.978) (-1014.704) -- 0:01:04
98000 -- (-1016.784) [-1014.506] (-1014.195) (-1015.150) * (-1015.192) (-1015.004) (-1016.642) [-1014.896] -- 0:01:04
98500 -- (-1014.483) [-1016.747] (-1014.028) (-1015.581) * (-1012.995) (-1017.106) [-1018.737] (-1013.562) -- 0:01:04
99000 -- [-1016.233] (-1014.933) (-1013.662) (-1013.040) * [-1013.366] (-1016.797) (-1014.033) (-1014.624) -- 0:01:03
99500 -- (-1016.283) (-1016.191) (-1018.522) [-1013.237] * (-1013.879) (-1016.089) (-1013.994) [-1016.588] -- 0:01:03
100000 -- [-1018.667] (-1016.573) (-1013.643) (-1012.982) * (-1013.423) [-1014.302] (-1015.555) (-1019.931) -- 0:01:02
Average standard deviation of split frequencies: 0.020032
100500 -- (-1013.270) (-1013.636) (-1013.994) [-1013.229] * (-1015.564) [-1014.063] (-1014.648) (-1015.095) -- 0:01:02
101000 -- (-1014.795) (-1014.913) [-1013.738] (-1013.214) * (-1019.105) (-1014.113) [-1015.447] (-1015.442) -- 0:01:02
101500 -- (-1012.775) (-1017.979) [-1013.706] (-1015.802) * (-1016.865) (-1018.717) [-1014.159] (-1014.769) -- 0:01:01
102000 -- (-1012.775) (-1018.826) [-1015.423] (-1013.910) * (-1015.189) (-1013.700) (-1015.204) [-1018.098] -- 0:01:01
102500 -- (-1013.693) (-1015.932) [-1014.260] (-1014.444) * (-1014.047) [-1018.060] (-1014.932) (-1016.949) -- 0:01:01
103000 -- (-1016.370) (-1015.865) [-1012.621] (-1014.983) * (-1013.971) [-1014.911] (-1014.300) (-1015.240) -- 0:01:00
103500 -- [-1015.421] (-1015.974) (-1012.693) (-1016.510) * (-1017.516) [-1014.375] (-1014.950) (-1016.194) -- 0:01:00
104000 -- (-1014.179) (-1014.932) [-1014.294] (-1013.103) * (-1014.854) (-1016.295) (-1013.512) [-1014.454] -- 0:01:00
104500 -- (-1015.000) (-1014.952) [-1015.684] (-1015.124) * (-1015.959) (-1013.752) (-1014.597) [-1014.793] -- 0:00:59
105000 -- (-1014.868) (-1012.883) (-1015.618) [-1014.996] * (-1013.869) (-1012.910) [-1013.496] (-1013.898) -- 0:00:59
Average standard deviation of split frequencies: 0.019271
105500 -- (-1017.223) (-1013.713) (-1014.888) [-1013.797] * (-1013.348) (-1013.124) (-1013.137) [-1018.770] -- 0:00:59
106000 -- (-1015.287) (-1019.744) (-1016.396) [-1013.657] * (-1016.868) (-1014.003) [-1018.551] (-1012.848) -- 0:00:59
106500 -- (-1015.393) [-1014.758] (-1013.320) (-1014.162) * [-1012.602] (-1014.069) (-1015.132) (-1012.767) -- 0:00:58
107000 -- [-1015.608] (-1013.762) (-1014.123) (-1013.609) * [-1017.193] (-1013.236) (-1014.073) (-1012.998) -- 0:00:58
107500 -- (-1015.267) [-1014.434] (-1015.622) (-1014.118) * (-1015.764) (-1015.348) [-1013.195] (-1015.189) -- 0:00:58
108000 -- [-1014.434] (-1014.004) (-1016.053) (-1014.509) * (-1016.898) (-1017.035) [-1013.195] (-1018.457) -- 0:00:57
108500 -- (-1014.098) (-1014.858) (-1013.560) [-1015.065] * (-1013.198) (-1012.722) [-1012.686] (-1015.110) -- 0:00:57
109000 -- (-1015.532) (-1013.915) (-1015.164) [-1016.845] * (-1013.387) (-1013.640) [-1013.042] (-1017.041) -- 0:00:57
109500 -- (-1013.479) [-1013.573] (-1013.607) (-1020.130) * (-1013.260) (-1012.373) (-1012.491) [-1013.255] -- 0:00:56
110000 -- (-1016.780) (-1015.136) (-1016.677) [-1023.927] * (-1013.778) (-1015.544) [-1012.352] (-1012.695) -- 0:00:56
Average standard deviation of split frequencies: 0.018459
110500 -- (-1018.164) (-1014.901) [-1015.972] (-1013.544) * (-1013.732) [-1015.272] (-1012.836) (-1016.134) -- 0:01:04
111000 -- (-1021.551) (-1016.283) (-1017.710) [-1013.224] * (-1014.012) (-1016.509) [-1013.992] (-1014.193) -- 0:01:04
111500 -- (-1013.930) (-1015.088) (-1014.643) [-1013.733] * [-1015.377] (-1014.683) (-1014.568) (-1016.372) -- 0:01:03
112000 -- (-1014.153) (-1014.926) [-1012.748] (-1014.393) * (-1014.819) [-1013.762] (-1013.900) (-1013.564) -- 0:01:03
112500 -- (-1014.306) (-1017.208) [-1012.719] (-1014.406) * [-1015.208] (-1014.362) (-1019.267) (-1016.621) -- 0:01:03
113000 -- (-1016.158) (-1014.165) (-1014.011) [-1013.672] * (-1013.997) [-1014.544] (-1018.150) (-1018.776) -- 0:01:02
113500 -- (-1016.092) (-1013.885) [-1015.488] (-1016.677) * [-1013.458] (-1013.555) (-1017.109) (-1013.840) -- 0:01:02
114000 -- (-1013.854) (-1019.544) (-1015.547) [-1013.955] * (-1013.277) [-1015.577] (-1014.302) (-1013.574) -- 0:01:02
114500 -- (-1013.556) (-1017.769) (-1015.202) [-1015.870] * [-1014.367] (-1013.287) (-1013.965) (-1014.421) -- 0:01:01
115000 -- (-1016.740) [-1012.835] (-1014.178) (-1014.353) * (-1014.597) (-1014.143) [-1015.640] (-1015.426) -- 0:01:01
Average standard deviation of split frequencies: 0.018646
115500 -- (-1015.764) (-1015.000) (-1014.982) [-1013.565] * (-1014.743) (-1014.019) (-1020.041) [-1016.905] -- 0:01:01
116000 -- (-1016.837) [-1014.150] (-1015.815) (-1015.345) * (-1014.778) (-1017.440) [-1014.821] (-1021.270) -- 0:01:00
116500 -- (-1016.683) (-1016.190) [-1014.901] (-1015.790) * (-1013.300) [-1014.326] (-1014.533) (-1016.208) -- 0:01:00
117000 -- (-1013.866) (-1017.460) (-1014.428) [-1015.397] * (-1014.120) [-1013.561] (-1014.433) (-1017.241) -- 0:01:00
117500 -- (-1013.521) (-1015.483) [-1015.789] (-1017.082) * (-1013.996) (-1013.948) [-1013.920] (-1019.495) -- 0:01:00
118000 -- (-1012.932) (-1013.774) [-1015.813] (-1013.907) * [-1013.298] (-1013.861) (-1016.130) (-1017.321) -- 0:00:59
118500 -- (-1015.260) [-1013.218] (-1015.840) (-1013.841) * (-1013.857) (-1015.722) [-1015.280] (-1016.165) -- 0:00:59
119000 -- (-1015.864) (-1014.957) (-1013.959) [-1014.657] * (-1021.746) (-1015.073) (-1016.290) [-1017.033] -- 0:00:59
119500 -- (-1015.675) (-1013.121) [-1015.945] (-1014.070) * [-1021.167] (-1013.587) (-1012.888) (-1018.074) -- 0:00:58
120000 -- [-1013.740] (-1016.282) (-1015.945) (-1013.558) * (-1024.468) (-1013.626) [-1013.562] (-1015.484) -- 0:00:58
Average standard deviation of split frequencies: 0.017336
120500 -- (-1015.125) (-1015.575) (-1014.334) [-1017.876] * (-1019.398) (-1016.567) (-1014.654) [-1015.145] -- 0:00:58
121000 -- (-1015.476) (-1015.201) (-1014.557) [-1012.933] * [-1020.375] (-1014.304) (-1014.006) (-1015.061) -- 0:00:58
121500 -- (-1014.390) [-1016.351] (-1014.126) (-1014.178) * (-1019.542) (-1013.020) [-1014.064] (-1014.588) -- 0:00:57
122000 -- [-1013.033] (-1016.796) (-1013.364) (-1013.114) * (-1017.448) (-1014.883) (-1014.161) [-1017.098] -- 0:00:57
122500 -- [-1015.065] (-1012.728) (-1014.943) (-1013.239) * (-1018.494) (-1013.925) (-1014.949) [-1013.234] -- 0:00:57
123000 -- (-1015.501) [-1012.898] (-1015.568) (-1013.947) * (-1016.765) (-1013.519) [-1017.281] (-1014.777) -- 0:00:57
123500 -- (-1018.771) (-1014.001) (-1013.889) [-1012.502] * (-1013.418) [-1014.381] (-1016.531) (-1013.331) -- 0:00:56
124000 -- (-1018.829) [-1013.334] (-1016.146) (-1013.861) * (-1013.424) (-1016.382) [-1012.881] (-1013.615) -- 0:00:56
124500 -- (-1012.912) (-1013.098) (-1013.256) [-1012.541] * (-1013.103) [-1013.294] (-1013.569) (-1014.739) -- 0:00:56
125000 -- (-1014.106) (-1012.647) (-1013.002) [-1013.145] * (-1017.114) (-1014.278) (-1013.729) [-1016.579] -- 0:00:56
Average standard deviation of split frequencies: 0.018116
125500 -- (-1018.118) (-1015.766) [-1013.074] (-1012.455) * (-1013.807) (-1015.698) (-1014.946) [-1017.233] -- 0:00:55
126000 -- (-1015.065) (-1014.609) (-1015.297) [-1018.630] * (-1015.319) (-1017.173) (-1013.179) [-1013.444] -- 0:00:55
126500 -- (-1017.126) (-1014.102) (-1014.364) [-1015.026] * (-1013.300) (-1015.255) [-1013.568] (-1023.891) -- 0:00:55
127000 -- [-1017.288] (-1014.785) (-1015.872) (-1014.149) * (-1017.177) (-1014.895) [-1012.290] (-1020.213) -- 0:01:01
127500 -- (-1014.308) (-1015.514) (-1014.055) [-1013.846] * [-1018.583] (-1014.713) (-1013.828) (-1014.896) -- 0:01:01
128000 -- (-1016.959) (-1015.564) (-1016.694) [-1014.757] * (-1014.579) [-1014.997] (-1015.267) (-1014.652) -- 0:01:01
128500 -- (-1017.497) [-1014.199] (-1020.713) (-1015.362) * (-1015.907) [-1015.748] (-1017.502) (-1014.548) -- 0:01:01
129000 -- (-1013.928) [-1015.005] (-1013.820) (-1014.341) * (-1023.263) (-1025.487) (-1013.197) [-1014.725] -- 0:01:00
129500 -- (-1015.294) [-1013.438] (-1015.071) (-1015.354) * (-1019.249) (-1017.548) [-1013.232] (-1015.449) -- 0:01:00
130000 -- (-1015.098) [-1012.893] (-1012.646) (-1013.972) * (-1019.178) (-1017.386) (-1014.269) [-1013.607] -- 0:01:00
Average standard deviation of split frequencies: 0.019368
130500 -- [-1013.425] (-1012.893) (-1017.885) (-1014.354) * (-1017.068) [-1017.231] (-1016.243) (-1022.265) -- 0:00:59
131000 -- [-1014.956] (-1014.061) (-1017.154) (-1015.408) * (-1016.109) (-1012.745) [-1014.425] (-1013.181) -- 0:00:59
131500 -- (-1015.952) [-1014.080] (-1012.364) (-1020.887) * (-1015.508) (-1012.783) (-1018.667) [-1014.836] -- 0:00:59
132000 -- [-1016.101] (-1015.950) (-1012.630) (-1017.094) * (-1013.519) (-1017.478) (-1015.012) [-1013.915] -- 0:00:59
132500 -- (-1017.350) (-1015.953) [-1013.067] (-1015.684) * [-1014.224] (-1016.931) (-1013.715) (-1017.616) -- 0:00:58
133000 -- (-1021.943) (-1015.690) (-1013.416) [-1015.379] * [-1013.061] (-1016.788) (-1013.684) (-1016.477) -- 0:00:58
133500 -- [-1014.476] (-1015.670) (-1013.280) (-1015.198) * (-1016.755) (-1017.841) (-1013.210) [-1021.467] -- 0:00:58
134000 -- (-1014.389) (-1014.708) (-1014.182) [-1016.193] * [-1018.581] (-1017.564) (-1014.657) (-1016.895) -- 0:00:58
134500 -- (-1013.277) (-1015.295) (-1016.634) [-1018.438] * (-1018.218) (-1013.633) [-1013.225] (-1013.022) -- 0:00:57
135000 -- (-1014.012) (-1015.959) [-1012.847] (-1015.330) * [-1014.077] (-1021.607) (-1015.668) (-1013.033) -- 0:00:57
Average standard deviation of split frequencies: 0.017943
135500 -- [-1012.718] (-1014.715) (-1013.095) (-1015.288) * [-1014.008] (-1014.516) (-1014.114) (-1013.294) -- 0:00:57
136000 -- (-1013.152) [-1013.651] (-1014.315) (-1013.422) * (-1014.183) [-1014.621] (-1020.885) (-1013.760) -- 0:00:57
136500 -- (-1013.301) (-1012.755) [-1013.321] (-1013.191) * (-1013.301) (-1014.355) (-1023.375) [-1018.319] -- 0:00:56
137000 -- (-1015.476) (-1013.236) (-1016.414) [-1016.100] * [-1013.222] (-1013.781) (-1017.562) (-1014.587) -- 0:00:56
137500 -- (-1016.988) (-1014.375) [-1016.131] (-1016.618) * [-1014.858] (-1016.404) (-1018.918) (-1013.311) -- 0:00:56
138000 -- (-1015.321) [-1016.086] (-1014.488) (-1015.495) * (-1017.730) (-1015.476) (-1015.178) [-1014.063] -- 0:00:56
138500 -- [-1012.897] (-1014.254) (-1013.717) (-1016.782) * [-1015.643] (-1015.091) (-1020.076) (-1012.772) -- 0:00:55
139000 -- [-1012.959] (-1014.340) (-1013.726) (-1013.698) * (-1013.693) [-1015.741] (-1016.270) (-1012.793) -- 0:00:55
139500 -- (-1013.411) (-1012.692) [-1013.001] (-1013.493) * (-1017.274) [-1015.768] (-1013.668) (-1013.671) -- 0:00:55
140000 -- (-1013.750) [-1014.007] (-1014.653) (-1014.627) * (-1015.131) (-1016.300) [-1013.446] (-1014.111) -- 0:00:55
Average standard deviation of split frequencies: 0.019269
140500 -- [-1014.459] (-1013.670) (-1016.163) (-1017.843) * (-1014.452) (-1016.994) [-1013.857] (-1015.702) -- 0:00:55
141000 -- [-1014.044] (-1017.185) (-1014.328) (-1015.010) * (-1015.134) [-1013.933] (-1013.038) (-1014.559) -- 0:00:54
141500 -- [-1013.684] (-1016.324) (-1014.572) (-1016.134) * (-1016.560) (-1013.332) (-1014.585) [-1015.587] -- 0:00:54
142000 -- (-1014.731) (-1016.252) (-1013.579) [-1014.863] * (-1015.335) [-1013.007] (-1013.116) (-1014.999) -- 0:00:54
142500 -- (-1014.045) [-1013.258] (-1015.550) (-1015.201) * (-1024.359) (-1015.145) [-1012.786] (-1014.054) -- 0:00:54
143000 -- [-1013.486] (-1013.770) (-1016.692) (-1012.988) * (-1013.552) (-1013.622) [-1015.854] (-1013.498) -- 0:00:53
143500 -- (-1014.415) (-1013.847) [-1014.058] (-1012.815) * (-1018.824) [-1014.096] (-1013.054) (-1016.770) -- 0:00:59
144000 -- (-1015.012) (-1015.317) [-1014.171] (-1013.921) * [-1018.345] (-1012.499) (-1015.808) (-1017.181) -- 0:00:59
144500 -- (-1014.754) (-1016.232) (-1014.912) [-1014.499] * (-1019.531) (-1012.509) (-1015.702) [-1017.422] -- 0:00:59
145000 -- (-1012.684) (-1016.094) [-1014.524] (-1013.677) * (-1021.105) (-1015.014) [-1013.651] (-1013.958) -- 0:00:58
Average standard deviation of split frequencies: 0.018297
145500 -- [-1017.124] (-1015.355) (-1014.569) (-1013.600) * [-1016.222] (-1014.504) (-1015.055) (-1014.146) -- 0:00:58
146000 -- [-1022.528] (-1012.856) (-1014.581) (-1014.177) * (-1014.261) (-1013.800) (-1015.371) [-1014.331] -- 0:00:58
146500 -- [-1015.401] (-1017.945) (-1014.506) (-1014.029) * [-1013.873] (-1014.896) (-1013.758) (-1014.691) -- 0:00:58
147000 -- (-1012.802) (-1016.728) [-1013.456] (-1013.431) * [-1013.071] (-1013.506) (-1015.410) (-1016.256) -- 0:00:58
147500 -- (-1013.777) (-1016.137) (-1017.207) [-1017.553] * (-1014.318) (-1013.616) (-1016.461) [-1013.485] -- 0:00:57
148000 -- (-1019.378) (-1016.760) (-1017.240) [-1013.184] * (-1015.959) [-1013.034] (-1013.733) (-1014.872) -- 0:00:57
148500 -- [-1015.486] (-1014.748) (-1015.404) (-1015.490) * (-1014.223) (-1012.905) [-1013.806] (-1016.624) -- 0:00:57
149000 -- (-1016.684) [-1013.320] (-1015.710) (-1015.294) * (-1020.503) [-1015.254] (-1019.725) (-1013.989) -- 0:00:57
149500 -- (-1016.389) (-1012.336) (-1019.880) [-1014.085] * [-1015.481] (-1013.122) (-1015.644) (-1016.754) -- 0:00:56
150000 -- (-1015.945) (-1019.141) (-1014.281) [-1015.523] * (-1016.056) (-1014.097) (-1012.935) [-1019.092] -- 0:00:56
Average standard deviation of split frequencies: 0.017382
150500 -- (-1016.779) (-1015.091) [-1013.326] (-1015.047) * (-1014.216) [-1014.684] (-1014.742) (-1017.390) -- 0:00:56
151000 -- (-1015.126) [-1016.047] (-1013.539) (-1016.672) * (-1012.961) [-1014.459] (-1015.280) (-1014.481) -- 0:00:56
151500 -- (-1013.296) (-1016.273) [-1012.355] (-1016.844) * [-1014.876] (-1018.333) (-1015.836) (-1015.502) -- 0:00:56
152000 -- (-1013.440) [-1017.717] (-1012.351) (-1014.956) * (-1014.230) [-1013.998] (-1014.835) (-1016.044) -- 0:00:55
152500 -- (-1015.308) (-1015.131) (-1014.235) [-1015.202] * [-1016.397] (-1016.150) (-1014.361) (-1015.225) -- 0:00:55
153000 -- (-1014.237) (-1014.190) [-1013.321] (-1014.770) * [-1015.853] (-1014.529) (-1014.130) (-1013.360) -- 0:00:55
153500 -- (-1014.459) (-1013.867) (-1014.410) [-1013.045] * (-1015.270) [-1013.041] (-1015.324) (-1015.463) -- 0:00:55
154000 -- [-1015.491] (-1013.947) (-1013.495) (-1013.743) * (-1016.565) [-1014.465] (-1019.084) (-1012.555) -- 0:00:54
154500 -- (-1018.004) (-1017.421) (-1015.362) [-1014.010] * (-1014.747) (-1013.156) (-1018.034) [-1012.674] -- 0:00:54
155000 -- (-1014.983) (-1016.090) (-1015.137) [-1013.948] * [-1018.066] (-1013.156) (-1016.755) (-1016.179) -- 0:00:54
Average standard deviation of split frequencies: 0.017124
155500 -- (-1015.883) (-1014.683) (-1013.838) [-1013.146] * [-1013.899] (-1015.633) (-1013.824) (-1017.359) -- 0:00:54
156000 -- (-1017.475) [-1015.350] (-1013.209) (-1014.671) * [-1013.911] (-1013.639) (-1016.399) (-1016.309) -- 0:00:54
156500 -- (-1014.149) (-1013.858) (-1013.695) [-1014.509] * (-1013.802) (-1014.240) (-1016.345) [-1014.993] -- 0:00:53
157000 -- [-1014.350] (-1014.940) (-1014.896) (-1013.311) * [-1015.233] (-1014.063) (-1013.285) (-1021.323) -- 0:00:53
157500 -- (-1013.173) (-1014.126) (-1019.902) [-1013.884] * (-1013.573) [-1014.256] (-1014.751) (-1014.068) -- 0:00:53
158000 -- [-1013.202] (-1017.120) (-1016.102) (-1015.547) * (-1015.161) (-1015.311) (-1013.556) [-1015.788] -- 0:00:53
158500 -- (-1013.129) (-1014.984) (-1017.006) [-1015.039] * (-1016.396) (-1014.984) [-1013.353] (-1016.543) -- 0:00:53
159000 -- (-1018.709) (-1014.152) (-1014.516) [-1013.916] * (-1012.702) (-1014.383) (-1014.456) [-1016.230] -- 0:00:52
159500 -- (-1016.945) (-1013.148) [-1013.736] (-1020.593) * (-1013.471) [-1013.156] (-1018.971) (-1014.262) -- 0:00:57
160000 -- (-1015.307) (-1016.759) [-1017.250] (-1019.942) * (-1015.015) (-1014.107) [-1019.247] (-1014.970) -- 0:00:57
Average standard deviation of split frequencies: 0.018467
160500 -- (-1018.346) (-1014.044) [-1015.622] (-1015.431) * (-1012.951) [-1013.753] (-1017.698) (-1015.162) -- 0:00:57
161000 -- (-1013.859) (-1015.421) [-1014.806] (-1015.449) * (-1013.091) (-1015.509) (-1014.724) [-1015.865] -- 0:00:57
161500 -- (-1016.962) (-1018.091) (-1015.507) [-1014.033] * (-1013.807) (-1015.639) (-1013.247) [-1015.009] -- 0:00:57
162000 -- [-1014.840] (-1014.544) (-1015.324) (-1015.347) * [-1014.387] (-1014.258) (-1015.756) (-1014.226) -- 0:00:56
162500 -- (-1016.201) (-1014.190) [-1013.297] (-1013.617) * (-1014.895) (-1013.770) [-1017.680] (-1014.666) -- 0:00:56
163000 -- (-1016.210) (-1016.801) [-1013.670] (-1014.592) * (-1014.898) [-1014.428] (-1013.876) (-1015.636) -- 0:00:56
163500 -- (-1013.063) (-1015.943) [-1014.759] (-1014.129) * (-1017.731) [-1014.182] (-1017.377) (-1014.313) -- 0:00:56
164000 -- (-1016.592) (-1023.154) (-1013.914) [-1013.778] * (-1014.976) [-1014.054] (-1015.639) (-1013.215) -- 0:00:56
164500 -- (-1014.418) (-1015.163) [-1012.844] (-1013.369) * (-1014.088) [-1012.894] (-1017.506) (-1015.057) -- 0:00:55
165000 -- [-1015.415] (-1019.370) (-1014.166) (-1019.154) * (-1015.555) [-1013.662] (-1013.718) (-1014.063) -- 0:00:55
Average standard deviation of split frequencies: 0.019043
165500 -- [-1013.525] (-1016.848) (-1013.814) (-1014.739) * (-1014.522) (-1013.548) [-1019.536] (-1015.148) -- 0:00:55
166000 -- [-1013.926] (-1014.806) (-1013.714) (-1016.036) * (-1016.924) [-1012.979] (-1019.443) (-1019.629) -- 0:00:55
166500 -- (-1021.192) (-1016.191) (-1013.614) [-1014.559] * (-1015.913) (-1012.425) [-1016.499] (-1017.326) -- 0:00:55
167000 -- (-1016.377) (-1016.564) (-1014.491) [-1019.254] * (-1014.276) [-1012.390] (-1014.361) (-1018.030) -- 0:00:54
167500 -- (-1017.502) [-1014.412] (-1014.241) (-1017.285) * [-1013.317] (-1012.682) (-1013.405) (-1016.563) -- 0:00:54
168000 -- (-1018.714) (-1014.989) [-1016.151] (-1014.114) * (-1014.235) (-1018.015) [-1015.215] (-1015.172) -- 0:00:54
168500 -- [-1020.923] (-1014.707) (-1013.762) (-1012.607) * (-1015.004) (-1015.918) [-1016.304] (-1013.866) -- 0:00:54
169000 -- (-1014.040) (-1015.981) (-1015.642) [-1014.900] * (-1013.564) (-1017.307) (-1014.202) [-1013.343] -- 0:00:54
169500 -- [-1015.155] (-1013.165) (-1015.661) (-1013.333) * (-1014.432) (-1018.141) [-1014.489] (-1019.414) -- 0:00:53
170000 -- (-1013.101) (-1016.898) [-1012.584] (-1015.255) * (-1013.137) (-1016.351) (-1014.557) [-1014.313] -- 0:00:53
Average standard deviation of split frequencies: 0.020310
170500 -- (-1016.303) (-1014.099) [-1012.954] (-1017.821) * [-1014.442] (-1012.658) (-1016.414) (-1016.266) -- 0:00:53
171000 -- [-1016.996] (-1014.507) (-1013.682) (-1013.302) * [-1014.787] (-1015.340) (-1016.565) (-1015.217) -- 0:00:53
171500 -- (-1014.971) (-1015.012) [-1014.318] (-1015.834) * [-1015.426] (-1014.538) (-1016.255) (-1015.084) -- 0:00:53
172000 -- (-1013.483) [-1016.203] (-1015.421) (-1019.270) * (-1019.125) (-1016.205) [-1015.038] (-1015.337) -- 0:00:52
172500 -- (-1015.510) (-1016.302) [-1015.635] (-1015.323) * (-1016.360) [-1015.559] (-1013.016) (-1015.724) -- 0:00:52
173000 -- [-1014.085] (-1013.708) (-1015.456) (-1014.408) * (-1018.294) (-1016.115) [-1014.272] (-1017.662) -- 0:00:52
173500 -- (-1017.226) (-1017.956) (-1013.660) [-1016.950] * (-1015.904) (-1018.336) [-1013.092] (-1014.387) -- 0:00:52
174000 -- (-1015.006) (-1017.379) [-1013.432] (-1014.291) * (-1014.371) (-1014.915) (-1012.697) [-1015.000] -- 0:00:52
174500 -- (-1014.196) (-1013.025) [-1014.642] (-1014.611) * (-1013.719) (-1014.113) (-1016.378) [-1014.385] -- 0:00:52
175000 -- (-1014.829) [-1013.400] (-1013.384) (-1018.152) * (-1013.274) (-1012.688) [-1016.199] (-1016.115) -- 0:00:51
Average standard deviation of split frequencies: 0.020009
175500 -- [-1014.867] (-1015.091) (-1014.303) (-1014.526) * (-1016.813) (-1012.757) (-1017.622) [-1013.936] -- 0:00:51
176000 -- (-1015.257) [-1013.256] (-1017.065) (-1012.707) * (-1013.203) [-1012.575] (-1015.879) (-1014.765) -- 0:00:56
176500 -- (-1016.101) (-1014.072) (-1014.803) [-1013.171] * (-1017.276) (-1013.604) (-1015.612) [-1015.471] -- 0:00:55
177000 -- (-1014.379) [-1015.517] (-1013.150) (-1020.415) * (-1026.219) (-1012.830) (-1014.345) [-1013.285] -- 0:00:55
177500 -- (-1017.063) (-1014.309) (-1015.060) [-1017.207] * (-1018.804) (-1012.597) [-1014.781] (-1015.037) -- 0:00:55
178000 -- [-1013.129] (-1014.716) (-1013.936) (-1013.760) * (-1012.908) [-1013.007] (-1016.521) (-1015.264) -- 0:00:55
178500 -- [-1013.601] (-1014.204) (-1013.771) (-1014.828) * (-1013.554) (-1013.009) [-1015.951] (-1016.434) -- 0:00:55
179000 -- (-1014.210) (-1014.611) [-1014.306] (-1017.870) * [-1017.026] (-1015.054) (-1016.441) (-1013.433) -- 0:00:55
179500 -- (-1014.071) (-1012.791) [-1014.582] (-1020.207) * (-1015.833) [-1014.946] (-1015.026) (-1016.018) -- 0:00:54
180000 -- (-1018.570) [-1015.022] (-1015.480) (-1023.579) * (-1014.559) (-1015.565) (-1013.391) [-1014.749] -- 0:00:54
Average standard deviation of split frequencies: 0.019953
180500 -- (-1016.158) (-1015.550) (-1016.961) [-1016.746] * [-1016.442] (-1017.149) (-1015.538) (-1014.052) -- 0:00:54
181000 -- [-1016.071] (-1016.247) (-1018.022) (-1013.262) * (-1016.887) (-1019.917) [-1014.766] (-1014.209) -- 0:00:54
181500 -- (-1014.684) (-1013.052) (-1017.116) [-1012.785] * (-1018.743) [-1015.516] (-1018.156) (-1013.197) -- 0:00:54
182000 -- (-1014.521) (-1017.506) [-1016.925] (-1012.853) * (-1015.428) (-1016.005) [-1016.919] (-1016.630) -- 0:00:53
182500 -- (-1013.326) (-1015.274) (-1020.859) [-1013.750] * [-1013.224] (-1013.330) (-1019.044) (-1013.697) -- 0:00:53
183000 -- (-1015.800) (-1014.845) [-1015.668] (-1013.742) * (-1015.353) (-1015.671) [-1017.696] (-1013.194) -- 0:00:53
183500 -- [-1016.180] (-1017.791) (-1017.160) (-1014.505) * (-1015.041) [-1014.719] (-1019.065) (-1013.617) -- 0:00:53
184000 -- (-1015.845) [-1013.367] (-1016.734) (-1023.766) * (-1013.620) (-1016.787) (-1018.334) [-1015.068] -- 0:00:53
184500 -- (-1014.618) (-1014.430) (-1017.225) [-1017.488] * (-1013.774) (-1015.418) [-1016.380] (-1016.138) -- 0:00:53
185000 -- (-1018.303) (-1013.312) (-1017.115) [-1015.246] * (-1017.522) (-1012.447) (-1013.297) [-1015.918] -- 0:00:52
Average standard deviation of split frequencies: 0.018337
185500 -- (-1012.819) (-1013.799) (-1015.548) [-1014.471] * (-1013.494) (-1012.920) (-1013.883) [-1014.461] -- 0:00:52
186000 -- (-1013.001) (-1014.328) [-1014.144] (-1013.333) * (-1014.527) (-1013.058) (-1013.226) [-1014.175] -- 0:00:52
186500 -- (-1015.987) [-1015.688] (-1015.500) (-1015.327) * (-1017.082) (-1015.317) (-1017.236) [-1014.909] -- 0:00:52
187000 -- (-1013.689) (-1016.899) (-1015.153) [-1013.893] * [-1015.952] (-1014.595) (-1016.593) (-1013.645) -- 0:00:52
187500 -- (-1014.467) [-1016.383] (-1013.313) (-1014.105) * (-1015.393) (-1015.218) [-1012.924] (-1012.727) -- 0:00:52
188000 -- (-1013.509) (-1014.122) (-1013.339) [-1013.399] * (-1015.067) (-1014.501) [-1012.901] (-1012.263) -- 0:00:51
188500 -- (-1013.968) (-1013.060) [-1016.497] (-1014.035) * (-1014.303) [-1016.502] (-1015.837) (-1015.633) -- 0:00:51
189000 -- (-1012.692) [-1013.497] (-1016.043) (-1015.919) * (-1014.007) [-1017.144] (-1015.341) (-1019.837) -- 0:00:51
189500 -- [-1013.699] (-1012.557) (-1015.798) (-1014.180) * (-1013.899) [-1015.140] (-1018.078) (-1013.615) -- 0:00:51
190000 -- (-1015.576) [-1012.724] (-1014.900) (-1017.959) * (-1014.104) (-1013.496) [-1013.698] (-1013.001) -- 0:00:51
Average standard deviation of split frequencies: 0.018325
190500 -- (-1013.504) [-1012.707] (-1015.225) (-1015.241) * [-1013.942] (-1015.898) (-1015.727) (-1013.565) -- 0:00:50
191000 -- (-1015.338) (-1015.490) (-1015.442) [-1014.074] * [-1015.946] (-1017.627) (-1014.239) (-1014.588) -- 0:00:50
191500 -- (-1013.489) (-1015.650) (-1014.884) [-1017.324] * [-1014.237] (-1013.835) (-1016.112) (-1014.358) -- 0:00:50
192000 -- (-1012.434) (-1016.203) [-1012.355] (-1016.866) * [-1014.364] (-1015.538) (-1014.617) (-1013.708) -- 0:00:54
192500 -- (-1015.016) (-1017.927) (-1012.631) [-1012.654] * [-1016.487] (-1015.926) (-1015.007) (-1013.945) -- 0:00:54
193000 -- (-1012.965) (-1019.185) [-1012.996] (-1012.743) * (-1016.787) (-1015.029) [-1018.677] (-1013.462) -- 0:00:54
193500 -- (-1015.134) (-1013.925) [-1013.471] (-1015.176) * (-1013.160) (-1014.542) (-1016.418) [-1014.816] -- 0:00:54
194000 -- (-1016.482) (-1012.636) [-1016.543] (-1014.181) * (-1015.392) (-1014.536) [-1013.460] (-1018.320) -- 0:00:54
194500 -- (-1016.646) (-1015.006) (-1016.264) [-1014.393] * (-1016.579) (-1018.196) [-1013.934] (-1019.918) -- 0:00:53
195000 -- (-1018.875) (-1014.854) [-1014.350] (-1013.594) * (-1013.763) [-1017.449] (-1015.895) (-1020.301) -- 0:00:53
Average standard deviation of split frequencies: 0.018339
195500 -- [-1012.562] (-1014.109) (-1013.236) (-1018.149) * (-1013.475) [-1014.458] (-1014.305) (-1017.060) -- 0:00:53
196000 -- (-1014.902) (-1017.453) (-1014.678) [-1016.575] * (-1013.136) [-1013.700] (-1013.280) (-1013.315) -- 0:00:53
196500 -- [-1016.626] (-1016.932) (-1013.869) (-1013.760) * [-1014.362] (-1016.329) (-1016.240) (-1012.708) -- 0:00:53
197000 -- (-1014.980) (-1014.115) (-1013.959) [-1014.525] * [-1014.200] (-1013.705) (-1018.915) (-1012.770) -- 0:00:52
197500 -- (-1016.222) (-1015.274) [-1013.528] (-1013.463) * (-1016.416) [-1013.880] (-1017.171) (-1013.679) -- 0:00:52
198000 -- (-1021.908) [-1019.593] (-1015.072) (-1016.037) * (-1017.476) [-1016.864] (-1015.454) (-1013.588) -- 0:00:52
198500 -- [-1013.501] (-1018.672) (-1013.256) (-1014.383) * (-1015.961) (-1018.166) [-1017.850] (-1013.596) -- 0:00:52
199000 -- [-1013.337] (-1013.824) (-1015.789) (-1014.899) * (-1016.000) [-1013.774] (-1015.639) (-1014.792) -- 0:00:52
199500 -- (-1013.894) [-1014.227] (-1018.177) (-1015.087) * (-1013.293) (-1018.725) [-1013.170] (-1013.842) -- 0:00:52
200000 -- [-1013.415] (-1014.309) (-1016.925) (-1016.669) * (-1015.551) (-1016.782) [-1013.924] (-1015.207) -- 0:00:51
Average standard deviation of split frequencies: 0.017412
200500 -- (-1016.089) (-1015.442) [-1016.775] (-1013.276) * (-1016.588) (-1016.586) (-1015.696) [-1013.237] -- 0:00:51
201000 -- (-1013.622) (-1013.847) [-1012.619] (-1013.980) * (-1017.544) [-1014.970] (-1015.516) (-1016.085) -- 0:00:51
201500 -- (-1015.129) (-1017.090) [-1013.407] (-1014.132) * [-1015.152] (-1016.643) (-1016.398) (-1014.677) -- 0:00:51
202000 -- [-1017.932] (-1018.469) (-1015.320) (-1012.952) * (-1013.843) (-1015.136) (-1016.345) [-1014.684] -- 0:00:51
202500 -- (-1022.144) (-1020.627) [-1013.753] (-1014.572) * (-1020.410) [-1013.114] (-1014.484) (-1014.494) -- 0:00:51
203000 -- (-1021.812) (-1013.453) (-1013.099) [-1015.673] * (-1016.759) (-1015.651) (-1016.588) [-1014.495] -- 0:00:51
203500 -- (-1013.207) (-1014.131) [-1013.595] (-1014.469) * (-1013.493) [-1018.087] (-1015.205) (-1015.369) -- 0:00:50
204000 -- (-1013.121) [-1015.376] (-1013.636) (-1015.689) * (-1014.064) (-1020.564) [-1013.727] (-1013.152) -- 0:00:50
204500 -- [-1012.419] (-1014.411) (-1015.868) (-1019.293) * (-1014.222) (-1018.017) (-1014.755) [-1012.458] -- 0:00:50
205000 -- [-1013.266] (-1013.684) (-1017.379) (-1013.132) * (-1016.794) (-1019.468) (-1016.472) [-1012.497] -- 0:00:50
Average standard deviation of split frequencies: 0.017499
205500 -- [-1013.309] (-1015.012) (-1015.228) (-1012.606) * [-1012.921] (-1020.604) (-1013.644) (-1012.972) -- 0:00:50
206000 -- (-1017.270) [-1013.914] (-1015.971) (-1017.495) * (-1012.672) (-1013.542) [-1014.811] (-1013.454) -- 0:00:50
206500 -- (-1024.329) (-1015.281) (-1013.783) [-1015.937] * (-1014.205) (-1015.276) [-1015.621] (-1015.954) -- 0:00:49
207000 -- [-1017.409] (-1019.510) (-1012.958) (-1014.523) * (-1013.430) (-1014.641) (-1016.332) [-1015.820] -- 0:00:49
207500 -- (-1013.754) (-1013.596) (-1013.569) [-1015.355] * [-1014.416] (-1013.396) (-1017.861) (-1014.263) -- 0:00:49
208000 -- (-1013.776) (-1013.528) (-1016.372) [-1015.209] * (-1015.115) (-1012.556) (-1017.631) [-1015.814] -- 0:00:49
208500 -- (-1014.329) [-1014.900] (-1012.856) (-1014.473) * [-1016.445] (-1013.603) (-1015.940) (-1014.443) -- 0:00:53
209000 -- (-1015.768) [-1015.071] (-1013.342) (-1014.240) * (-1015.234) (-1014.797) (-1013.032) [-1014.611] -- 0:00:52
209500 -- [-1017.249] (-1015.848) (-1017.712) (-1013.146) * (-1017.422) (-1015.258) (-1015.087) [-1014.835] -- 0:00:52
210000 -- (-1014.462) (-1018.137) (-1012.464) [-1016.877] * (-1014.299) (-1016.464) (-1014.677) [-1013.430] -- 0:00:52
Average standard deviation of split frequencies: 0.017156
210500 -- (-1016.311) (-1016.129) (-1017.605) [-1012.908] * (-1015.750) (-1015.613) [-1014.216] (-1016.491) -- 0:00:52
211000 -- (-1014.302) (-1016.834) (-1016.728) [-1013.454] * (-1014.233) (-1014.282) [-1012.765] (-1017.593) -- 0:00:52
211500 -- (-1013.539) [-1016.440] (-1014.298) (-1014.735) * (-1016.375) [-1014.054] (-1013.613) (-1019.070) -- 0:00:52
212000 -- (-1014.340) [-1014.141] (-1012.677) (-1013.877) * (-1013.501) (-1013.805) [-1013.957] (-1018.115) -- 0:00:52
212500 -- (-1014.210) (-1016.874) [-1014.880] (-1015.440) * (-1013.871) (-1014.320) [-1013.509] (-1016.220) -- 0:00:51
213000 -- [-1013.644] (-1017.292) (-1016.808) (-1013.351) * (-1016.349) (-1016.878) (-1014.561) [-1013.246] -- 0:00:51
213500 -- (-1014.084) (-1017.702) [-1015.700] (-1016.793) * (-1021.578) [-1017.548] (-1017.105) (-1013.764) -- 0:00:51
214000 -- (-1014.017) [-1016.768] (-1019.190) (-1014.086) * (-1016.277) (-1015.786) [-1013.658] (-1014.180) -- 0:00:51
214500 -- (-1013.404) (-1016.975) [-1013.912] (-1016.615) * (-1013.802) [-1013.609] (-1016.275) (-1015.964) -- 0:00:51
215000 -- [-1012.856] (-1016.906) (-1014.315) (-1014.857) * (-1017.314) (-1014.093) [-1016.582] (-1018.936) -- 0:00:51
Average standard deviation of split frequencies: 0.016047
215500 -- (-1012.395) [-1014.067] (-1014.577) (-1015.490) * (-1017.902) (-1017.569) (-1019.034) [-1018.222] -- 0:00:50
216000 -- [-1013.779] (-1018.644) (-1013.507) (-1019.731) * (-1016.107) (-1014.277) (-1012.774) [-1016.550] -- 0:00:50
216500 -- (-1016.401) [-1021.832] (-1016.911) (-1019.511) * (-1014.392) [-1015.432] (-1012.621) (-1016.411) -- 0:00:50
217000 -- (-1015.640) [-1012.400] (-1015.695) (-1015.903) * (-1013.801) [-1016.437] (-1014.217) (-1015.904) -- 0:00:50
217500 -- [-1012.319] (-1015.523) (-1016.348) (-1014.187) * (-1015.637) [-1019.413] (-1014.018) (-1017.352) -- 0:00:50
218000 -- (-1012.509) (-1019.477) (-1023.644) [-1014.171] * (-1013.434) (-1013.785) (-1015.597) [-1014.656] -- 0:00:50
218500 -- (-1015.658) (-1018.581) [-1020.758] (-1017.495) * (-1017.348) (-1014.419) (-1012.781) [-1014.286] -- 0:00:50
219000 -- (-1013.679) [-1016.912] (-1015.189) (-1016.285) * [-1014.821] (-1013.638) (-1018.876) (-1014.287) -- 0:00:49
219500 -- [-1016.100] (-1013.628) (-1014.957) (-1014.892) * (-1015.528) [-1013.364] (-1013.226) (-1014.628) -- 0:00:49
220000 -- (-1015.559) (-1015.253) [-1014.665] (-1015.641) * (-1014.369) [-1014.342] (-1012.883) (-1017.648) -- 0:00:49
Average standard deviation of split frequencies: 0.015488
220500 -- [-1012.558] (-1014.847) (-1017.159) (-1014.496) * [-1015.064] (-1014.004) (-1012.883) (-1015.900) -- 0:00:49
221000 -- (-1013.692) (-1015.111) (-1018.770) [-1015.023] * [-1014.662] (-1013.917) (-1013.847) (-1015.456) -- 0:00:49
221500 -- (-1012.833) (-1014.830) [-1014.305] (-1014.003) * (-1015.333) [-1016.113] (-1016.499) (-1013.740) -- 0:00:49
222000 -- (-1014.528) [-1016.005] (-1014.298) (-1013.832) * (-1017.445) (-1016.686) [-1016.066] (-1016.734) -- 0:00:52
222500 -- (-1012.462) [-1014.478] (-1013.307) (-1017.860) * (-1013.600) [-1020.252] (-1018.102) (-1015.146) -- 0:00:52
223000 -- (-1012.618) [-1017.375] (-1014.088) (-1018.409) * (-1016.516) [-1018.335] (-1017.874) (-1014.938) -- 0:00:52
223500 -- (-1014.967) (-1013.114) [-1013.640] (-1013.135) * (-1015.362) [-1013.470] (-1015.672) (-1019.462) -- 0:00:52
224000 -- (-1015.544) (-1013.880) (-1014.897) [-1013.046] * (-1015.833) [-1013.340] (-1019.958) (-1014.604) -- 0:00:51
224500 -- [-1013.228] (-1014.420) (-1014.499) (-1014.389) * (-1012.961) (-1016.412) (-1020.490) [-1013.898] -- 0:00:51
225000 -- (-1014.535) [-1014.125] (-1013.157) (-1014.774) * (-1013.226) (-1016.112) (-1019.212) [-1015.453] -- 0:00:51
Average standard deviation of split frequencies: 0.015705
225500 -- (-1016.460) (-1013.969) [-1013.142] (-1014.796) * (-1012.969) (-1014.685) (-1014.872) [-1015.311] -- 0:00:51
226000 -- [-1016.595] (-1016.399) (-1013.644) (-1015.516) * (-1018.082) (-1013.555) [-1015.715] (-1016.048) -- 0:00:51
226500 -- (-1013.957) [-1019.568] (-1014.338) (-1017.033) * [-1013.425] (-1014.571) (-1014.971) (-1016.551) -- 0:00:51
227000 -- (-1014.074) (-1017.388) [-1023.437] (-1016.284) * [-1012.488] (-1018.396) (-1013.311) (-1014.158) -- 0:00:51
227500 -- [-1013.583] (-1016.962) (-1016.310) (-1018.990) * (-1012.946) [-1013.926] (-1018.649) (-1013.633) -- 0:00:50
228000 -- [-1019.323] (-1015.229) (-1014.289) (-1018.738) * (-1012.727) [-1013.479] (-1016.481) (-1014.583) -- 0:00:50
228500 -- (-1021.008) [-1014.277] (-1014.649) (-1015.012) * (-1014.585) (-1014.911) (-1015.259) [-1014.012] -- 0:00:50
229000 -- [-1016.381] (-1013.244) (-1013.920) (-1016.257) * (-1017.449) (-1014.448) (-1014.107) [-1015.461] -- 0:00:50
229500 -- [-1018.220] (-1014.365) (-1012.475) (-1014.658) * (-1015.984) (-1014.920) (-1012.941) [-1017.637] -- 0:00:50
230000 -- [-1017.003] (-1013.693) (-1014.785) (-1013.207) * [-1016.556] (-1014.024) (-1012.965) (-1015.382) -- 0:00:50
Average standard deviation of split frequencies: 0.015555
230500 -- (-1015.616) (-1014.480) [-1015.120] (-1013.107) * (-1018.290) [-1014.002] (-1012.929) (-1013.671) -- 0:00:50
231000 -- (-1013.736) (-1014.062) (-1015.456) [-1013.512] * (-1014.800) [-1013.871] (-1013.351) (-1014.324) -- 0:00:49
231500 -- (-1013.791) (-1015.339) [-1015.000] (-1015.260) * [-1014.753] (-1014.773) (-1013.547) (-1014.815) -- 0:00:49
232000 -- [-1014.993] (-1015.244) (-1015.995) (-1017.272) * (-1017.375) (-1015.590) (-1014.648) [-1018.231] -- 0:00:49
232500 -- (-1013.310) (-1013.553) [-1014.647] (-1017.783) * (-1018.854) [-1013.400] (-1015.708) (-1014.964) -- 0:00:49
233000 -- (-1012.869) [-1013.660] (-1013.091) (-1014.899) * [-1015.687] (-1013.254) (-1013.702) (-1014.892) -- 0:00:49
233500 -- [-1013.942] (-1012.961) (-1015.154) (-1013.639) * (-1015.469) [-1013.516] (-1013.063) (-1017.507) -- 0:00:49
234000 -- (-1013.727) (-1015.703) [-1015.071] (-1012.732) * (-1015.028) (-1020.019) (-1015.521) [-1013.526] -- 0:00:49
234500 -- (-1013.782) [-1014.637] (-1014.459) (-1013.145) * (-1016.277) (-1015.363) [-1014.663] (-1014.127) -- 0:00:48
235000 -- [-1016.292] (-1015.968) (-1013.422) (-1015.154) * (-1013.866) (-1012.496) [-1013.992] (-1013.864) -- 0:00:48
Average standard deviation of split frequencies: 0.016424
235500 -- [-1014.683] (-1015.117) (-1013.460) (-1013.006) * (-1013.250) (-1016.863) (-1020.028) [-1015.683] -- 0:00:48
236000 -- (-1013.235) (-1016.714) (-1014.648) [-1015.759] * (-1014.665) (-1015.169) [-1015.308] (-1014.066) -- 0:00:48
236500 -- (-1013.675) (-1015.229) [-1014.283] (-1014.100) * (-1013.326) [-1013.943] (-1014.526) (-1015.924) -- 0:00:48
237000 -- [-1013.075] (-1014.314) (-1013.886) (-1016.053) * (-1015.234) (-1015.127) [-1016.263] (-1017.031) -- 0:00:48
237500 -- (-1012.960) (-1014.583) [-1013.510] (-1014.309) * (-1012.575) [-1017.335] (-1014.013) (-1015.929) -- 0:00:48
238000 -- (-1015.170) [-1013.991] (-1012.865) (-1014.792) * (-1012.644) (-1014.838) (-1013.504) [-1014.525] -- 0:00:48
238500 -- (-1016.904) (-1015.117) [-1014.650] (-1018.798) * [-1014.599] (-1014.258) (-1014.921) (-1016.256) -- 0:00:51
239000 -- (-1015.781) (-1015.557) (-1017.905) [-1018.859] * (-1014.526) (-1014.351) [-1013.928] (-1014.355) -- 0:00:50
239500 -- (-1012.963) (-1014.312) [-1015.538] (-1015.283) * (-1015.582) (-1014.493) [-1015.434] (-1014.252) -- 0:00:50
240000 -- (-1014.943) [-1013.948] (-1013.913) (-1018.526) * (-1015.825) (-1015.773) (-1014.863) [-1014.084] -- 0:00:50
Average standard deviation of split frequencies: 0.015670
240500 -- (-1017.463) [-1013.500] (-1014.116) (-1016.488) * [-1017.551] (-1014.161) (-1012.919) (-1013.456) -- 0:00:50
241000 -- (-1013.509) (-1015.086) [-1015.596] (-1014.022) * (-1016.969) [-1014.775] (-1013.861) (-1014.725) -- 0:00:50
241500 -- (-1014.589) (-1013.862) [-1018.003] (-1012.860) * (-1015.178) [-1013.322] (-1013.762) (-1014.862) -- 0:00:50
242000 -- (-1015.007) [-1014.486] (-1018.782) (-1015.073) * (-1015.558) (-1015.249) (-1016.892) [-1013.966] -- 0:00:50
242500 -- [-1017.452] (-1014.539) (-1019.753) (-1016.901) * (-1013.171) [-1013.417] (-1013.372) (-1013.746) -- 0:00:49
243000 -- (-1015.193) [-1015.056] (-1014.625) (-1016.280) * [-1014.852] (-1014.380) (-1013.187) (-1016.447) -- 0:00:49
243500 -- (-1013.715) [-1015.290] (-1015.882) (-1015.481) * (-1016.821) [-1014.656] (-1012.910) (-1019.411) -- 0:00:49
244000 -- (-1014.705) (-1014.578) (-1015.524) [-1019.258] * [-1013.592] (-1017.308) (-1014.035) (-1016.608) -- 0:00:49
244500 -- (-1014.442) (-1016.915) [-1012.671] (-1014.319) * (-1013.959) (-1015.114) [-1013.206] (-1019.308) -- 0:00:49
245000 -- (-1016.930) [-1015.132] (-1012.946) (-1014.151) * [-1015.620] (-1014.128) (-1014.072) (-1016.216) -- 0:00:49
Average standard deviation of split frequencies: 0.016345
245500 -- (-1016.049) [-1013.853] (-1015.031) (-1016.645) * [-1019.238] (-1013.944) (-1015.612) (-1018.348) -- 0:00:49
246000 -- (-1013.800) [-1013.036] (-1016.149) (-1017.032) * (-1014.872) (-1014.577) (-1016.016) [-1014.832] -- 0:00:49
246500 -- (-1013.933) [-1012.542] (-1013.627) (-1018.866) * [-1014.417] (-1014.594) (-1014.998) (-1014.575) -- 0:00:48
247000 -- (-1015.096) (-1014.511) (-1014.678) [-1014.468] * (-1015.565) (-1013.590) [-1014.004] (-1016.351) -- 0:00:48
247500 -- [-1016.880] (-1014.847) (-1017.306) (-1014.850) * (-1013.370) (-1013.809) (-1014.261) [-1014.815] -- 0:00:48
248000 -- (-1016.594) (-1014.311) (-1017.309) [-1013.539] * (-1017.042) (-1013.653) (-1014.755) [-1013.916] -- 0:00:48
248500 -- (-1014.922) (-1018.485) [-1012.785] (-1016.754) * (-1016.335) (-1013.581) [-1014.592] (-1016.011) -- 0:00:48
249000 -- (-1013.753) (-1014.267) (-1013.289) [-1017.118] * [-1013.958] (-1017.181) (-1014.093) (-1018.150) -- 0:00:48
249500 -- [-1015.400] (-1015.548) (-1014.998) (-1013.007) * (-1019.247) (-1017.752) [-1015.136] (-1015.173) -- 0:00:48
250000 -- (-1017.953) (-1017.849) [-1014.618] (-1014.524) * (-1018.278) (-1012.949) [-1014.675] (-1013.255) -- 0:00:48
Average standard deviation of split frequencies: 0.016925
250500 -- (-1017.915) (-1016.511) [-1014.562] (-1017.452) * [-1015.391] (-1014.445) (-1013.928) (-1015.231) -- 0:00:47
251000 -- (-1016.696) (-1012.850) (-1020.525) [-1014.562] * [-1014.359] (-1018.325) (-1017.068) (-1017.447) -- 0:00:47
251500 -- (-1019.898) [-1016.831] (-1014.190) (-1014.964) * [-1012.936] (-1015.170) (-1014.543) (-1013.764) -- 0:00:47
252000 -- (-1018.776) (-1013.238) (-1013.979) [-1013.770] * (-1013.795) (-1015.854) (-1018.755) [-1012.865] -- 0:00:47
252500 -- [-1013.455] (-1015.778) (-1013.784) (-1013.142) * (-1013.314) (-1018.051) [-1015.844] (-1013.330) -- 0:00:47
253000 -- (-1014.943) (-1014.262) [-1014.211] (-1015.867) * (-1015.275) [-1014.667] (-1013.999) (-1015.394) -- 0:00:47
253500 -- (-1015.051) (-1016.689) [-1014.511] (-1013.866) * (-1015.116) (-1014.689) (-1014.059) [-1013.626] -- 0:00:47
254000 -- (-1012.396) (-1019.766) (-1015.010) [-1015.051] * (-1013.580) (-1014.727) (-1013.517) [-1014.917] -- 0:00:46
254500 -- [-1014.778] (-1015.070) (-1015.724) (-1017.323) * (-1016.590) (-1014.046) (-1016.129) [-1015.930] -- 0:00:46
255000 -- (-1012.675) (-1016.062) [-1014.751] (-1015.102) * (-1016.566) (-1014.524) [-1013.942] (-1012.709) -- 0:00:49
Average standard deviation of split frequencies: 0.015923
255500 -- (-1014.046) (-1014.412) (-1014.876) [-1014.907] * (-1015.348) [-1012.594] (-1013.439) (-1012.365) -- 0:00:49
256000 -- (-1017.229) (-1017.933) [-1012.481] (-1015.044) * (-1015.570) (-1013.937) (-1015.401) [-1013.694] -- 0:00:49
256500 -- (-1016.184) (-1016.323) (-1013.280) [-1015.497] * (-1015.405) [-1015.217] (-1019.102) (-1013.865) -- 0:00:49
257000 -- (-1015.288) (-1015.932) [-1013.100] (-1015.678) * (-1016.933) (-1016.034) (-1014.663) [-1017.743] -- 0:00:49
257500 -- (-1013.328) [-1013.569] (-1013.846) (-1014.577) * [-1015.592] (-1014.513) (-1017.892) (-1013.761) -- 0:00:49
258000 -- (-1013.656) (-1019.037) (-1013.783) [-1014.332] * [-1015.671] (-1015.536) (-1020.503) (-1014.804) -- 0:00:48
258500 -- (-1013.158) (-1014.483) [-1014.175] (-1016.852) * (-1016.582) (-1014.727) [-1013.843] (-1015.239) -- 0:00:48
259000 -- (-1013.647) (-1015.108) (-1015.907) [-1012.874] * (-1013.852) [-1013.745] (-1015.372) (-1015.444) -- 0:00:48
259500 -- (-1013.107) [-1016.529] (-1013.456) (-1014.956) * [-1012.981] (-1014.379) (-1013.033) (-1016.762) -- 0:00:48
260000 -- (-1017.516) [-1018.969] (-1012.502) (-1015.254) * (-1014.466) (-1014.652) (-1016.834) [-1015.741] -- 0:00:48
Average standard deviation of split frequencies: 0.016477
260500 -- (-1015.565) [-1015.926] (-1014.989) (-1013.902) * (-1014.054) (-1022.932) [-1013.232] (-1013.042) -- 0:00:48
261000 -- (-1013.476) (-1014.538) (-1012.842) [-1014.724] * (-1015.727) (-1013.230) (-1014.915) [-1013.859] -- 0:00:48
261500 -- (-1012.807) (-1020.295) (-1014.157) [-1014.513] * [-1015.589] (-1019.716) (-1013.751) (-1015.374) -- 0:00:48
262000 -- (-1012.546) [-1017.318] (-1016.361) (-1012.947) * (-1015.273) (-1017.281) [-1014.002] (-1016.960) -- 0:00:47
262500 -- (-1013.480) (-1017.066) (-1017.290) [-1015.426] * (-1012.840) (-1014.961) (-1014.177) [-1014.778] -- 0:00:47
263000 -- (-1013.482) (-1014.057) [-1015.225] (-1017.473) * (-1014.924) (-1014.742) (-1014.996) [-1014.580] -- 0:00:47
263500 -- [-1013.909] (-1013.627) (-1015.071) (-1015.599) * (-1016.488) [-1014.800] (-1015.277) (-1013.230) -- 0:00:47
264000 -- (-1015.475) (-1014.348) (-1014.418) [-1016.749] * (-1013.322) (-1015.725) (-1018.483) [-1013.440] -- 0:00:47
264500 -- [-1015.109] (-1015.972) (-1015.449) (-1019.860) * [-1014.900] (-1019.315) (-1016.583) (-1014.447) -- 0:00:47
265000 -- [-1017.193] (-1017.658) (-1012.597) (-1012.891) * (-1015.274) (-1016.367) (-1014.121) [-1013.913] -- 0:00:47
Average standard deviation of split frequencies: 0.015851
265500 -- (-1013.056) (-1015.175) (-1013.275) [-1014.431] * (-1016.102) [-1013.267] (-1015.980) (-1015.520) -- 0:00:47
266000 -- (-1013.284) (-1013.895) (-1015.634) [-1012.612] * (-1018.381) [-1014.031] (-1012.821) (-1015.008) -- 0:00:46
266500 -- (-1015.613) [-1015.854] (-1016.779) (-1013.538) * (-1013.994) [-1016.033] (-1016.919) (-1016.263) -- 0:00:46
267000 -- (-1014.326) (-1016.954) (-1014.373) [-1013.609] * [-1013.067] (-1013.090) (-1016.501) (-1017.121) -- 0:00:46
267500 -- (-1014.787) (-1018.599) [-1014.397] (-1014.495) * (-1013.525) (-1014.301) [-1012.977] (-1015.420) -- 0:00:46
268000 -- [-1015.424] (-1016.431) (-1018.463) (-1013.413) * (-1014.222) (-1015.646) (-1013.187) [-1012.861] -- 0:00:46
268500 -- (-1015.326) (-1017.961) (-1014.867) [-1015.157] * (-1013.158) (-1016.825) [-1014.667] (-1016.503) -- 0:00:46
269000 -- (-1017.283) (-1016.447) (-1014.421) [-1013.686] * [-1014.042] (-1014.612) (-1013.231) (-1023.522) -- 0:00:46
269500 -- [-1015.855] (-1017.532) (-1015.011) (-1016.587) * (-1013.189) (-1014.517) [-1015.772] (-1014.033) -- 0:00:46
270000 -- [-1020.715] (-1014.554) (-1017.075) (-1015.960) * (-1017.283) (-1015.354) [-1013.951] (-1017.390) -- 0:00:45
Average standard deviation of split frequencies: 0.016159
270500 -- (-1021.088) [-1014.911] (-1014.380) (-1014.370) * (-1016.075) (-1015.561) (-1013.547) [-1015.988] -- 0:00:45
271000 -- (-1014.124) (-1015.436) (-1015.131) [-1013.753] * (-1016.057) (-1018.184) [-1016.057] (-1014.612) -- 0:00:45
271500 -- (-1014.188) (-1014.576) [-1015.752] (-1014.385) * [-1015.616] (-1016.114) (-1016.286) (-1016.662) -- 0:00:48
272000 -- (-1014.163) (-1014.247) [-1015.686] (-1014.417) * (-1015.397) (-1015.631) [-1014.511] (-1015.140) -- 0:00:48
272500 -- (-1014.578) (-1014.153) [-1014.722] (-1013.871) * [-1021.423] (-1016.974) (-1013.052) (-1014.221) -- 0:00:48
273000 -- (-1014.414) (-1016.224) [-1014.572] (-1022.781) * (-1014.368) (-1021.444) [-1013.294] (-1019.041) -- 0:00:47
273500 -- (-1013.117) [-1017.538] (-1013.404) (-1021.790) * (-1015.899) (-1017.097) (-1015.201) [-1022.626] -- 0:00:47
274000 -- (-1013.013) [-1016.518] (-1013.387) (-1018.352) * (-1017.809) [-1014.744] (-1015.714) (-1014.002) -- 0:00:47
274500 -- [-1013.739] (-1014.403) (-1013.927) (-1016.178) * [-1014.130] (-1014.444) (-1013.702) (-1013.258) -- 0:00:47
275000 -- (-1014.374) (-1016.871) [-1016.026] (-1013.735) * (-1016.928) (-1016.627) [-1013.849] (-1015.141) -- 0:00:47
Average standard deviation of split frequencies: 0.015573
275500 -- (-1013.642) [-1016.042] (-1014.701) (-1016.391) * (-1015.987) (-1020.297) [-1016.936] (-1016.458) -- 0:00:47
276000 -- [-1016.411] (-1014.779) (-1013.637) (-1019.514) * (-1016.244) (-1017.161) [-1013.695] (-1016.165) -- 0:00:47
276500 -- (-1017.566) [-1014.634] (-1013.084) (-1014.451) * (-1013.870) (-1017.631) [-1014.851] (-1014.212) -- 0:00:47
277000 -- (-1018.416) [-1013.865] (-1012.732) (-1014.214) * [-1014.278] (-1016.293) (-1014.231) (-1014.130) -- 0:00:46
277500 -- (-1015.947) (-1014.929) (-1012.701) [-1018.633] * (-1016.066) (-1014.313) (-1014.246) [-1013.457] -- 0:00:46
278000 -- [-1012.732] (-1014.800) (-1015.481) (-1020.881) * (-1018.377) [-1013.221] (-1015.171) (-1015.808) -- 0:00:46
278500 -- (-1012.660) [-1014.683] (-1017.524) (-1018.147) * (-1014.040) [-1012.873] (-1017.962) (-1017.868) -- 0:00:46
279000 -- (-1013.476) (-1013.426) (-1016.927) [-1016.718] * (-1015.669) (-1014.566) [-1016.753] (-1019.188) -- 0:00:46
279500 -- [-1013.868] (-1014.744) (-1015.451) (-1012.916) * [-1015.565] (-1013.311) (-1014.820) (-1016.103) -- 0:00:46
280000 -- (-1016.115) (-1012.974) (-1015.589) [-1014.071] * (-1016.031) [-1013.930] (-1015.505) (-1014.214) -- 0:00:46
Average standard deviation of split frequencies: 0.015610
280500 -- [-1014.178] (-1013.059) (-1018.404) (-1014.842) * [-1017.418] (-1016.437) (-1013.608) (-1016.790) -- 0:00:46
281000 -- [-1013.319] (-1014.561) (-1015.325) (-1013.536) * (-1014.535) (-1013.133) (-1013.387) [-1017.012] -- 0:00:46
281500 -- (-1017.085) (-1015.678) [-1015.929] (-1014.100) * (-1014.971) (-1013.371) (-1012.640) [-1013.970] -- 0:00:45
282000 -- (-1016.660) [-1013.876] (-1016.047) (-1014.749) * (-1015.420) (-1013.207) [-1015.438] (-1014.352) -- 0:00:45
282500 -- [-1014.523] (-1015.206) (-1015.768) (-1013.455) * (-1014.689) (-1014.647) [-1014.558] (-1015.216) -- 0:00:45
283000 -- (-1018.224) (-1015.293) (-1013.194) [-1015.049] * (-1013.094) [-1014.042] (-1015.429) (-1014.162) -- 0:00:45
283500 -- (-1016.661) (-1015.554) (-1014.395) [-1014.932] * (-1016.053) (-1012.898) (-1014.584) [-1016.742] -- 0:00:45
284000 -- (-1017.322) [-1013.951] (-1016.114) (-1015.656) * (-1015.638) (-1012.754) (-1019.981) [-1015.867] -- 0:00:45
284500 -- (-1014.869) (-1014.534) (-1013.427) [-1013.965] * (-1019.302) [-1013.752] (-1017.152) (-1014.791) -- 0:00:47
285000 -- (-1015.507) (-1014.350) [-1013.075] (-1013.950) * [-1015.838] (-1013.925) (-1014.110) (-1015.036) -- 0:00:47
Average standard deviation of split frequencies: 0.015416
285500 -- (-1013.831) (-1016.592) [-1013.808] (-1016.921) * (-1014.663) (-1016.606) (-1014.307) [-1014.694] -- 0:00:47
286000 -- (-1013.901) (-1015.458) [-1012.813] (-1013.492) * (-1016.346) [-1014.371] (-1014.425) (-1015.504) -- 0:00:47
286500 -- (-1016.322) (-1014.063) (-1013.534) [-1012.858] * [-1016.104] (-1020.957) (-1015.776) (-1017.651) -- 0:00:47
287000 -- (-1013.742) (-1013.036) (-1013.791) [-1013.921] * (-1014.854) [-1015.907] (-1017.098) (-1013.439) -- 0:00:47
287500 -- (-1015.538) (-1015.039) [-1013.134] (-1016.995) * (-1014.556) (-1015.270) (-1015.013) [-1013.872] -- 0:00:47
288000 -- (-1014.418) (-1014.045) (-1017.066) [-1015.103] * (-1014.053) [-1013.377] (-1013.465) (-1014.061) -- 0:00:46
288500 -- [-1016.263] (-1014.069) (-1014.970) (-1016.927) * (-1014.546) (-1013.468) [-1015.996] (-1013.775) -- 0:00:46
289000 -- (-1015.443) [-1014.844] (-1013.514) (-1019.305) * [-1013.936] (-1017.276) (-1018.678) (-1016.087) -- 0:00:46
289500 -- [-1013.518] (-1015.897) (-1015.889) (-1013.654) * (-1013.986) (-1016.724) (-1013.896) [-1016.996] -- 0:00:46
290000 -- (-1014.176) [-1013.821] (-1015.094) (-1013.531) * [-1015.362] (-1017.878) (-1015.903) (-1015.607) -- 0:00:46
Average standard deviation of split frequencies: 0.015407
290500 -- [-1016.852] (-1014.186) (-1016.050) (-1016.426) * [-1015.784] (-1016.271) (-1015.997) (-1016.894) -- 0:00:46
291000 -- (-1017.395) (-1013.670) (-1012.471) [-1016.255] * (-1017.055) (-1015.760) (-1015.195) [-1012.636] -- 0:00:46
291500 -- [-1013.956] (-1013.992) (-1012.432) (-1017.515) * (-1015.192) (-1014.422) (-1012.674) [-1014.588] -- 0:00:46
292000 -- [-1014.343] (-1013.662) (-1012.373) (-1016.405) * (-1017.993) (-1017.701) [-1014.204] (-1014.292) -- 0:00:46
292500 -- (-1013.213) [-1013.240] (-1012.718) (-1016.447) * [-1014.621] (-1014.474) (-1020.771) (-1015.368) -- 0:00:45
293000 -- [-1014.243] (-1018.290) (-1015.019) (-1013.910) * (-1013.850) (-1017.035) [-1012.924] (-1016.426) -- 0:00:45
293500 -- (-1015.779) (-1014.693) [-1016.212] (-1013.933) * [-1014.377] (-1022.944) (-1014.171) (-1015.241) -- 0:00:45
294000 -- (-1012.927) (-1013.484) [-1014.425] (-1016.419) * (-1012.871) (-1013.685) [-1017.118] (-1017.270) -- 0:00:45
294500 -- (-1012.879) (-1012.812) (-1013.998) [-1016.662] * (-1015.055) [-1014.950] (-1013.816) (-1015.218) -- 0:00:45
295000 -- (-1018.600) (-1013.492) [-1012.710] (-1013.744) * (-1013.434) (-1013.883) [-1013.914] (-1014.653) -- 0:00:45
Average standard deviation of split frequencies: 0.014802
295500 -- (-1023.153) (-1012.669) [-1013.497] (-1013.288) * (-1014.529) (-1013.779) (-1018.826) [-1014.748] -- 0:00:45
296000 -- (-1017.027) (-1019.227) [-1015.207] (-1014.316) * (-1013.428) [-1013.440] (-1018.648) (-1016.013) -- 0:00:45
296500 -- (-1015.769) (-1020.084) [-1014.877] (-1014.393) * (-1014.169) [-1012.918] (-1021.266) (-1016.903) -- 0:00:45
297000 -- [-1013.050] (-1013.266) (-1015.963) (-1014.118) * (-1015.361) (-1021.869) [-1014.956] (-1017.340) -- 0:00:44
297500 -- (-1014.687) (-1015.291) [-1014.020] (-1013.751) * [-1012.874] (-1020.244) (-1015.619) (-1019.686) -- 0:00:44
298000 -- (-1015.188) [-1016.626] (-1014.150) (-1014.166) * [-1013.175] (-1012.888) (-1016.654) (-1015.838) -- 0:00:44
298500 -- [-1013.713] (-1014.524) (-1013.578) (-1012.752) * (-1018.028) (-1016.882) [-1015.085] (-1013.998) -- 0:00:47
299000 -- [-1014.535] (-1016.962) (-1014.223) (-1016.340) * (-1013.561) [-1012.878] (-1014.925) (-1013.926) -- 0:00:46
299500 -- (-1018.402) (-1015.780) (-1019.630) [-1012.420] * [-1014.453] (-1014.647) (-1013.246) (-1016.774) -- 0:00:46
300000 -- (-1019.563) [-1015.814] (-1012.704) (-1016.817) * (-1014.660) [-1014.961] (-1014.465) (-1012.919) -- 0:00:46
Average standard deviation of split frequencies: 0.013742
300500 -- (-1016.766) [-1016.282] (-1013.327) (-1014.466) * (-1014.193) [-1013.787] (-1014.431) (-1013.080) -- 0:00:46
301000 -- (-1014.874) (-1016.323) [-1019.456] (-1018.073) * (-1013.501) (-1013.621) (-1013.866) [-1013.874] -- 0:00:46
301500 -- [-1015.288] (-1013.311) (-1015.510) (-1015.780) * (-1016.065) [-1016.276] (-1015.781) (-1018.546) -- 0:00:46
302000 -- (-1012.926) [-1012.802] (-1012.547) (-1013.122) * (-1016.091) (-1017.016) [-1018.873] (-1014.003) -- 0:00:46
302500 -- (-1013.569) (-1013.847) (-1013.376) [-1012.645] * (-1016.126) [-1014.453] (-1020.756) (-1014.249) -- 0:00:46
303000 -- (-1014.135) (-1012.906) [-1015.246] (-1017.083) * [-1015.204] (-1012.561) (-1017.680) (-1016.265) -- 0:00:46
303500 -- [-1015.916] (-1014.771) (-1014.122) (-1016.552) * [-1015.096] (-1012.408) (-1014.086) (-1015.880) -- 0:00:45
304000 -- (-1014.642) [-1016.331] (-1014.049) (-1017.751) * (-1014.185) [-1013.191] (-1014.643) (-1016.500) -- 0:00:45
304500 -- (-1018.979) (-1016.931) (-1013.042) [-1013.770] * [-1014.384] (-1013.399) (-1013.662) (-1016.419) -- 0:00:45
305000 -- [-1016.052] (-1018.886) (-1014.279) (-1014.610) * (-1013.855) [-1013.439] (-1016.761) (-1017.438) -- 0:00:45
Average standard deviation of split frequencies: 0.013351
305500 -- (-1015.466) (-1014.669) [-1013.474] (-1018.762) * (-1014.476) (-1014.261) (-1015.127) [-1018.393] -- 0:00:45
306000 -- (-1017.514) [-1014.306] (-1017.680) (-1017.452) * [-1016.106] (-1013.427) (-1016.050) (-1014.310) -- 0:00:45
306500 -- (-1019.253) (-1015.111) (-1016.571) [-1014.336] * [-1015.409] (-1014.254) (-1017.545) (-1014.035) -- 0:00:45
307000 -- [-1013.969] (-1013.920) (-1014.409) (-1013.262) * [-1013.062] (-1014.003) (-1020.109) (-1013.465) -- 0:00:45
307500 -- (-1017.134) [-1012.884] (-1017.628) (-1015.415) * (-1015.943) (-1015.229) [-1014.860] (-1014.097) -- 0:00:45
308000 -- (-1021.315) (-1012.300) [-1013.379] (-1014.822) * [-1015.595] (-1018.078) (-1019.055) (-1016.330) -- 0:00:44
308500 -- (-1014.515) (-1012.377) (-1013.881) [-1014.119] * (-1017.504) [-1015.278] (-1015.256) (-1016.675) -- 0:00:44
309000 -- [-1019.451] (-1013.822) (-1017.388) (-1014.693) * (-1017.826) (-1014.566) (-1014.249) [-1013.888] -- 0:00:44
309500 -- (-1014.542) (-1014.606) (-1017.143) [-1014.099] * (-1016.963) (-1013.591) (-1013.548) [-1013.071] -- 0:00:44
310000 -- [-1015.361] (-1014.302) (-1019.335) (-1015.085) * (-1015.837) (-1015.727) (-1012.875) [-1013.146] -- 0:00:44
Average standard deviation of split frequencies: 0.014500
310500 -- (-1012.843) (-1012.732) [-1013.782] (-1013.886) * (-1014.315) (-1014.178) [-1017.002] (-1017.778) -- 0:00:44
311000 -- [-1012.655] (-1014.964) (-1015.438) (-1019.493) * (-1013.017) (-1013.456) [-1014.127] (-1017.140) -- 0:00:46
311500 -- (-1013.221) (-1017.439) (-1016.589) [-1017.556] * [-1014.721] (-1013.441) (-1016.025) (-1018.423) -- 0:00:46
312000 -- (-1012.434) [-1013.851] (-1015.557) (-1014.179) * [-1015.161] (-1014.049) (-1013.907) (-1015.443) -- 0:00:46
312500 -- (-1014.249) (-1013.610) (-1020.600) [-1014.788] * [-1015.227] (-1012.514) (-1013.536) (-1013.196) -- 0:00:46
313000 -- (-1014.081) (-1016.915) (-1017.094) [-1015.907] * (-1019.758) (-1012.947) (-1017.736) [-1013.756] -- 0:00:46
313500 -- [-1012.988] (-1014.463) (-1013.609) (-1017.799) * [-1014.245] (-1017.337) (-1013.955) (-1013.262) -- 0:00:45
314000 -- (-1014.254) (-1015.112) [-1014.717] (-1012.757) * (-1013.146) [-1016.743] (-1015.998) (-1015.116) -- 0:00:45
314500 -- (-1016.032) (-1014.539) (-1019.478) [-1014.920] * [-1013.797] (-1013.803) (-1014.381) (-1016.275) -- 0:00:45
315000 -- (-1013.323) [-1012.915] (-1018.658) (-1014.120) * (-1014.165) [-1012.997] (-1017.346) (-1019.350) -- 0:00:45
Average standard deviation of split frequencies: 0.013675
315500 -- (-1013.281) (-1012.992) [-1014.967] (-1013.093) * (-1013.425) [-1013.321] (-1012.786) (-1016.118) -- 0:00:45
316000 -- (-1013.308) (-1013.054) [-1014.254] (-1013.443) * [-1013.293] (-1014.894) (-1017.615) (-1016.918) -- 0:00:45
316500 -- (-1013.024) (-1013.770) [-1014.635] (-1014.286) * (-1013.734) (-1016.029) [-1020.303] (-1015.921) -- 0:00:45
317000 -- (-1012.977) (-1015.620) [-1012.749] (-1015.546) * (-1015.043) (-1014.867) (-1018.176) [-1014.563] -- 0:00:45
317500 -- [-1013.586] (-1014.678) (-1015.446) (-1015.337) * [-1014.240] (-1013.870) (-1022.681) (-1014.634) -- 0:00:45
318000 -- [-1012.835] (-1013.155) (-1015.772) (-1021.312) * (-1019.944) [-1016.168] (-1014.613) (-1013.781) -- 0:00:45
318500 -- (-1013.024) (-1015.887) (-1014.233) [-1017.653] * (-1017.786) [-1014.823] (-1014.232) (-1014.811) -- 0:00:44
319000 -- (-1012.742) (-1014.775) [-1013.877] (-1014.785) * (-1013.270) [-1012.678] (-1016.095) (-1015.175) -- 0:00:44
319500 -- (-1015.540) (-1017.778) [-1013.409] (-1018.049) * (-1014.369) [-1012.932] (-1016.092) (-1017.067) -- 0:00:44
320000 -- (-1015.183) [-1015.649] (-1014.054) (-1015.209) * [-1018.662] (-1013.010) (-1014.515) (-1015.241) -- 0:00:44
Average standard deviation of split frequencies: 0.013884
320500 -- (-1013.212) (-1014.022) (-1017.036) [-1015.804] * (-1015.209) (-1012.743) (-1014.639) [-1013.488] -- 0:00:44
321000 -- (-1017.461) [-1015.147] (-1015.209) (-1015.696) * (-1019.678) (-1014.235) (-1013.719) [-1013.642] -- 0:00:44
321500 -- (-1012.546) (-1013.702) (-1015.159) [-1013.737] * (-1016.913) (-1013.405) (-1012.952) [-1014.103] -- 0:00:44
322000 -- (-1017.704) [-1015.912] (-1014.927) (-1013.729) * (-1015.138) (-1014.240) [-1012.988] (-1015.014) -- 0:00:44
322500 -- (-1017.782) [-1018.399] (-1016.091) (-1016.338) * (-1014.977) [-1013.720] (-1014.481) (-1017.712) -- 0:00:44
323000 -- (-1015.855) [-1018.914] (-1014.937) (-1015.689) * [-1015.428] (-1012.854) (-1013.057) (-1018.830) -- 0:00:44
323500 -- [-1014.862] (-1013.811) (-1019.889) (-1013.077) * (-1018.008) (-1012.926) [-1013.138] (-1012.597) -- 0:00:43
324000 -- (-1013.431) (-1012.383) (-1018.772) [-1012.874] * (-1014.318) (-1012.776) (-1014.238) [-1014.135] -- 0:00:45
324500 -- [-1013.283] (-1014.155) (-1015.308) (-1017.453) * (-1014.950) [-1012.781] (-1015.597) (-1016.849) -- 0:00:45
325000 -- (-1013.416) [-1017.556] (-1016.447) (-1015.624) * (-1014.416) [-1013.140] (-1017.902) (-1014.033) -- 0:00:45
Average standard deviation of split frequencies: 0.014139
325500 -- (-1015.857) [-1012.759] (-1012.928) (-1015.363) * (-1021.366) [-1014.301] (-1013.356) (-1014.269) -- 0:00:45
326000 -- [-1015.515] (-1013.910) (-1013.075) (-1015.895) * (-1015.304) (-1014.687) [-1013.063] (-1015.406) -- 0:00:45
326500 -- (-1013.789) (-1014.393) (-1012.869) [-1016.559] * (-1017.779) (-1015.029) [-1014.579] (-1016.813) -- 0:00:45
327000 -- (-1018.931) (-1016.285) [-1015.883] (-1015.059) * (-1013.370) (-1015.607) (-1013.021) [-1013.353] -- 0:00:45
327500 -- (-1017.991) [-1014.456] (-1016.672) (-1015.781) * (-1013.437) (-1013.641) [-1013.671] (-1013.464) -- 0:00:45
328000 -- [-1020.770] (-1014.977) (-1018.171) (-1019.060) * [-1012.292] (-1012.851) (-1013.812) (-1013.372) -- 0:00:45
328500 -- (-1015.488) (-1014.137) (-1014.536) [-1014.966] * [-1018.462] (-1013.345) (-1018.147) (-1019.275) -- 0:00:44
329000 -- [-1013.684] (-1015.801) (-1017.519) (-1016.218) * [-1014.256] (-1014.599) (-1018.999) (-1013.992) -- 0:00:44
329500 -- (-1013.415) [-1014.633] (-1016.268) (-1014.565) * (-1013.673) [-1013.303] (-1014.765) (-1018.909) -- 0:00:44
330000 -- (-1014.295) (-1013.408) [-1014.891] (-1015.750) * (-1014.478) (-1013.054) [-1014.561] (-1019.885) -- 0:00:44
Average standard deviation of split frequencies: 0.014573
330500 -- [-1018.778] (-1017.612) (-1015.023) (-1013.667) * (-1013.525) (-1014.665) [-1013.190] (-1019.125) -- 0:00:44
331000 -- (-1017.462) (-1012.814) [-1013.064] (-1015.217) * [-1012.625] (-1012.695) (-1013.383) (-1018.810) -- 0:00:44
331500 -- (-1012.729) (-1013.187) [-1015.738] (-1016.419) * (-1012.535) [-1015.478] (-1018.341) (-1017.044) -- 0:00:44
332000 -- (-1012.864) (-1015.751) [-1016.981] (-1022.340) * (-1012.434) (-1016.336) (-1019.721) [-1014.637] -- 0:00:44
332500 -- [-1014.840] (-1013.829) (-1013.265) (-1014.935) * (-1014.555) [-1016.473] (-1015.303) (-1015.593) -- 0:00:44
333000 -- [-1017.228] (-1015.963) (-1017.552) (-1015.659) * [-1014.180] (-1016.263) (-1012.692) (-1017.462) -- 0:00:44
333500 -- [-1015.243] (-1015.826) (-1015.908) (-1015.470) * (-1016.027) (-1017.637) (-1013.807) [-1013.198] -- 0:00:43
334000 -- (-1016.886) (-1014.860) [-1019.140] (-1014.500) * (-1017.173) (-1014.635) [-1013.310] (-1018.494) -- 0:00:43
334500 -- [-1016.384] (-1012.589) (-1016.754) (-1014.173) * [-1017.805] (-1015.874) (-1013.236) (-1019.973) -- 0:00:43
335000 -- (-1017.716) (-1015.170) [-1014.606] (-1013.915) * (-1013.786) (-1016.120) (-1020.803) [-1015.753] -- 0:00:43
Average standard deviation of split frequencies: 0.014653
335500 -- (-1013.577) [-1015.415] (-1014.909) (-1014.968) * (-1014.790) [-1015.706] (-1019.977) (-1014.490) -- 0:00:43
336000 -- (-1013.338) (-1015.699) (-1013.189) [-1013.504] * (-1017.599) (-1016.616) [-1015.372] (-1014.669) -- 0:00:45
336500 -- (-1017.694) [-1013.604] (-1014.333) (-1016.404) * (-1014.266) (-1016.480) [-1013.251] (-1014.307) -- 0:00:45
337000 -- (-1017.618) (-1013.211) (-1012.983) [-1015.861] * (-1012.965) (-1012.895) [-1013.277] (-1016.081) -- 0:00:45
337500 -- (-1019.120) (-1013.148) [-1014.237] (-1017.101) * (-1013.325) [-1016.297] (-1014.562) (-1015.552) -- 0:00:45
338000 -- (-1018.925) [-1015.004] (-1012.715) (-1015.337) * (-1014.985) [-1015.720] (-1013.827) (-1014.553) -- 0:00:45
338500 -- (-1019.499) (-1013.803) (-1012.695) [-1014.987] * (-1015.373) [-1015.337] (-1014.436) (-1016.041) -- 0:00:44
339000 -- [-1013.873] (-1013.226) (-1012.852) (-1014.758) * (-1017.108) (-1016.336) (-1014.453) [-1016.128] -- 0:00:44
339500 -- (-1012.467) (-1014.122) (-1014.283) [-1013.963] * (-1019.125) (-1020.668) [-1014.082] (-1015.282) -- 0:00:44
340000 -- (-1015.222) [-1013.276] (-1013.916) (-1014.070) * (-1015.003) (-1021.578) [-1016.677] (-1016.306) -- 0:00:44
Average standard deviation of split frequencies: 0.013991
340500 -- [-1013.585] (-1013.859) (-1015.111) (-1014.831) * (-1014.321) (-1017.534) (-1015.911) [-1017.646] -- 0:00:44
341000 -- [-1014.888] (-1015.514) (-1013.621) (-1013.647) * (-1013.850) (-1015.665) [-1012.911] (-1014.324) -- 0:00:44
341500 -- (-1018.074) (-1014.155) [-1015.487] (-1012.950) * (-1013.147) (-1013.095) [-1018.545] (-1018.608) -- 0:00:44
342000 -- (-1016.689) [-1015.780] (-1019.801) (-1022.935) * (-1015.196) [-1017.480] (-1016.281) (-1014.337) -- 0:00:44
342500 -- (-1014.128) (-1014.189) [-1014.184] (-1013.465) * [-1013.125] (-1018.834) (-1012.762) (-1013.009) -- 0:00:44
343000 -- (-1016.201) (-1016.346) (-1013.870) [-1015.488] * (-1012.845) [-1015.541] (-1014.519) (-1013.113) -- 0:00:44
343500 -- (-1017.225) [-1015.522] (-1014.912) (-1013.326) * (-1013.802) (-1019.657) (-1013.983) [-1014.311] -- 0:00:43
344000 -- (-1014.262) [-1014.094] (-1015.384) (-1013.655) * (-1015.895) (-1013.481) [-1015.867] (-1016.295) -- 0:00:43
344500 -- [-1017.696] (-1013.871) (-1013.506) (-1013.516) * [-1017.506] (-1014.754) (-1015.750) (-1015.741) -- 0:00:43
345000 -- (-1013.366) [-1013.804] (-1013.269) (-1019.235) * [-1015.599] (-1014.243) (-1014.551) (-1016.122) -- 0:00:43
Average standard deviation of split frequencies: 0.013624
345500 -- (-1012.860) [-1012.750] (-1013.269) (-1013.727) * (-1013.648) [-1015.746] (-1013.085) (-1016.096) -- 0:00:43
346000 -- (-1013.723) (-1018.091) (-1013.258) [-1015.803] * (-1013.359) (-1015.280) (-1016.446) [-1014.028] -- 0:00:43
346500 -- (-1016.307) (-1016.696) [-1012.753] (-1015.215) * (-1014.988) (-1017.149) [-1019.764] (-1013.319) -- 0:00:43
347000 -- (-1016.665) (-1016.935) (-1013.180) [-1012.608] * (-1016.480) (-1019.277) (-1015.049) [-1016.044] -- 0:00:43
347500 -- (-1015.247) [-1014.987] (-1016.322) (-1012.967) * (-1023.600) (-1013.434) (-1014.081) [-1015.351] -- 0:00:43
348000 -- [-1014.855] (-1015.550) (-1015.388) (-1014.318) * (-1017.490) [-1013.328] (-1013.356) (-1015.202) -- 0:00:43
348500 -- (-1015.506) [-1016.216] (-1014.913) (-1015.724) * (-1016.461) [-1013.973] (-1013.842) (-1016.735) -- 0:00:42
349000 -- (-1019.258) (-1015.891) (-1017.599) [-1017.037] * [-1013.801] (-1021.327) (-1013.770) (-1014.758) -- 0:00:42
349500 -- (-1012.721) (-1016.449) (-1015.847) [-1013.771] * (-1013.278) (-1013.789) [-1013.204] (-1013.402) -- 0:00:44
350000 -- (-1013.671) (-1015.283) [-1015.634] (-1014.288) * [-1012.508] (-1015.362) (-1015.093) (-1013.385) -- 0:00:44
Average standard deviation of split frequencies: 0.013891
350500 -- (-1015.889) [-1014.844] (-1013.547) (-1017.525) * (-1013.493) [-1012.475] (-1015.901) (-1013.931) -- 0:00:44
351000 -- [-1015.002] (-1013.978) (-1015.404) (-1016.064) * (-1018.754) (-1015.396) [-1017.633] (-1013.813) -- 0:00:44
351500 -- [-1014.022] (-1013.284) (-1015.964) (-1013.415) * (-1012.510) [-1016.997] (-1013.871) (-1014.973) -- 0:00:44
352000 -- (-1014.748) (-1012.628) [-1015.396] (-1013.799) * (-1012.374) (-1015.238) [-1017.946] (-1013.448) -- 0:00:44
352500 -- (-1015.952) (-1017.054) (-1017.076) [-1016.873] * (-1013.769) (-1014.320) [-1012.466] (-1014.393) -- 0:00:44
353000 -- (-1014.255) (-1013.745) [-1014.144] (-1015.597) * [-1014.321] (-1013.975) (-1014.456) (-1016.463) -- 0:00:43
353500 -- (-1013.962) [-1015.614] (-1018.119) (-1014.965) * [-1016.518] (-1012.958) (-1014.547) (-1015.550) -- 0:00:43
354000 -- (-1014.723) [-1018.293] (-1017.667) (-1016.785) * [-1015.584] (-1013.921) (-1016.069) (-1019.179) -- 0:00:43
354500 -- [-1014.077] (-1015.345) (-1014.145) (-1014.194) * (-1019.704) [-1015.370] (-1016.403) (-1016.831) -- 0:00:43
355000 -- (-1012.767) [-1013.717] (-1013.927) (-1019.054) * (-1014.369) (-1012.880) [-1014.454] (-1013.201) -- 0:00:43
Average standard deviation of split frequencies: 0.013683
355500 -- (-1017.195) [-1015.433] (-1016.592) (-1016.782) * (-1013.520) (-1012.677) [-1017.014] (-1016.080) -- 0:00:43
356000 -- (-1013.302) (-1016.140) (-1012.834) [-1017.217] * [-1018.563] (-1013.219) (-1013.861) (-1012.736) -- 0:00:43
356500 -- (-1013.043) (-1014.272) (-1012.384) [-1013.296] * (-1012.870) [-1014.575] (-1014.800) (-1012.962) -- 0:00:43
357000 -- (-1012.808) [-1013.903] (-1012.527) (-1013.189) * (-1012.698) [-1012.844] (-1014.474) (-1013.735) -- 0:00:43
357500 -- (-1012.493) (-1015.355) [-1012.485] (-1013.676) * (-1013.734) [-1014.727] (-1013.482) (-1014.064) -- 0:00:43
358000 -- (-1016.524) (-1016.345) (-1017.378) [-1013.350] * (-1018.241) [-1015.019] (-1014.038) (-1015.184) -- 0:00:43
358500 -- (-1013.527) (-1022.589) [-1017.081] (-1014.747) * (-1016.052) [-1014.558] (-1014.789) (-1019.110) -- 0:00:42
359000 -- [-1015.243] (-1023.840) (-1014.746) (-1013.425) * (-1016.444) (-1013.911) (-1013.746) [-1014.146] -- 0:00:42
359500 -- [-1015.166] (-1015.712) (-1014.180) (-1013.708) * (-1015.317) [-1015.879] (-1015.318) (-1014.088) -- 0:00:42
360000 -- (-1014.422) (-1022.731) (-1015.724) [-1014.401] * [-1013.256] (-1013.349) (-1014.210) (-1015.764) -- 0:00:42
Average standard deviation of split frequencies: 0.011909
360500 -- [-1014.139] (-1017.662) (-1014.690) (-1015.706) * [-1014.081] (-1014.629) (-1012.679) (-1017.122) -- 0:00:42
361000 -- (-1014.405) [-1015.306] (-1014.007) (-1018.114) * (-1016.148) (-1013.366) (-1014.579) [-1012.707] -- 0:00:42
361500 -- (-1013.052) (-1016.866) [-1015.807] (-1015.128) * (-1013.941) (-1014.806) [-1014.793] (-1015.514) -- 0:00:42
362000 -- (-1013.619) (-1015.466) (-1014.450) [-1014.290] * (-1017.566) (-1013.582) [-1016.223] (-1015.482) -- 0:00:44
362500 -- [-1013.936] (-1014.108) (-1015.189) (-1014.189) * (-1016.614) (-1014.240) (-1016.157) [-1015.435] -- 0:00:43
363000 -- (-1015.023) (-1014.368) [-1014.440] (-1013.206) * (-1014.196) (-1014.542) [-1016.723] (-1014.512) -- 0:00:43
363500 -- (-1017.458) (-1018.707) (-1016.075) [-1013.903] * (-1015.778) (-1014.328) (-1018.809) [-1015.208] -- 0:00:43
364000 -- [-1014.702] (-1012.706) (-1014.396) (-1015.221) * (-1014.577) [-1013.979] (-1020.379) (-1014.053) -- 0:00:43
364500 -- (-1016.312) (-1013.118) (-1017.319) [-1013.857] * (-1014.267) (-1014.320) [-1014.986] (-1013.973) -- 0:00:43
365000 -- [-1014.611] (-1012.799) (-1013.469) (-1012.411) * (-1014.341) (-1017.245) [-1016.362] (-1015.943) -- 0:00:43
Average standard deviation of split frequencies: 0.012522
365500 -- (-1017.329) (-1016.100) (-1013.289) [-1013.127] * (-1015.094) (-1013.460) (-1012.886) [-1013.866] -- 0:00:43
366000 -- (-1015.207) (-1014.300) [-1012.948] (-1016.675) * (-1015.619) (-1012.949) (-1019.786) [-1014.476] -- 0:00:43
366500 -- [-1018.304] (-1015.156) (-1014.833) (-1017.948) * (-1016.152) [-1013.325] (-1020.021) (-1014.359) -- 0:00:43
367000 -- (-1014.815) [-1014.163] (-1015.111) (-1018.361) * (-1016.892) (-1015.928) (-1014.735) [-1015.010] -- 0:00:43
367500 -- (-1017.028) (-1014.290) (-1017.562) [-1012.487] * [-1013.671] (-1014.942) (-1013.152) (-1017.563) -- 0:00:43
368000 -- [-1013.095] (-1014.130) (-1015.516) (-1012.490) * [-1014.280] (-1017.751) (-1012.921) (-1017.008) -- 0:00:42
368500 -- (-1013.576) (-1016.159) [-1013.872] (-1012.729) * (-1016.955) (-1014.044) [-1013.063] (-1017.642) -- 0:00:42
369000 -- (-1014.475) (-1014.465) [-1016.382] (-1014.206) * [-1013.726] (-1016.366) (-1013.098) (-1015.058) -- 0:00:42
369500 -- [-1016.259] (-1015.616) (-1013.514) (-1015.633) * (-1016.451) (-1015.555) [-1012.880] (-1014.866) -- 0:00:42
370000 -- (-1013.957) [-1015.171] (-1012.704) (-1012.841) * [-1015.440] (-1013.807) (-1015.258) (-1012.925) -- 0:00:42
Average standard deviation of split frequencies: 0.013655
370500 -- (-1015.216) [-1015.468] (-1014.325) (-1014.168) * [-1014.041] (-1013.607) (-1016.383) (-1016.196) -- 0:00:42
371000 -- [-1015.363] (-1014.895) (-1013.550) (-1015.906) * (-1013.762) [-1013.752] (-1015.523) (-1012.799) -- 0:00:42
371500 -- (-1015.227) [-1014.989] (-1013.934) (-1013.359) * (-1018.330) [-1014.379] (-1012.959) (-1012.715) -- 0:00:42
372000 -- (-1014.239) (-1015.915) [-1014.202] (-1014.048) * (-1013.345) (-1016.397) [-1012.959] (-1018.147) -- 0:00:42
372500 -- (-1015.101) (-1018.538) [-1013.221] (-1012.538) * (-1013.986) [-1015.527] (-1016.281) (-1013.996) -- 0:00:42
373000 -- (-1014.337) (-1015.232) (-1017.731) [-1012.559] * (-1013.201) [-1017.451] (-1017.798) (-1018.378) -- 0:00:42
373500 -- (-1014.511) (-1016.690) (-1017.685) [-1015.006] * [-1014.483] (-1015.477) (-1012.307) (-1017.142) -- 0:00:41
374000 -- [-1012.791] (-1014.461) (-1014.737) (-1016.332) * (-1014.261) (-1015.229) [-1013.220] (-1015.825) -- 0:00:41
374500 -- [-1013.449] (-1014.073) (-1021.403) (-1012.758) * (-1013.622) (-1015.371) (-1018.193) [-1016.759] -- 0:00:41
375000 -- [-1013.616] (-1015.094) (-1017.060) (-1013.082) * (-1013.557) (-1013.838) (-1019.486) [-1014.079] -- 0:00:41
Average standard deviation of split frequencies: 0.013512
375500 -- (-1016.512) (-1015.929) (-1015.355) [-1013.932] * (-1012.920) [-1015.546] (-1014.844) (-1016.862) -- 0:00:41
376000 -- (-1014.499) [-1020.681] (-1015.463) (-1013.145) * (-1016.234) [-1015.379] (-1016.297) (-1014.518) -- 0:00:41
376500 -- (-1022.677) [-1013.063] (-1015.735) (-1017.109) * (-1015.253) [-1014.276] (-1016.177) (-1013.793) -- 0:00:43
377000 -- (-1016.147) (-1012.417) [-1013.571] (-1017.377) * [-1014.322] (-1014.833) (-1013.110) (-1018.874) -- 0:00:42
377500 -- (-1014.430) (-1017.782) (-1017.143) [-1012.630] * (-1013.541) (-1017.189) (-1015.759) [-1013.455] -- 0:00:42
378000 -- (-1016.413) (-1016.494) (-1021.350) [-1014.179] * (-1017.056) (-1013.560) (-1014.924) [-1015.227] -- 0:00:42
378500 -- (-1013.594) (-1012.892) [-1015.593] (-1014.259) * [-1012.664] (-1013.957) (-1014.013) (-1016.010) -- 0:00:42
379000 -- (-1015.131) (-1013.590) [-1014.790] (-1015.679) * (-1014.153) [-1015.041] (-1014.100) (-1017.730) -- 0:00:42
379500 -- (-1019.011) [-1014.056] (-1012.594) (-1016.034) * [-1018.278] (-1019.116) (-1018.663) (-1016.467) -- 0:00:42
380000 -- (-1018.510) (-1014.141) [-1013.117] (-1016.597) * (-1014.996) (-1016.832) (-1015.188) [-1016.365] -- 0:00:42
Average standard deviation of split frequencies: 0.012452
380500 -- (-1012.785) (-1014.088) [-1013.549] (-1012.892) * (-1015.723) (-1015.077) [-1014.672] (-1018.019) -- 0:00:42
381000 -- (-1013.557) [-1012.902] (-1015.923) (-1013.457) * [-1014.471] (-1014.580) (-1014.942) (-1016.297) -- 0:00:42
381500 -- (-1013.589) (-1013.011) [-1014.619] (-1015.660) * (-1014.862) [-1013.796] (-1015.868) (-1013.938) -- 0:00:42
382000 -- (-1014.395) (-1015.478) (-1017.652) [-1014.832] * [-1016.909] (-1013.942) (-1017.945) (-1015.142) -- 0:00:42
382500 -- (-1013.295) (-1016.278) (-1016.312) [-1017.415] * (-1014.362) (-1013.585) (-1013.701) [-1014.713] -- 0:00:41
383000 -- (-1018.363) (-1016.308) [-1015.338] (-1016.105) * [-1014.551] (-1014.982) (-1016.211) (-1012.641) -- 0:00:41
383500 -- (-1012.669) [-1014.418] (-1014.526) (-1019.685) * [-1018.095] (-1013.060) (-1012.969) (-1014.081) -- 0:00:41
384000 -- [-1012.558] (-1014.896) (-1013.365) (-1014.216) * (-1016.197) [-1012.637] (-1014.682) (-1014.429) -- 0:00:41
384500 -- (-1013.941) (-1015.363) [-1012.620] (-1016.817) * (-1018.092) (-1013.074) (-1017.259) [-1016.569] -- 0:00:41
385000 -- [-1014.043] (-1014.905) (-1014.869) (-1016.948) * [-1015.598] (-1013.339) (-1012.809) (-1014.318) -- 0:00:41
Average standard deviation of split frequencies: 0.012687
385500 -- (-1013.997) (-1016.748) (-1013.465) [-1014.736] * (-1014.009) (-1015.447) (-1013.432) [-1014.979] -- 0:00:41
386000 -- [-1013.763] (-1019.548) (-1015.741) (-1016.142) * [-1014.284] (-1015.950) (-1013.468) (-1014.712) -- 0:00:41
386500 -- (-1013.105) [-1017.736] (-1013.829) (-1016.384) * (-1012.989) (-1015.818) (-1014.649) [-1013.597] -- 0:00:41
387000 -- (-1015.392) (-1014.744) [-1014.429] (-1013.015) * (-1013.094) [-1013.639] (-1013.399) (-1014.070) -- 0:00:41
387500 -- (-1013.624) [-1014.097] (-1013.888) (-1013.573) * (-1012.941) (-1014.433) [-1014.154] (-1013.061) -- 0:00:41
388000 -- (-1012.430) (-1014.745) [-1015.450] (-1015.152) * (-1014.967) (-1013.664) [-1015.919] (-1013.421) -- 0:00:41
388500 -- (-1013.117) (-1013.892) [-1015.349] (-1014.934) * (-1013.204) (-1013.219) [-1013.060] (-1014.304) -- 0:00:40
389000 -- (-1015.867) (-1013.122) (-1014.213) [-1015.496] * (-1012.789) (-1014.509) [-1012.476] (-1014.912) -- 0:00:40
389500 -- (-1014.649) (-1012.725) [-1016.137] (-1018.859) * (-1013.770) (-1013.132) (-1012.469) [-1013.603] -- 0:00:40
390000 -- [-1014.264] (-1015.934) (-1015.542) (-1012.420) * [-1013.119] (-1014.817) (-1012.716) (-1017.008) -- 0:00:40
Average standard deviation of split frequencies: 0.013628
390500 -- (-1016.377) (-1016.466) (-1014.128) [-1012.675] * (-1015.396) (-1013.031) [-1014.043] (-1016.404) -- 0:00:40
391000 -- (-1020.734) [-1014.871] (-1014.369) (-1013.385) * (-1013.991) [-1013.475] (-1014.998) (-1015.367) -- 0:00:40
391500 -- (-1018.793) [-1018.154] (-1015.285) (-1014.887) * (-1013.593) (-1016.612) [-1013.672] (-1014.395) -- 0:00:40
392000 -- (-1020.653) (-1013.631) (-1013.896) [-1013.015] * [-1012.728] (-1014.728) (-1015.520) (-1017.482) -- 0:00:41
392500 -- (-1014.024) [-1014.741] (-1015.652) (-1014.727) * (-1013.826) [-1013.290] (-1016.624) (-1016.193) -- 0:00:41
393000 -- (-1016.041) (-1013.826) (-1013.554) [-1015.642] * [-1015.110] (-1016.857) (-1016.875) (-1014.985) -- 0:00:41
393500 -- (-1019.211) (-1014.546) [-1015.071] (-1012.614) * (-1015.477) (-1013.574) (-1012.664) [-1016.568] -- 0:00:41
394000 -- (-1020.570) [-1013.820] (-1016.413) (-1013.422) * (-1020.106) [-1012.780] (-1014.944) (-1013.439) -- 0:00:41
394500 -- (-1020.979) (-1015.553) (-1013.654) [-1014.691] * [-1015.089] (-1015.469) (-1013.989) (-1014.286) -- 0:00:41
395000 -- (-1013.736) (-1019.177) [-1013.852] (-1012.659) * (-1017.020) [-1014.868] (-1014.596) (-1013.927) -- 0:00:41
Average standard deviation of split frequencies: 0.012324
395500 -- [-1013.486] (-1020.118) (-1014.494) (-1013.816) * (-1015.203) [-1013.388] (-1013.043) (-1013.153) -- 0:00:41
396000 -- (-1012.369) [-1017.384] (-1018.940) (-1013.164) * [-1014.040] (-1014.055) (-1012.945) (-1013.153) -- 0:00:41
396500 -- (-1016.131) (-1020.677) (-1014.863) [-1012.780] * (-1015.506) [-1014.370] (-1016.465) (-1016.481) -- 0:00:41
397000 -- (-1015.404) (-1014.188) [-1017.362] (-1012.521) * (-1016.433) (-1016.222) [-1013.088] (-1016.387) -- 0:00:41
397500 -- (-1015.402) (-1014.355) [-1017.863] (-1015.237) * (-1013.939) (-1013.973) (-1014.466) [-1014.661] -- 0:00:40
398000 -- (-1016.475) (-1014.420) (-1015.560) [-1013.596] * [-1013.834] (-1013.702) (-1013.636) (-1013.041) -- 0:00:40
398500 -- (-1014.222) (-1014.272) (-1014.254) [-1015.839] * (-1015.863) (-1015.499) (-1013.897) [-1015.778] -- 0:00:40
399000 -- [-1014.294] (-1018.207) (-1014.780) (-1013.583) * [-1013.268] (-1023.211) (-1017.057) (-1017.111) -- 0:00:40
399500 -- [-1013.810] (-1013.461) (-1014.361) (-1014.212) * (-1014.856) (-1018.996) (-1014.285) [-1015.215] -- 0:00:40
400000 -- (-1013.189) (-1012.327) (-1014.771) [-1012.858] * (-1015.141) (-1016.750) (-1016.564) [-1016.737] -- 0:00:40
Average standard deviation of split frequencies: 0.011627
400500 -- [-1013.987] (-1012.409) (-1014.327) (-1012.767) * (-1014.710) (-1013.639) (-1013.614) [-1018.629] -- 0:00:40
401000 -- (-1014.378) (-1013.227) (-1014.444) [-1017.499] * [-1014.819] (-1015.799) (-1015.557) (-1017.138) -- 0:00:40
401500 -- [-1013.244] (-1015.276) (-1013.966) (-1019.470) * (-1014.614) (-1015.734) (-1018.236) [-1017.740] -- 0:00:40
402000 -- [-1012.523] (-1014.550) (-1014.075) (-1019.587) * (-1016.114) [-1012.880] (-1016.491) (-1015.186) -- 0:00:40
402500 -- [-1015.788] (-1014.324) (-1014.067) (-1015.863) * [-1013.301] (-1014.585) (-1016.548) (-1014.641) -- 0:00:40
403000 -- (-1014.386) (-1013.142) (-1016.533) [-1015.053] * [-1013.353] (-1015.287) (-1016.063) (-1015.777) -- 0:00:39
403500 -- [-1014.637] (-1014.321) (-1018.133) (-1014.982) * (-1017.484) [-1014.788] (-1013.902) (-1019.782) -- 0:00:39
404000 -- (-1015.409) (-1015.038) (-1015.972) [-1015.711] * (-1017.946) [-1012.459] (-1014.169) (-1014.061) -- 0:00:39
404500 -- (-1014.736) (-1016.564) [-1016.617] (-1014.407) * [-1014.279] (-1016.783) (-1013.196) (-1014.541) -- 0:00:39
405000 -- (-1018.543) (-1013.489) (-1013.215) [-1013.900] * [-1015.230] (-1018.804) (-1012.636) (-1015.954) -- 0:00:39
Average standard deviation of split frequencies: 0.010860
405500 -- [-1015.081] (-1014.059) (-1012.532) (-1013.141) * [-1015.466] (-1014.095) (-1016.737) (-1014.982) -- 0:00:39
406000 -- (-1014.065) [-1013.095] (-1015.411) (-1015.537) * [-1017.457] (-1015.445) (-1016.164) (-1013.851) -- 0:00:39
406500 -- (-1019.150) [-1013.168] (-1018.945) (-1013.989) * [-1016.758] (-1015.775) (-1015.365) (-1013.717) -- 0:00:39
407000 -- [-1013.913] (-1014.482) (-1016.009) (-1013.222) * (-1016.890) (-1014.456) (-1014.681) [-1013.792] -- 0:00:39
407500 -- (-1013.684) (-1020.484) (-1016.087) [-1013.868] * [-1012.637] (-1014.941) (-1015.145) (-1015.112) -- 0:00:39
408000 -- (-1013.673) (-1015.056) [-1016.011] (-1013.562) * (-1012.660) (-1016.184) [-1014.133] (-1015.176) -- 0:00:40
408500 -- [-1013.995] (-1016.502) (-1014.600) (-1013.719) * (-1013.776) (-1018.275) [-1014.076] (-1015.507) -- 0:00:40
409000 -- (-1014.030) (-1018.729) (-1014.124) [-1012.888] * (-1014.056) (-1013.158) (-1015.216) [-1013.678] -- 0:00:40
409500 -- (-1017.840) (-1013.243) [-1014.039] (-1018.827) * (-1013.835) (-1012.456) (-1013.819) [-1014.247] -- 0:00:40
410000 -- (-1013.821) [-1015.470] (-1017.414) (-1019.736) * (-1013.878) (-1016.738) [-1016.087] (-1014.432) -- 0:00:40
Average standard deviation of split frequencies: 0.010601
410500 -- (-1015.270) (-1013.822) [-1016.605] (-1015.426) * (-1018.942) (-1017.722) (-1012.469) [-1013.062] -- 0:00:40
411000 -- (-1015.362) [-1015.889] (-1016.321) (-1013.653) * (-1017.411) [-1015.104] (-1012.469) (-1013.461) -- 0:00:40
411500 -- [-1013.853] (-1015.568) (-1014.100) (-1014.170) * [-1013.121] (-1015.583) (-1012.395) (-1013.246) -- 0:00:40
412000 -- (-1012.898) (-1014.470) (-1014.449) [-1013.189] * (-1013.890) [-1015.541] (-1012.862) (-1013.499) -- 0:00:39
412500 -- [-1013.143] (-1013.995) (-1017.786) (-1013.105) * (-1014.217) (-1019.121) (-1012.892) [-1015.589] -- 0:00:39
413000 -- (-1015.681) (-1014.905) (-1014.802) [-1014.909] * (-1017.409) (-1021.231) (-1014.793) [-1015.631] -- 0:00:39
413500 -- [-1014.324] (-1014.198) (-1012.950) (-1015.856) * (-1017.342) (-1020.024) (-1013.678) [-1013.017] -- 0:00:39
414000 -- (-1014.042) (-1019.989) [-1013.921] (-1016.010) * (-1012.618) [-1013.734] (-1013.492) (-1013.077) -- 0:00:39
414500 -- [-1012.905] (-1014.490) (-1016.253) (-1015.692) * (-1012.905) (-1014.219) [-1015.599] (-1014.358) -- 0:00:39
415000 -- (-1013.786) [-1013.846] (-1013.662) (-1014.070) * (-1014.105) [-1014.624] (-1017.451) (-1014.898) -- 0:00:39
Average standard deviation of split frequencies: 0.010265
415500 -- (-1012.956) (-1013.258) (-1014.618) [-1014.062] * (-1015.203) (-1013.339) [-1015.934] (-1017.184) -- 0:00:39
416000 -- (-1016.846) (-1014.129) [-1013.996] (-1012.822) * (-1015.219) (-1017.563) [-1013.779] (-1015.242) -- 0:00:39
416500 -- (-1014.509) (-1014.205) (-1012.999) [-1012.756] * (-1014.484) (-1014.163) [-1016.008] (-1012.923) -- 0:00:39
417000 -- (-1013.879) (-1014.739) (-1014.480) [-1014.446] * (-1014.428) [-1017.985] (-1016.045) (-1013.427) -- 0:00:39
417500 -- (-1016.752) [-1014.049] (-1017.210) (-1019.605) * (-1014.491) (-1014.658) [-1015.000] (-1015.019) -- 0:00:39
418000 -- [-1014.806] (-1012.954) (-1016.563) (-1016.662) * [-1013.899] (-1015.999) (-1018.293) (-1014.253) -- 0:00:38
418500 -- [-1018.314] (-1013.180) (-1014.436) (-1018.933) * (-1016.215) [-1014.639] (-1015.778) (-1013.679) -- 0:00:38
419000 -- [-1013.609] (-1012.955) (-1017.463) (-1015.090) * (-1014.122) (-1013.779) [-1013.028] (-1014.877) -- 0:00:38
419500 -- [-1013.632] (-1013.809) (-1015.680) (-1012.771) * (-1013.641) (-1013.304) (-1017.346) [-1016.269] -- 0:00:38
420000 -- (-1016.304) (-1019.838) [-1013.763] (-1012.362) * (-1015.757) (-1013.112) (-1018.994) [-1015.842] -- 0:00:38
Average standard deviation of split frequencies: 0.011536
420500 -- (-1014.149) (-1013.437) (-1014.090) [-1014.946] * (-1015.665) (-1014.828) (-1015.833) [-1014.009] -- 0:00:38
421000 -- (-1015.195) [-1015.054] (-1021.558) (-1015.385) * (-1012.570) (-1015.713) [-1016.332] (-1015.745) -- 0:00:38
421500 -- (-1014.598) (-1013.948) [-1012.927] (-1016.413) * (-1013.325) (-1015.440) [-1015.656] (-1014.509) -- 0:00:38
422000 -- [-1017.016] (-1017.508) (-1014.261) (-1016.425) * (-1013.584) (-1018.594) [-1014.823] (-1014.545) -- 0:00:38
422500 -- (-1015.354) (-1018.381) [-1013.128] (-1015.384) * (-1016.310) (-1013.169) (-1016.854) [-1016.226] -- 0:00:38
423000 -- (-1013.303) (-1015.774) (-1014.113) [-1015.793] * (-1012.791) (-1012.352) (-1015.588) [-1013.034] -- 0:00:39
423500 -- (-1013.456) (-1014.501) [-1013.107] (-1017.254) * [-1013.577] (-1014.882) (-1016.136) (-1016.941) -- 0:00:39
424000 -- (-1017.741) [-1014.561] (-1013.966) (-1018.184) * (-1016.101) [-1013.083] (-1014.885) (-1014.423) -- 0:00:39
424500 -- (-1015.298) (-1014.376) (-1013.954) [-1014.367] * (-1019.061) [-1014.408] (-1016.545) (-1013.577) -- 0:00:39
425000 -- (-1015.567) (-1013.255) [-1015.746] (-1016.301) * (-1017.414) (-1013.588) [-1015.796] (-1014.390) -- 0:00:39
Average standard deviation of split frequencies: 0.011456
425500 -- (-1014.802) [-1014.186] (-1014.244) (-1013.816) * (-1013.396) (-1013.291) (-1014.788) [-1014.106] -- 0:00:39
426000 -- (-1017.697) (-1013.399) [-1014.538] (-1015.470) * (-1016.406) (-1015.363) [-1016.763] (-1014.019) -- 0:00:39
426500 -- (-1016.242) (-1016.177) (-1014.443) [-1013.443] * (-1014.725) (-1016.289) (-1017.362) [-1013.356] -- 0:00:38
427000 -- (-1015.622) (-1013.370) (-1016.385) [-1013.520] * (-1013.788) [-1017.289] (-1020.338) (-1013.127) -- 0:00:38
427500 -- (-1015.557) (-1012.567) (-1017.380) [-1013.573] * (-1014.833) [-1015.370] (-1015.292) (-1012.945) -- 0:00:38
428000 -- (-1016.398) (-1016.300) [-1014.044] (-1014.708) * (-1015.269) (-1018.672) [-1013.238] (-1019.032) -- 0:00:38
428500 -- (-1017.500) [-1014.114] (-1017.978) (-1018.462) * (-1013.169) (-1018.708) [-1013.791] (-1015.122) -- 0:00:38
429000 -- (-1015.548) (-1012.806) [-1015.340] (-1014.179) * (-1013.688) [-1014.889] (-1014.238) (-1014.027) -- 0:00:38
429500 -- [-1017.343] (-1012.756) (-1015.375) (-1017.710) * (-1016.662) (-1016.390) (-1017.847) [-1014.020] -- 0:00:38
430000 -- [-1016.560] (-1014.840) (-1013.721) (-1014.720) * (-1015.743) [-1015.318] (-1019.049) (-1016.144) -- 0:00:38
Average standard deviation of split frequencies: 0.013013
430500 -- (-1014.386) (-1013.406) [-1017.699] (-1014.403) * (-1019.521) [-1015.066] (-1019.015) (-1018.889) -- 0:00:38
431000 -- (-1017.443) [-1013.317] (-1014.913) (-1018.092) * (-1012.641) (-1017.430) [-1013.665] (-1013.223) -- 0:00:38
431500 -- (-1013.986) (-1013.546) [-1014.722] (-1013.551) * (-1015.934) (-1017.738) [-1017.282] (-1013.635) -- 0:00:38
432000 -- [-1012.408] (-1020.763) (-1013.846) (-1014.715) * (-1016.583) (-1017.952) (-1016.611) [-1016.608] -- 0:00:38
432500 -- (-1013.080) (-1018.829) [-1013.738] (-1015.690) * (-1018.089) (-1015.002) (-1012.617) [-1015.855] -- 0:00:38
433000 -- [-1013.116] (-1017.809) (-1013.257) (-1014.920) * (-1017.298) (-1013.480) [-1017.130] (-1014.881) -- 0:00:37
433500 -- (-1013.809) (-1015.825) (-1012.291) [-1012.670] * (-1017.086) [-1013.825] (-1019.152) (-1015.875) -- 0:00:37
434000 -- (-1017.202) [-1017.473] (-1013.616) (-1013.563) * (-1014.107) (-1016.273) (-1013.939) [-1016.235] -- 0:00:37
434500 -- (-1013.923) (-1013.781) (-1013.424) [-1015.200] * (-1014.793) (-1015.628) (-1012.758) [-1017.140] -- 0:00:37
435000 -- (-1014.504) (-1017.152) [-1013.480] (-1015.407) * (-1013.515) (-1015.271) [-1015.368] (-1013.579) -- 0:00:37
Average standard deviation of split frequencies: 0.012674
435500 -- (-1014.217) (-1015.453) [-1014.365] (-1016.686) * (-1014.960) [-1014.439] (-1014.087) (-1015.870) -- 0:00:37
436000 -- (-1013.998) (-1013.857) [-1014.319] (-1015.666) * (-1014.883) [-1013.007] (-1016.285) (-1016.037) -- 0:00:37
436500 -- (-1017.545) (-1014.610) [-1013.819] (-1013.616) * (-1014.909) (-1013.365) [-1014.160] (-1013.657) -- 0:00:37
437000 -- (-1017.779) (-1014.708) (-1017.245) [-1014.933] * (-1018.174) [-1012.770] (-1013.520) (-1013.122) -- 0:00:37
437500 -- [-1016.764] (-1014.540) (-1013.109) (-1013.299) * (-1016.425) [-1013.256] (-1013.641) (-1013.967) -- 0:00:37
438000 -- (-1018.185) [-1013.372] (-1012.528) (-1015.148) * [-1017.374] (-1017.088) (-1013.748) (-1012.685) -- 0:00:38
438500 -- (-1018.186) (-1016.142) [-1015.058] (-1015.228) * (-1014.656) (-1017.397) (-1014.528) [-1014.753] -- 0:00:38
439000 -- [-1015.183] (-1015.764) (-1013.584) (-1016.042) * [-1016.189] (-1018.339) (-1015.957) (-1017.625) -- 0:00:38
439500 -- (-1013.325) (-1016.723) (-1013.540) [-1017.259] * (-1016.420) [-1013.989] (-1015.643) (-1015.112) -- 0:00:38
440000 -- [-1013.482] (-1017.089) (-1015.495) (-1017.566) * [-1013.123] (-1012.655) (-1013.670) (-1013.787) -- 0:00:38
Average standard deviation of split frequencies: 0.012362
440500 -- (-1013.455) (-1013.006) [-1016.596] (-1013.279) * (-1016.133) (-1014.271) [-1013.776] (-1012.939) -- 0:00:38
441000 -- [-1013.180] (-1016.424) (-1014.868) (-1013.591) * (-1013.669) (-1013.931) [-1013.845] (-1014.406) -- 0:00:38
441500 -- (-1014.560) (-1014.353) (-1014.661) [-1014.993] * (-1015.154) (-1013.054) [-1013.894] (-1013.248) -- 0:00:37
442000 -- (-1016.370) (-1013.870) (-1015.196) [-1014.474] * (-1013.087) (-1012.461) [-1015.370] (-1014.546) -- 0:00:37
442500 -- [-1016.917] (-1012.785) (-1014.406) (-1014.501) * (-1015.280) [-1014.885] (-1014.656) (-1014.761) -- 0:00:37
443000 -- [-1017.670] (-1014.245) (-1014.455) (-1012.974) * [-1019.301] (-1015.479) (-1016.120) (-1015.593) -- 0:00:37
443500 -- (-1014.248) (-1013.696) [-1019.142] (-1013.220) * (-1015.045) [-1013.343] (-1015.083) (-1015.567) -- 0:00:37
444000 -- [-1015.997] (-1013.852) (-1019.038) (-1013.746) * (-1015.486) [-1015.091] (-1014.567) (-1013.850) -- 0:00:37
444500 -- (-1014.734) (-1015.990) (-1013.943) [-1013.325] * [-1013.312] (-1017.506) (-1015.265) (-1013.551) -- 0:00:37
445000 -- (-1014.361) (-1016.656) [-1013.714] (-1015.742) * (-1014.867) [-1013.072] (-1013.603) (-1017.524) -- 0:00:37
Average standard deviation of split frequencies: 0.012507
445500 -- (-1014.559) (-1013.530) [-1014.080] (-1013.983) * [-1016.068] (-1014.249) (-1014.077) (-1013.679) -- 0:00:37
446000 -- (-1014.001) (-1014.795) (-1013.854) [-1015.785] * (-1014.174) [-1013.324] (-1013.439) (-1014.455) -- 0:00:37
446500 -- (-1014.337) (-1014.654) [-1013.467] (-1014.958) * (-1015.544) [-1013.410] (-1013.121) (-1015.356) -- 0:00:37
447000 -- [-1014.365] (-1014.422) (-1016.023) (-1013.469) * (-1014.763) (-1014.601) [-1015.213] (-1013.638) -- 0:00:37
447500 -- [-1013.225] (-1017.291) (-1014.437) (-1014.044) * [-1013.038] (-1013.731) (-1014.256) (-1013.371) -- 0:00:37
448000 -- (-1016.866) [-1016.004] (-1014.190) (-1015.797) * (-1013.585) (-1012.927) (-1015.315) [-1013.451] -- 0:00:36
448500 -- (-1014.167) (-1014.661) [-1014.124] (-1019.213) * (-1015.414) (-1015.014) [-1017.081] (-1013.903) -- 0:00:36
449000 -- (-1013.392) (-1018.641) [-1016.457] (-1012.908) * [-1015.796] (-1019.430) (-1017.213) (-1013.126) -- 0:00:36
449500 -- (-1016.409) (-1015.396) (-1015.168) [-1015.894] * (-1015.025) (-1016.404) (-1017.464) [-1013.490] -- 0:00:36
450000 -- (-1016.325) (-1013.444) (-1015.572) [-1014.331] * [-1016.135] (-1014.144) (-1016.518) (-1015.247) -- 0:00:36
Average standard deviation of split frequencies: 0.012145
450500 -- [-1014.569] (-1014.367) (-1015.702) (-1019.588) * [-1018.947] (-1016.500) (-1017.160) (-1014.152) -- 0:00:36
451000 -- (-1014.242) (-1015.170) [-1016.119] (-1021.364) * (-1014.475) (-1014.928) [-1014.801] (-1015.562) -- 0:00:36
451500 -- (-1012.907) (-1014.771) (-1013.761) [-1012.862] * (-1013.420) [-1013.983] (-1013.174) (-1014.127) -- 0:00:36
452000 -- (-1014.710) (-1013.579) [-1014.506] (-1015.098) * (-1013.606) (-1014.532) (-1014.744) [-1014.453] -- 0:00:36
452500 -- (-1015.472) (-1017.314) [-1015.610] (-1016.895) * [-1013.606] (-1014.483) (-1012.945) (-1015.303) -- 0:00:36
453000 -- (-1014.594) (-1019.206) [-1014.787] (-1019.728) * (-1012.697) (-1014.244) [-1013.505] (-1013.809) -- 0:00:36
453500 -- [-1016.459] (-1014.754) (-1015.015) (-1015.262) * (-1013.788) [-1013.623] (-1014.420) (-1013.018) -- 0:00:36
454000 -- (-1016.519) [-1013.692] (-1015.979) (-1013.967) * [-1015.178] (-1013.880) (-1016.829) (-1013.660) -- 0:00:37
454500 -- (-1019.343) (-1016.105) [-1022.535] (-1014.106) * (-1014.629) [-1013.737] (-1016.553) (-1012.705) -- 0:00:37
455000 -- (-1014.297) [-1013.711] (-1013.502) (-1013.931) * (-1013.322) [-1013.625] (-1014.708) (-1013.596) -- 0:00:37
Average standard deviation of split frequencies: 0.011797
455500 -- [-1015.013] (-1013.605) (-1012.610) (-1013.091) * [-1014.537] (-1012.744) (-1014.507) (-1015.846) -- 0:00:37
456000 -- (-1016.012) (-1013.399) [-1012.749] (-1014.792) * (-1016.540) (-1015.051) (-1015.294) [-1014.046] -- 0:00:36
456500 -- (-1014.549) (-1016.266) (-1012.749) [-1014.193] * (-1014.325) (-1016.080) [-1013.852] (-1014.168) -- 0:00:36
457000 -- [-1013.415] (-1014.777) (-1016.753) (-1016.038) * (-1018.485) [-1016.433] (-1013.000) (-1013.506) -- 0:00:36
457500 -- (-1014.481) [-1012.976] (-1016.452) (-1020.180) * (-1018.342) (-1016.472) (-1016.016) [-1012.246] -- 0:00:36
458000 -- [-1013.605] (-1013.339) (-1014.701) (-1017.525) * (-1013.146) [-1013.587] (-1014.641) (-1014.743) -- 0:00:36
458500 -- [-1013.589] (-1013.456) (-1017.501) (-1017.778) * (-1013.202) (-1017.577) [-1015.777] (-1013.936) -- 0:00:36
459000 -- (-1013.279) [-1012.901] (-1015.362) (-1014.696) * (-1013.310) (-1017.919) (-1012.496) [-1013.614] -- 0:00:36
459500 -- (-1012.883) (-1014.321) [-1013.462] (-1013.102) * (-1013.128) (-1017.310) (-1015.715) [-1015.371] -- 0:00:36
460000 -- [-1014.881] (-1014.119) (-1014.545) (-1014.859) * [-1014.523] (-1016.647) (-1014.452) (-1013.712) -- 0:00:36
Average standard deviation of split frequencies: 0.011858
460500 -- [-1013.418] (-1015.479) (-1015.340) (-1014.575) * [-1015.490] (-1019.050) (-1014.836) (-1014.961) -- 0:00:36
461000 -- (-1014.113) (-1018.635) [-1013.824] (-1017.378) * (-1015.703) [-1017.673] (-1016.020) (-1017.539) -- 0:00:36
461500 -- (-1015.243) (-1019.460) (-1016.988) [-1013.846] * (-1013.310) (-1015.882) (-1012.660) [-1014.343] -- 0:00:36
462000 -- [-1013.064] (-1014.583) (-1017.178) (-1013.618) * [-1014.942] (-1017.915) (-1013.131) (-1013.111) -- 0:00:36
462500 -- [-1013.838] (-1018.508) (-1014.233) (-1013.619) * (-1012.885) (-1017.700) (-1012.881) [-1013.768] -- 0:00:36
463000 -- (-1015.018) [-1012.877] (-1014.640) (-1017.179) * (-1016.566) (-1014.900) (-1013.786) [-1012.922] -- 0:00:35
463500 -- [-1012.745] (-1012.701) (-1016.024) (-1015.458) * (-1015.239) (-1013.361) [-1016.115] (-1013.021) -- 0:00:35
464000 -- (-1017.417) (-1012.901) [-1013.217] (-1015.838) * [-1013.217] (-1013.747) (-1014.186) (-1014.701) -- 0:00:35
464500 -- [-1017.788] (-1012.727) (-1017.054) (-1013.444) * (-1013.285) (-1014.813) (-1012.286) [-1015.080] -- 0:00:35
465000 -- (-1016.467) (-1012.757) (-1019.171) [-1016.494] * (-1019.114) (-1013.883) [-1014.686] (-1014.365) -- 0:00:35
Average standard deviation of split frequencies: 0.011425
465500 -- (-1014.622) [-1014.565] (-1012.643) (-1015.512) * (-1016.774) [-1015.456] (-1015.407) (-1013.846) -- 0:00:35
466000 -- (-1013.343) (-1013.434) (-1015.044) [-1014.997] * (-1016.519) (-1015.667) [-1014.231] (-1016.751) -- 0:00:35
466500 -- (-1015.175) [-1012.782] (-1013.699) (-1016.995) * (-1016.118) (-1014.190) [-1013.546] (-1016.838) -- 0:00:35
467000 -- (-1013.145) [-1015.337] (-1013.491) (-1015.971) * (-1015.995) (-1015.930) (-1018.365) [-1018.414] -- 0:00:35
467500 -- [-1015.705] (-1013.018) (-1013.875) (-1016.713) * [-1014.428] (-1013.372) (-1014.139) (-1013.163) -- 0:00:35
468000 -- (-1019.773) (-1012.832) (-1013.559) [-1012.758] * (-1016.889) [-1014.210] (-1013.685) (-1015.085) -- 0:00:35
468500 -- (-1016.336) [-1014.753] (-1018.996) (-1014.654) * [-1016.288] (-1013.243) (-1014.191) (-1012.421) -- 0:00:35
469000 -- (-1015.875) (-1015.430) [-1015.270] (-1016.423) * [-1015.306] (-1012.942) (-1015.856) (-1013.113) -- 0:00:35
469500 -- (-1013.724) [-1014.965] (-1020.858) (-1013.062) * (-1013.295) (-1013.661) [-1015.054] (-1013.663) -- 0:00:35
470000 -- (-1014.616) [-1015.312] (-1018.105) (-1015.178) * [-1013.787] (-1015.423) (-1015.900) (-1015.987) -- 0:00:34
Average standard deviation of split frequencies: 0.010958
470500 -- (-1014.641) (-1017.638) (-1017.225) [-1015.859] * [-1015.446] (-1015.669) (-1012.886) (-1014.961) -- 0:00:36
471000 -- (-1015.849) [-1014.417] (-1014.096) (-1014.226) * [-1015.190] (-1014.701) (-1014.509) (-1014.320) -- 0:00:35
471500 -- [-1013.723] (-1015.783) (-1017.137) (-1015.151) * (-1012.926) (-1014.138) [-1017.107] (-1014.629) -- 0:00:35
472000 -- (-1012.862) (-1025.260) (-1014.841) [-1013.227] * (-1017.010) (-1016.449) (-1013.983) [-1012.691] -- 0:00:35
472500 -- (-1014.069) (-1017.240) (-1016.551) [-1012.367] * [-1013.805] (-1014.446) (-1015.034) (-1012.719) -- 0:00:35
473000 -- (-1013.389) (-1016.862) (-1013.510) [-1012.635] * [-1019.423] (-1014.874) (-1012.828) (-1016.839) -- 0:00:35
473500 -- (-1013.346) [-1012.718] (-1014.052) (-1012.424) * (-1015.137) (-1015.098) (-1013.807) [-1015.040] -- 0:00:35
474000 -- (-1013.239) (-1012.506) (-1013.066) [-1013.192] * [-1014.721] (-1017.274) (-1014.410) (-1014.556) -- 0:00:35
474500 -- (-1013.965) [-1014.282] (-1013.781) (-1014.766) * [-1013.520] (-1014.822) (-1015.522) (-1015.941) -- 0:00:35
475000 -- (-1013.188) [-1013.660] (-1015.578) (-1015.815) * (-1012.223) (-1014.603) (-1013.712) [-1014.006] -- 0:00:35
Average standard deviation of split frequencies: 0.011651
475500 -- (-1015.394) (-1016.642) (-1014.595) [-1014.888] * [-1013.051] (-1013.060) (-1013.105) (-1015.802) -- 0:00:35
476000 -- (-1013.575) (-1017.264) (-1013.837) [-1016.906] * (-1013.645) [-1013.919] (-1015.959) (-1014.767) -- 0:00:35
476500 -- (-1013.993) (-1012.638) [-1013.334] (-1016.104) * (-1012.833) (-1013.884) [-1017.814] (-1014.754) -- 0:00:35
477000 -- [-1018.084] (-1016.877) (-1019.013) (-1013.817) * [-1013.686] (-1014.660) (-1014.070) (-1016.745) -- 0:00:35
477500 -- [-1014.532] (-1020.546) (-1015.999) (-1014.945) * (-1014.465) [-1013.855] (-1015.445) (-1020.149) -- 0:00:35
478000 -- [-1013.047] (-1018.413) (-1019.097) (-1015.740) * (-1014.918) [-1016.313] (-1014.370) (-1015.543) -- 0:00:34
478500 -- (-1013.590) (-1015.059) (-1015.152) [-1015.358] * (-1015.438) (-1017.912) [-1013.110] (-1015.750) -- 0:00:34
479000 -- (-1012.413) [-1017.266] (-1015.673) (-1016.042) * (-1016.897) (-1013.949) (-1012.449) [-1014.055] -- 0:00:34
479500 -- (-1014.186) (-1019.706) (-1014.582) [-1016.164] * (-1016.303) (-1012.984) [-1013.870] (-1013.329) -- 0:00:34
480000 -- (-1014.525) (-1020.844) (-1012.445) [-1014.323] * (-1014.294) (-1013.532) [-1014.046] (-1014.659) -- 0:00:34
Average standard deviation of split frequencies: 0.012014
480500 -- (-1014.791) (-1013.686) [-1014.432] (-1014.743) * (-1014.972) [-1013.261] (-1016.813) (-1018.069) -- 0:00:34
481000 -- [-1013.423] (-1013.502) (-1016.917) (-1023.234) * (-1015.718) [-1013.352] (-1015.688) (-1019.429) -- 0:00:34
481500 -- (-1019.805) [-1015.595] (-1016.999) (-1014.963) * (-1018.269) (-1013.459) (-1013.904) [-1018.944] -- 0:00:34
482000 -- (-1013.321) [-1013.062] (-1019.780) (-1014.294) * [-1013.858] (-1016.504) (-1016.498) (-1016.261) -- 0:00:34
482500 -- (-1013.621) (-1013.719) (-1013.496) [-1017.974] * (-1015.392) [-1012.742] (-1017.878) (-1019.259) -- 0:00:34
483000 -- (-1013.942) [-1014.332] (-1013.769) (-1016.228) * [-1016.763] (-1012.329) (-1013.932) (-1016.513) -- 0:00:34
483500 -- (-1016.066) (-1014.333) [-1013.914] (-1014.349) * [-1013.999] (-1013.410) (-1012.937) (-1015.962) -- 0:00:34
484000 -- (-1017.340) (-1014.816) (-1013.957) [-1014.493] * (-1014.837) (-1014.422) [-1013.768] (-1013.295) -- 0:00:34
484500 -- (-1014.749) (-1013.915) [-1014.231] (-1013.766) * (-1013.520) [-1015.414] (-1013.362) (-1012.605) -- 0:00:34
485000 -- (-1013.156) [-1013.283] (-1013.585) (-1019.516) * (-1015.337) (-1016.162) [-1013.738] (-1015.059) -- 0:00:33
Average standard deviation of split frequencies: 0.011411
485500 -- (-1015.116) (-1014.452) (-1014.671) [-1016.496] * (-1012.904) (-1016.387) [-1013.081] (-1013.022) -- 0:00:33
486000 -- (-1013.971) [-1014.144] (-1014.982) (-1017.770) * [-1014.776] (-1016.257) (-1016.030) (-1012.793) -- 0:00:33
486500 -- (-1013.210) (-1016.004) (-1016.377) [-1015.282] * (-1014.792) (-1016.282) [-1014.186] (-1013.484) -- 0:00:34
487000 -- (-1018.947) (-1013.585) (-1014.710) [-1014.203] * (-1017.052) [-1015.947] (-1016.535) (-1013.708) -- 0:00:34
487500 -- (-1018.293) (-1015.316) [-1013.212] (-1012.909) * [-1015.026] (-1012.696) (-1014.950) (-1016.441) -- 0:00:34
488000 -- [-1017.827] (-1015.588) (-1014.202) (-1015.255) * (-1018.101) [-1012.741] (-1015.191) (-1016.502) -- 0:00:34
488500 -- (-1014.048) [-1014.302] (-1018.704) (-1015.538) * (-1014.634) [-1012.675] (-1013.598) (-1015.218) -- 0:00:34
489000 -- (-1014.482) (-1015.640) [-1017.312] (-1014.574) * (-1012.702) [-1017.604] (-1015.325) (-1015.416) -- 0:00:34
489500 -- (-1014.284) [-1015.012] (-1015.822) (-1015.074) * (-1017.520) [-1014.798] (-1014.366) (-1015.349) -- 0:00:34
490000 -- (-1017.745) (-1015.062) (-1019.890) [-1013.074] * (-1017.798) (-1017.102) [-1016.341] (-1015.754) -- 0:00:34
Average standard deviation of split frequencies: 0.010851
490500 -- [-1013.822] (-1014.430) (-1016.842) (-1013.787) * (-1021.837) [-1017.163] (-1018.794) (-1018.040) -- 0:00:34
491000 -- (-1014.048) (-1014.665) (-1015.927) [-1017.435] * (-1020.647) [-1013.711] (-1014.356) (-1015.839) -- 0:00:34
491500 -- (-1016.442) (-1013.731) (-1016.854) [-1014.531] * (-1018.268) [-1016.013] (-1012.454) (-1013.651) -- 0:00:34
492000 -- (-1013.815) (-1015.193) [-1015.805] (-1015.155) * [-1012.963] (-1018.273) (-1013.291) (-1012.930) -- 0:00:34
492500 -- (-1013.322) [-1013.829] (-1014.762) (-1014.757) * (-1012.438) (-1016.910) [-1014.240] (-1013.712) -- 0:00:34
493000 -- [-1015.460] (-1013.204) (-1015.264) (-1018.941) * (-1014.563) [-1014.284] (-1016.206) (-1013.310) -- 0:00:33
493500 -- (-1015.016) (-1015.190) [-1013.879] (-1014.956) * [-1014.864] (-1021.054) (-1014.826) (-1014.532) -- 0:00:33
494000 -- (-1014.454) (-1014.209) (-1013.382) [-1013.359] * (-1015.869) (-1015.772) [-1013.909] (-1014.925) -- 0:00:33
494500 -- (-1013.976) [-1015.314] (-1015.326) (-1013.445) * (-1013.287) [-1015.043] (-1013.666) (-1014.080) -- 0:00:33
495000 -- [-1016.667] (-1013.216) (-1013.541) (-1013.303) * (-1013.061) [-1013.646] (-1012.498) (-1014.872) -- 0:00:33
Average standard deviation of split frequencies: 0.010510
495500 -- (-1018.056) (-1014.270) (-1019.863) [-1012.886] * (-1016.738) [-1015.597] (-1015.618) (-1015.922) -- 0:00:33
496000 -- (-1013.924) [-1013.881] (-1017.355) (-1013.895) * (-1014.584) (-1017.426) (-1015.050) [-1018.186] -- 0:00:33
496500 -- (-1017.336) [-1015.784] (-1014.184) (-1013.427) * [-1014.952] (-1013.247) (-1018.703) (-1017.118) -- 0:00:33
497000 -- (-1014.540) (-1015.382) [-1014.602] (-1013.041) * (-1016.882) (-1014.512) (-1013.816) [-1017.068] -- 0:00:33
497500 -- (-1013.224) (-1014.072) [-1014.055] (-1013.653) * (-1013.673) [-1015.196] (-1012.631) (-1015.341) -- 0:00:33
498000 -- (-1013.148) [-1014.064] (-1014.600) (-1014.971) * [-1013.382] (-1013.642) (-1013.761) (-1015.951) -- 0:00:33
498500 -- (-1015.725) [-1017.341] (-1013.064) (-1019.361) * [-1015.893] (-1017.064) (-1013.516) (-1016.031) -- 0:00:33
499000 -- [-1015.192] (-1014.088) (-1013.119) (-1013.745) * (-1014.234) (-1016.808) (-1015.663) [-1016.592] -- 0:00:33
499500 -- (-1018.340) (-1014.631) [-1014.401] (-1016.983) * (-1015.531) [-1016.727] (-1013.247) (-1014.775) -- 0:00:33
500000 -- [-1013.206] (-1014.886) (-1013.967) (-1017.399) * [-1013.769] (-1019.305) (-1017.089) (-1016.430) -- 0:00:33
Average standard deviation of split frequencies: 0.009859
500500 -- (-1013.460) (-1014.099) (-1014.653) [-1012.793] * (-1014.619) (-1015.592) [-1015.642] (-1012.563) -- 0:00:32
501000 -- (-1016.740) [-1016.163] (-1013.974) (-1012.961) * (-1015.608) (-1014.256) [-1017.666] (-1014.283) -- 0:00:32
501500 -- (-1013.730) [-1014.578] (-1013.966) (-1014.227) * (-1017.737) [-1013.942] (-1014.738) (-1013.131) -- 0:00:32
502000 -- (-1017.145) (-1014.193) (-1013.851) [-1015.225] * (-1018.354) (-1014.754) (-1013.468) [-1013.566] -- 0:00:33
502500 -- (-1017.356) (-1016.051) [-1013.437] (-1014.861) * (-1014.931) (-1014.836) [-1014.792] (-1023.908) -- 0:00:33
503000 -- (-1016.412) (-1015.588) (-1014.688) [-1017.881] * (-1016.080) [-1016.123] (-1014.006) (-1019.289) -- 0:00:33
503500 -- [-1014.240] (-1015.276) (-1015.766) (-1017.893) * (-1015.889) [-1016.479] (-1013.769) (-1016.791) -- 0:00:33
504000 -- (-1014.244) (-1016.265) [-1017.367] (-1015.128) * (-1013.603) (-1013.262) [-1015.664] (-1014.467) -- 0:00:33
504500 -- [-1014.521] (-1013.633) (-1013.662) (-1017.747) * (-1014.507) [-1012.773] (-1015.918) (-1012.598) -- 0:00:33
505000 -- (-1013.796) (-1012.998) [-1018.227] (-1016.997) * (-1013.071) [-1013.284] (-1018.188) (-1012.968) -- 0:00:33
Average standard deviation of split frequencies: 0.010193
505500 -- (-1013.671) [-1017.327] (-1014.566) (-1015.213) * [-1014.038] (-1012.862) (-1014.972) (-1016.718) -- 0:00:33
506000 -- [-1014.755] (-1015.324) (-1019.591) (-1017.894) * (-1013.639) [-1013.687] (-1013.586) (-1017.010) -- 0:00:33
506500 -- [-1014.309] (-1017.730) (-1015.172) (-1015.697) * (-1012.691) (-1016.654) [-1013.509] (-1015.087) -- 0:00:33
507000 -- (-1014.136) [-1013.667] (-1013.889) (-1013.461) * (-1014.351) [-1016.541] (-1016.656) (-1018.105) -- 0:00:33
507500 -- (-1015.811) (-1014.755) [-1014.140] (-1014.016) * (-1013.548) (-1018.519) [-1014.077] (-1014.982) -- 0:00:32
508000 -- (-1013.372) (-1013.193) (-1016.065) [-1015.878] * (-1014.517) (-1018.431) [-1015.590] (-1013.401) -- 0:00:32
508500 -- (-1020.579) [-1013.386] (-1014.846) (-1016.232) * (-1014.550) (-1014.243) (-1017.969) [-1012.842] -- 0:00:32
509000 -- [-1015.385] (-1012.882) (-1013.536) (-1017.260) * (-1015.056) (-1012.792) (-1014.273) [-1015.267] -- 0:00:32
509500 -- (-1015.964) (-1014.344) (-1013.749) [-1014.768] * [-1014.799] (-1014.809) (-1017.916) (-1014.770) -- 0:00:32
510000 -- (-1016.564) [-1015.397] (-1015.907) (-1014.569) * (-1014.541) (-1014.855) [-1013.982] (-1013.135) -- 0:00:32
Average standard deviation of split frequencies: 0.011135
510500 -- [-1014.219] (-1012.683) (-1014.541) (-1012.774) * (-1017.134) (-1013.917) [-1016.878] (-1014.682) -- 0:00:32
511000 -- (-1013.363) [-1012.821] (-1018.137) (-1013.260) * [-1014.882] (-1015.997) (-1013.472) (-1014.902) -- 0:00:32
511500 -- (-1016.269) (-1016.652) [-1017.440] (-1012.904) * (-1013.559) (-1014.306) [-1013.380] (-1014.146) -- 0:00:32
512000 -- [-1014.119] (-1013.130) (-1014.946) (-1016.582) * (-1015.805) (-1014.759) (-1014.439) [-1012.393] -- 0:00:32
512500 -- (-1017.966) (-1018.418) (-1013.129) [-1015.659] * (-1014.169) (-1014.008) [-1016.200] (-1018.807) -- 0:00:32
513000 -- (-1014.469) (-1014.392) (-1024.458) [-1013.854] * (-1014.157) (-1014.966) (-1012.891) [-1017.107] -- 0:00:32
513500 -- (-1013.192) (-1017.770) (-1018.458) [-1013.880] * (-1014.565) (-1014.768) (-1013.066) [-1013.250] -- 0:00:32
514000 -- [-1013.003] (-1012.942) (-1016.174) (-1014.546) * [-1016.318] (-1016.800) (-1015.938) (-1012.559) -- 0:00:32
514500 -- (-1015.618) (-1014.069) [-1013.781] (-1014.668) * (-1018.621) (-1016.996) (-1015.358) [-1012.554] -- 0:00:32
515000 -- (-1013.307) (-1014.161) [-1012.583] (-1015.528) * (-1021.923) [-1015.642] (-1013.827) (-1014.372) -- 0:00:32
Average standard deviation of split frequencies: 0.010563
515500 -- [-1017.609] (-1013.552) (-1014.636) (-1013.537) * (-1014.109) (-1016.457) [-1012.844] (-1014.947) -- 0:00:31
516000 -- (-1014.366) [-1013.544] (-1014.379) (-1015.068) * [-1015.609] (-1015.950) (-1015.593) (-1013.858) -- 0:00:31
516500 -- (-1012.743) [-1014.203] (-1013.959) (-1016.373) * (-1019.942) [-1013.565] (-1015.632) (-1012.606) -- 0:00:31
517000 -- [-1014.652] (-1015.697) (-1013.293) (-1015.488) * (-1016.182) [-1013.086] (-1015.643) (-1015.627) -- 0:00:31
517500 -- (-1014.830) (-1016.241) [-1013.772] (-1015.065) * [-1018.118] (-1012.747) (-1016.427) (-1014.049) -- 0:00:31
518000 -- (-1013.385) (-1020.522) [-1013.257] (-1015.771) * (-1013.778) (-1013.291) (-1015.697) [-1013.451] -- 0:00:31
518500 -- (-1015.631) (-1015.082) (-1015.040) [-1013.737] * (-1014.267) (-1015.300) [-1015.798] (-1014.320) -- 0:00:31
519000 -- (-1015.613) [-1013.732] (-1018.444) (-1023.053) * (-1014.827) [-1014.874] (-1012.991) (-1014.315) -- 0:00:32
519500 -- (-1017.559) (-1017.038) (-1015.344) [-1013.861] * (-1017.228) (-1013.517) [-1013.590] (-1016.774) -- 0:00:32
520000 -- (-1015.704) (-1015.678) (-1014.009) [-1014.536] * (-1013.723) (-1013.796) (-1016.254) [-1015.291] -- 0:00:32
Average standard deviation of split frequencies: 0.010299
520500 -- [-1012.930] (-1019.179) (-1013.510) (-1013.221) * (-1013.516) [-1013.723] (-1012.913) (-1016.122) -- 0:00:32
521000 -- (-1020.447) [-1015.734] (-1015.404) (-1013.776) * (-1017.243) (-1013.342) [-1016.977] (-1014.565) -- 0:00:32
521500 -- (-1017.668) (-1014.936) (-1017.990) [-1012.892] * [-1014.904] (-1017.212) (-1014.326) (-1014.039) -- 0:00:32
522000 -- [-1014.412] (-1014.093) (-1019.020) (-1013.574) * (-1012.948) (-1014.001) (-1013.506) [-1013.062] -- 0:00:32
522500 -- (-1014.799) [-1012.505] (-1014.313) (-1014.748) * (-1013.019) (-1014.211) [-1013.929] (-1014.259) -- 0:00:31
523000 -- (-1015.235) (-1012.888) [-1013.280] (-1016.849) * (-1013.662) [-1013.390] (-1014.897) (-1013.715) -- 0:00:31
523500 -- (-1015.420) (-1013.630) [-1013.590] (-1012.432) * (-1016.473) (-1013.602) [-1013.126] (-1013.641) -- 0:00:31
524000 -- [-1014.246] (-1013.752) (-1015.047) (-1013.509) * (-1014.525) (-1015.741) [-1015.455] (-1013.718) -- 0:00:31
524500 -- (-1012.418) (-1016.812) (-1016.423) [-1013.672] * (-1015.565) [-1014.500] (-1017.154) (-1014.299) -- 0:00:31
525000 -- (-1015.489) (-1013.127) [-1014.885] (-1014.525) * (-1017.562) [-1012.992] (-1014.217) (-1014.667) -- 0:00:31
Average standard deviation of split frequencies: 0.010586
525500 -- [-1015.284] (-1013.543) (-1017.628) (-1016.193) * (-1015.942) [-1014.372] (-1017.694) (-1016.015) -- 0:00:31
526000 -- (-1016.207) (-1015.126) [-1014.444] (-1012.973) * (-1012.769) (-1014.768) (-1018.670) [-1014.460] -- 0:00:31
526500 -- [-1016.041] (-1014.772) (-1015.879) (-1015.967) * (-1015.571) [-1014.366] (-1015.043) (-1019.187) -- 0:00:31
527000 -- (-1013.843) (-1014.831) (-1014.959) [-1018.184] * (-1016.420) (-1015.484) [-1014.166] (-1015.076) -- 0:00:31
527500 -- (-1019.087) (-1015.882) [-1013.815] (-1017.786) * [-1015.669] (-1013.460) (-1017.577) (-1013.637) -- 0:00:31
528000 -- (-1015.262) (-1013.276) (-1016.802) [-1018.452] * (-1017.291) [-1013.452] (-1018.926) (-1013.624) -- 0:00:31
528500 -- (-1014.664) (-1017.738) (-1016.030) [-1015.007] * [-1014.907] (-1014.715) (-1014.004) (-1013.664) -- 0:00:31
529000 -- (-1013.186) (-1020.542) [-1013.139] (-1013.711) * (-1016.893) (-1013.186) [-1012.903] (-1012.841) -- 0:00:31
529500 -- (-1013.306) (-1015.506) (-1014.126) [-1013.028] * (-1014.226) (-1015.076) (-1014.510) [-1013.404] -- 0:00:31
530000 -- [-1013.025] (-1014.083) (-1016.084) (-1014.494) * (-1013.603) [-1017.853] (-1018.277) (-1017.640) -- 0:00:31
Average standard deviation of split frequencies: 0.011182
530500 -- [-1014.664] (-1014.933) (-1016.463) (-1017.860) * (-1013.013) (-1013.861) (-1016.000) [-1015.151] -- 0:00:30
531000 -- (-1013.828) [-1015.602] (-1014.157) (-1014.893) * (-1017.150) (-1014.566) (-1013.814) [-1014.473] -- 0:00:30
531500 -- (-1015.048) (-1018.875) [-1014.629] (-1016.678) * (-1016.853) (-1014.535) (-1012.866) [-1014.810] -- 0:00:30
532000 -- (-1014.284) (-1015.508) (-1017.084) [-1014.744] * (-1014.311) (-1013.541) (-1012.921) [-1015.496] -- 0:00:30
532500 -- (-1015.186) [-1014.068] (-1016.806) (-1016.367) * (-1015.488) (-1014.410) (-1014.861) [-1013.588] -- 0:00:30
533000 -- (-1014.466) (-1014.948) (-1013.713) [-1013.413] * (-1015.562) (-1014.614) (-1015.496) [-1013.407] -- 0:00:30
533500 -- (-1014.616) (-1014.898) [-1014.739] (-1014.311) * [-1014.429] (-1015.294) (-1016.241) (-1014.904) -- 0:00:30
534000 -- (-1012.828) (-1013.531) (-1013.014) [-1014.272] * (-1014.164) (-1013.907) (-1016.034) [-1013.025] -- 0:00:30
534500 -- [-1015.199] (-1014.102) (-1014.515) (-1017.871) * [-1015.733] (-1013.674) (-1014.933) (-1013.106) -- 0:00:30
535000 -- (-1013.528) (-1014.838) (-1012.621) [-1014.318] * [-1014.166] (-1014.565) (-1014.346) (-1013.702) -- 0:00:31
Average standard deviation of split frequencies: 0.011104
535500 -- (-1012.839) (-1014.097) [-1014.715] (-1012.750) * (-1014.637) (-1016.392) [-1016.567] (-1013.686) -- 0:00:31
536000 -- (-1016.414) [-1013.711] (-1013.555) (-1015.381) * (-1014.921) [-1013.369] (-1015.680) (-1013.053) -- 0:00:31
536500 -- (-1013.406) [-1014.139] (-1017.792) (-1014.446) * (-1013.111) [-1012.730] (-1014.749) (-1012.640) -- 0:00:31
537000 -- [-1018.169] (-1016.117) (-1016.183) (-1012.832) * (-1013.003) [-1013.588] (-1014.836) (-1014.668) -- 0:00:31
537500 -- (-1015.747) (-1017.142) (-1016.377) [-1014.641] * (-1014.448) (-1015.169) (-1014.429) [-1013.073] -- 0:00:30
538000 -- (-1014.234) (-1018.311) [-1016.577] (-1013.872) * (-1013.407) (-1014.431) (-1014.608) [-1015.102] -- 0:00:30
538500 -- [-1016.080] (-1014.356) (-1014.445) (-1013.279) * (-1013.208) (-1016.508) (-1015.028) [-1016.517] -- 0:00:30
539000 -- (-1016.226) [-1021.075] (-1015.239) (-1013.454) * (-1015.247) (-1017.408) (-1013.555) [-1016.439] -- 0:00:30
539500 -- [-1019.476] (-1017.729) (-1013.851) (-1015.618) * (-1013.061) (-1018.754) [-1014.456] (-1018.741) -- 0:00:30
540000 -- [-1013.892] (-1016.302) (-1017.368) (-1014.366) * (-1015.205) (-1013.086) (-1018.601) [-1013.753] -- 0:00:30
Average standard deviation of split frequencies: 0.011117
540500 -- [-1012.935] (-1016.128) (-1018.355) (-1014.071) * [-1014.526] (-1015.294) (-1016.165) (-1014.139) -- 0:00:30
541000 -- (-1013.725) (-1014.366) (-1018.638) [-1014.246] * (-1014.660) (-1016.481) [-1018.086] (-1014.117) -- 0:00:30
541500 -- (-1016.654) (-1014.272) (-1018.371) [-1013.254] * [-1015.534] (-1015.234) (-1014.135) (-1012.669) -- 0:00:30
542000 -- (-1015.892) (-1017.708) (-1016.261) [-1013.566] * (-1016.830) (-1017.137) (-1015.163) [-1014.682] -- 0:00:30
542500 -- (-1017.685) (-1020.263) [-1013.511] (-1013.371) * (-1016.596) (-1017.152) (-1013.473) [-1013.660] -- 0:00:30
543000 -- (-1020.529) (-1019.876) [-1013.231] (-1013.871) * (-1017.245) (-1013.849) [-1013.209] (-1017.020) -- 0:00:30
543500 -- (-1015.038) (-1015.081) [-1014.245] (-1013.747) * (-1016.996) (-1015.068) [-1013.792] (-1017.743) -- 0:00:30
544000 -- (-1013.847) (-1014.379) (-1013.146) [-1013.019] * (-1013.045) [-1017.984] (-1016.686) (-1014.098) -- 0:00:30
544500 -- (-1014.856) (-1020.202) (-1020.300) [-1012.681] * (-1017.091) (-1014.497) (-1014.558) [-1015.288] -- 0:00:30
545000 -- (-1019.200) (-1018.997) [-1016.152] (-1012.667) * [-1016.750] (-1015.191) (-1018.327) (-1015.535) -- 0:00:30
Average standard deviation of split frequencies: 0.011224
545500 -- (-1017.156) (-1013.799) (-1022.155) [-1015.385] * (-1017.179) [-1013.673] (-1014.792) (-1015.490) -- 0:00:29
546000 -- (-1014.389) (-1014.202) (-1021.399) [-1015.173] * (-1013.806) [-1013.909] (-1014.221) (-1013.557) -- 0:00:29
546500 -- [-1012.942] (-1013.683) (-1016.695) (-1015.987) * (-1014.997) (-1013.695) (-1016.110) [-1017.027] -- 0:00:29
547000 -- (-1013.794) (-1013.226) (-1015.559) [-1014.096] * (-1014.689) (-1017.192) (-1020.243) [-1014.457] -- 0:00:29
547500 -- [-1013.624] (-1013.246) (-1014.469) (-1015.955) * [-1015.650] (-1016.088) (-1013.170) (-1016.674) -- 0:00:29
548000 -- [-1013.546] (-1013.242) (-1015.035) (-1015.773) * (-1013.492) [-1013.179] (-1013.169) (-1015.044) -- 0:00:29
548500 -- (-1015.127) (-1016.086) [-1014.668] (-1012.627) * (-1013.713) (-1013.919) (-1013.292) [-1013.245] -- 0:00:29
549000 -- [-1013.177] (-1015.852) (-1015.676) (-1014.790) * [-1013.126] (-1012.462) (-1014.149) (-1014.899) -- 0:00:29
549500 -- (-1016.146) (-1018.111) (-1016.622) [-1016.551] * (-1013.267) (-1013.004) (-1014.426) [-1015.429] -- 0:00:29
550000 -- (-1012.931) (-1014.915) [-1014.198] (-1016.033) * (-1013.497) (-1013.043) (-1012.945) [-1013.701] -- 0:00:29
Average standard deviation of split frequencies: 0.010968
550500 -- [-1013.346] (-1014.808) (-1012.508) (-1012.701) * (-1013.163) [-1013.636] (-1014.154) (-1016.557) -- 0:00:29
551000 -- (-1022.035) (-1015.436) [-1014.577] (-1012.807) * (-1013.874) (-1018.648) (-1016.238) [-1018.780] -- 0:00:30
551500 -- [-1015.330] (-1014.686) (-1013.995) (-1013.273) * (-1017.190) [-1015.366] (-1014.838) (-1016.648) -- 0:00:30
552000 -- (-1014.310) [-1017.288] (-1013.462) (-1015.506) * [-1015.765] (-1014.850) (-1016.533) (-1016.798) -- 0:00:30
552500 -- (-1013.189) [-1013.960] (-1014.589) (-1013.060) * (-1014.221) (-1016.748) [-1013.562] (-1014.772) -- 0:00:29
553000 -- [-1013.269] (-1014.042) (-1014.268) (-1015.899) * (-1012.967) (-1014.325) [-1013.498] (-1021.206) -- 0:00:29
553500 -- [-1014.653] (-1014.635) (-1015.196) (-1015.844) * (-1014.365) (-1018.132) [-1013.160] (-1015.427) -- 0:00:29
554000 -- [-1012.853] (-1016.336) (-1014.222) (-1013.867) * (-1016.487) (-1015.284) [-1013.160] (-1014.073) -- 0:00:29
554500 -- (-1013.351) (-1013.617) [-1016.311] (-1017.707) * (-1013.729) [-1014.180] (-1014.887) (-1018.515) -- 0:00:29
555000 -- [-1015.294] (-1013.582) (-1013.728) (-1015.457) * (-1012.978) (-1015.137) [-1013.584] (-1014.123) -- 0:00:29
Average standard deviation of split frequencies: 0.010916
555500 -- (-1019.385) [-1013.136] (-1012.328) (-1012.878) * (-1014.118) (-1016.196) (-1014.642) [-1014.143] -- 0:00:29
556000 -- (-1015.356) [-1012.730] (-1013.206) (-1013.299) * (-1015.887) (-1015.122) (-1014.095) [-1014.610] -- 0:00:29
556500 -- (-1018.136) [-1013.473] (-1013.768) (-1015.678) * [-1013.926] (-1014.381) (-1014.337) (-1014.202) -- 0:00:29
557000 -- (-1018.287) (-1019.357) (-1017.407) [-1015.413] * (-1017.969) (-1020.110) [-1014.234] (-1014.262) -- 0:00:29
557500 -- [-1017.136] (-1018.516) (-1016.900) (-1012.760) * (-1017.054) [-1015.565] (-1014.017) (-1014.763) -- 0:00:29
558000 -- (-1016.686) [-1013.399] (-1018.063) (-1019.312) * (-1014.703) (-1015.695) (-1013.747) [-1017.150] -- 0:00:29
558500 -- (-1015.839) [-1013.654] (-1014.395) (-1014.968) * (-1015.447) (-1015.015) [-1015.598] (-1014.864) -- 0:00:29
559000 -- [-1015.185] (-1014.998) (-1013.183) (-1013.631) * (-1014.810) [-1012.388] (-1016.054) (-1013.867) -- 0:00:29
559500 -- (-1013.646) (-1014.692) (-1013.611) [-1013.342] * (-1014.649) [-1013.062] (-1012.442) (-1014.113) -- 0:00:29
560000 -- (-1013.711) (-1019.455) [-1016.837] (-1013.011) * [-1013.674] (-1014.374) (-1018.415) (-1013.913) -- 0:00:29
Average standard deviation of split frequencies: 0.010773
560500 -- (-1015.022) (-1014.365) (-1013.914) [-1012.937] * (-1013.501) (-1017.074) [-1013.165] (-1015.483) -- 0:00:29
561000 -- (-1014.815) (-1012.484) [-1016.356] (-1012.435) * (-1014.358) [-1013.824] (-1015.762) (-1016.027) -- 0:00:28
561500 -- (-1014.792) (-1013.094) [-1015.208] (-1013.322) * (-1014.450) (-1021.514) [-1013.732] (-1016.208) -- 0:00:28
562000 -- (-1013.587) [-1014.489] (-1013.585) (-1016.191) * (-1014.375) [-1016.216] (-1015.178) (-1014.481) -- 0:00:28
562500 -- (-1016.735) (-1017.616) (-1017.496) [-1014.949] * [-1013.748] (-1018.818) (-1016.780) (-1013.901) -- 0:00:28
563000 -- (-1013.196) [-1013.438] (-1013.346) (-1013.456) * (-1017.032) (-1013.509) (-1013.549) [-1015.010] -- 0:00:28
563500 -- (-1020.161) (-1015.889) (-1014.609) [-1016.745] * (-1013.959) (-1014.395) [-1013.228] (-1014.414) -- 0:00:28
564000 -- (-1013.830) (-1015.550) [-1015.282] (-1013.591) * (-1012.767) [-1014.148] (-1015.328) (-1017.080) -- 0:00:28
564500 -- [-1013.738] (-1016.579) (-1014.397) (-1013.337) * (-1012.363) (-1019.286) (-1014.154) [-1014.760] -- 0:00:28
565000 -- (-1016.021) (-1014.948) (-1019.521) [-1012.727] * (-1013.082) [-1014.002] (-1014.106) (-1018.796) -- 0:00:28
Average standard deviation of split frequencies: 0.010781
565500 -- (-1013.981) (-1013.244) (-1017.555) [-1015.660] * (-1014.201) [-1013.936] (-1015.250) (-1016.580) -- 0:00:28
566000 -- [-1014.759] (-1018.961) (-1014.821) (-1015.053) * [-1013.401] (-1014.689) (-1013.765) (-1020.768) -- 0:00:28
566500 -- (-1012.941) (-1013.939) [-1013.839] (-1016.052) * (-1013.709) (-1014.095) [-1012.714] (-1018.949) -- 0:00:28
567000 -- (-1014.565) (-1020.058) (-1013.889) [-1015.020] * (-1019.915) (-1014.425) (-1013.820) [-1018.058] -- 0:00:28
567500 -- (-1015.276) (-1013.122) (-1014.533) [-1014.270] * (-1017.545) (-1014.610) (-1012.998) [-1013.299] -- 0:00:28
568000 -- (-1016.713) (-1017.519) (-1015.353) [-1012.573] * (-1015.026) (-1014.047) (-1020.756) [-1015.415] -- 0:00:28
568500 -- (-1013.817) (-1012.422) [-1015.363] (-1013.298) * (-1016.564) (-1013.718) [-1013.759] (-1014.115) -- 0:00:28
569000 -- (-1013.668) [-1015.239] (-1014.642) (-1013.298) * (-1016.322) [-1014.768] (-1013.170) (-1017.321) -- 0:00:28
569500 -- (-1013.346) [-1012.714] (-1016.671) (-1013.440) * (-1013.620) (-1016.982) [-1013.991] (-1014.810) -- 0:00:28
570000 -- (-1013.407) [-1012.613] (-1016.457) (-1015.369) * [-1013.202] (-1015.234) (-1015.434) (-1014.773) -- 0:00:28
Average standard deviation of split frequencies: 0.011462
570500 -- (-1012.846) [-1014.178] (-1014.321) (-1017.018) * (-1016.409) (-1014.873) (-1014.860) [-1015.630] -- 0:00:28
571000 -- [-1015.432] (-1013.041) (-1014.968) (-1013.618) * (-1015.646) [-1014.790] (-1013.652) (-1016.908) -- 0:00:28
571500 -- (-1013.882) [-1016.439] (-1014.448) (-1014.179) * (-1013.568) (-1013.621) (-1013.671) [-1013.921] -- 0:00:28
572000 -- (-1013.443) [-1014.182] (-1013.788) (-1017.343) * (-1012.946) (-1014.733) (-1014.448) [-1014.774] -- 0:00:28
572500 -- (-1015.732) (-1017.991) [-1018.216] (-1014.643) * [-1014.396] (-1014.672) (-1013.723) (-1013.464) -- 0:00:28
573000 -- [-1013.575] (-1012.893) (-1017.699) (-1014.407) * [-1014.055] (-1013.566) (-1014.344) (-1013.412) -- 0:00:28
573500 -- [-1013.111] (-1015.528) (-1012.636) (-1013.228) * (-1013.895) (-1017.736) [-1014.573] (-1013.595) -- 0:00:28
574000 -- (-1014.107) [-1014.185] (-1013.255) (-1015.029) * (-1017.051) (-1016.370) (-1012.626) [-1013.848] -- 0:00:28
574500 -- (-1016.057) (-1012.781) [-1012.917] (-1016.010) * (-1019.185) [-1013.608] (-1014.280) (-1013.648) -- 0:00:28
575000 -- (-1013.675) (-1012.832) [-1014.468] (-1012.874) * [-1014.228] (-1016.616) (-1015.788) (-1016.105) -- 0:00:28
Average standard deviation of split frequencies: 0.011304
575500 -- (-1013.044) (-1016.298) [-1014.292] (-1013.179) * (-1013.878) (-1013.920) (-1014.069) [-1014.572] -- 0:00:28
576000 -- (-1013.196) (-1015.313) (-1017.795) [-1013.490] * [-1014.479] (-1014.536) (-1014.431) (-1014.969) -- 0:00:27
576500 -- (-1016.891) (-1013.722) (-1016.630) [-1016.168] * (-1014.480) (-1014.779) [-1013.804] (-1013.841) -- 0:00:27
577000 -- (-1016.360) (-1014.671) (-1013.159) [-1013.253] * [-1014.881] (-1016.699) (-1013.483) (-1012.930) -- 0:00:27
577500 -- (-1019.261) (-1013.781) [-1013.487] (-1013.409) * (-1016.031) (-1016.890) [-1012.960] (-1015.448) -- 0:00:27
578000 -- (-1016.324) (-1012.957) [-1015.275] (-1012.877) * (-1016.304) (-1015.027) (-1012.774) [-1013.591] -- 0:00:27
578500 -- (-1019.620) [-1015.398] (-1012.592) (-1016.251) * (-1019.907) [-1016.351] (-1012.368) (-1013.000) -- 0:00:27
579000 -- (-1017.686) (-1014.976) [-1014.441] (-1013.778) * (-1015.416) (-1017.425) [-1013.373] (-1013.001) -- 0:00:27
579500 -- (-1018.023) (-1014.021) (-1013.796) [-1014.599] * (-1016.716) (-1013.650) [-1016.386] (-1014.124) -- 0:00:27
580000 -- (-1015.669) (-1014.257) (-1015.680) [-1015.709] * (-1014.419) [-1014.290] (-1013.024) (-1013.707) -- 0:00:27
Average standard deviation of split frequencies: 0.011467
580500 -- (-1014.166) [-1014.723] (-1013.351) (-1016.620) * (-1014.988) (-1014.169) (-1019.220) [-1012.597] -- 0:00:27
581000 -- (-1014.020) [-1014.334] (-1015.891) (-1016.259) * [-1013.999] (-1013.006) (-1016.241) (-1013.749) -- 0:00:27
581500 -- [-1013.479] (-1015.345) (-1018.441) (-1014.177) * [-1015.976] (-1013.036) (-1013.352) (-1013.726) -- 0:00:27
582000 -- (-1016.915) [-1015.174] (-1018.247) (-1013.510) * (-1015.091) (-1013.238) (-1016.616) [-1014.036] -- 0:00:27
582500 -- [-1013.587] (-1014.820) (-1016.035) (-1018.421) * (-1016.510) (-1017.516) [-1013.467] (-1015.633) -- 0:00:27
583000 -- (-1016.747) (-1014.514) [-1013.602] (-1013.009) * (-1017.978) (-1014.043) (-1014.257) [-1014.260] -- 0:00:27
583500 -- (-1014.864) [-1013.300] (-1014.148) (-1013.876) * (-1016.223) (-1015.282) [-1013.753] (-1014.534) -- 0:00:27
584000 -- (-1014.883) (-1013.909) [-1013.172] (-1013.389) * (-1016.683) (-1018.052) (-1014.126) [-1017.373] -- 0:00:27
584500 -- [-1014.717] (-1015.750) (-1014.478) (-1013.998) * (-1014.236) (-1016.839) (-1014.455) [-1015.020] -- 0:00:27
585000 -- [-1014.905] (-1016.466) (-1012.872) (-1013.198) * (-1014.334) (-1013.556) (-1012.859) [-1016.144] -- 0:00:27
Average standard deviation of split frequencies: 0.011363
585500 -- (-1015.929) (-1017.962) [-1014.280] (-1013.661) * (-1015.480) [-1015.248] (-1013.612) (-1015.600) -- 0:00:27
586000 -- (-1017.415) (-1016.100) [-1014.265] (-1015.022) * (-1012.908) (-1014.088) [-1013.129] (-1016.771) -- 0:00:27
586500 -- [-1012.487] (-1014.532) (-1014.955) (-1013.026) * (-1012.586) [-1013.127] (-1013.597) (-1019.345) -- 0:00:27
587000 -- [-1013.447] (-1015.662) (-1017.009) (-1015.337) * (-1015.296) [-1012.541] (-1014.020) (-1016.578) -- 0:00:27
587500 -- [-1014.986] (-1015.987) (-1013.420) (-1013.690) * [-1016.289] (-1012.831) (-1016.534) (-1015.416) -- 0:00:27
588000 -- [-1012.848] (-1012.926) (-1013.242) (-1013.988) * (-1017.724) [-1015.734] (-1014.569) (-1014.430) -- 0:00:27
588500 -- (-1014.829) (-1013.988) (-1018.805) [-1013.842] * (-1016.784) (-1017.530) (-1013.688) [-1014.568] -- 0:00:27
589000 -- [-1012.618] (-1013.822) (-1014.612) (-1013.906) * (-1018.814) (-1013.759) (-1015.371) [-1014.831] -- 0:00:27
589500 -- [-1012.360] (-1016.377) (-1013.665) (-1013.087) * (-1018.154) (-1013.005) [-1013.107] (-1014.026) -- 0:00:27
590000 -- (-1020.797) (-1014.771) [-1015.357] (-1014.982) * [-1014.356] (-1014.948) (-1013.062) (-1013.646) -- 0:00:27
Average standard deviation of split frequencies: 0.011173
590500 -- (-1014.911) [-1013.821] (-1015.428) (-1013.515) * [-1014.375] (-1014.452) (-1012.950) (-1013.249) -- 0:00:27
591000 -- [-1021.789] (-1015.605) (-1013.764) (-1013.497) * (-1014.131) (-1017.822) [-1015.540] (-1015.006) -- 0:00:26
591500 -- [-1015.122] (-1014.289) (-1012.858) (-1014.940) * [-1014.413] (-1017.300) (-1014.066) (-1013.048) -- 0:00:26
592000 -- (-1015.595) (-1015.739) (-1013.879) [-1014.957] * (-1013.598) [-1012.934] (-1015.087) (-1020.041) -- 0:00:26
592500 -- [-1014.139] (-1013.962) (-1016.442) (-1017.519) * [-1014.925] (-1013.455) (-1016.308) (-1014.426) -- 0:00:26
593000 -- (-1013.805) (-1014.306) [-1014.034] (-1016.146) * (-1014.948) [-1013.154] (-1018.194) (-1012.965) -- 0:00:26
593500 -- (-1013.592) (-1014.630) (-1014.067) [-1015.704] * (-1016.738) (-1013.862) [-1015.882] (-1015.269) -- 0:00:26
594000 -- (-1017.058) (-1013.648) [-1013.802] (-1015.481) * (-1016.479) (-1015.748) (-1014.866) [-1014.660] -- 0:00:26
594500 -- (-1013.648) (-1014.691) [-1012.866] (-1014.623) * [-1015.201] (-1014.115) (-1014.612) (-1014.635) -- 0:00:26
595000 -- (-1013.689) [-1018.115] (-1014.673) (-1016.864) * (-1017.389) [-1013.609] (-1017.430) (-1017.061) -- 0:00:26
Average standard deviation of split frequencies: 0.011123
595500 -- (-1014.381) (-1015.098) [-1014.573] (-1014.004) * (-1016.074) (-1014.624) (-1015.678) [-1014.018] -- 0:00:26
596000 -- (-1013.138) (-1012.970) (-1013.052) [-1013.871] * (-1015.063) (-1016.242) [-1012.907] (-1013.730) -- 0:00:26
596500 -- (-1014.381) (-1016.635) (-1012.652) [-1014.023] * (-1016.687) (-1016.050) [-1012.526] (-1015.449) -- 0:00:26
597000 -- (-1013.545) (-1016.986) (-1012.594) [-1013.345] * (-1017.070) (-1014.196) (-1016.268) [-1013.654] -- 0:00:26
597500 -- (-1015.782) (-1015.174) [-1014.621] (-1016.452) * (-1015.268) [-1013.818] (-1017.210) (-1015.593) -- 0:00:26
598000 -- [-1017.339] (-1016.023) (-1016.146) (-1016.465) * (-1014.883) (-1013.281) (-1014.812) [-1014.442] -- 0:00:26
598500 -- (-1020.807) (-1014.746) [-1016.328] (-1016.022) * (-1013.298) [-1013.978] (-1016.441) (-1015.358) -- 0:00:26
599000 -- [-1015.350] (-1013.043) (-1014.277) (-1014.760) * [-1013.223] (-1018.425) (-1013.417) (-1013.640) -- 0:00:26
599500 -- [-1014.618] (-1013.670) (-1014.592) (-1013.766) * (-1016.054) (-1018.820) (-1012.460) [-1013.401] -- 0:00:26
600000 -- [-1012.547] (-1015.462) (-1014.973) (-1014.821) * [-1014.266] (-1016.716) (-1012.687) (-1013.675) -- 0:00:26
Average standard deviation of split frequencies: 0.011036
600500 -- (-1016.318) (-1012.946) (-1014.793) [-1012.852] * [-1017.555] (-1015.619) (-1014.716) (-1015.048) -- 0:00:26
601000 -- (-1015.430) (-1013.713) (-1014.083) [-1014.708] * (-1015.246) [-1013.818] (-1013.801) (-1019.818) -- 0:00:26
601500 -- [-1014.383] (-1020.259) (-1013.084) (-1013.674) * (-1014.954) (-1018.486) [-1015.690] (-1016.354) -- 0:00:26
602000 -- [-1012.664] (-1015.916) (-1014.132) (-1015.297) * (-1016.318) (-1016.607) (-1013.532) [-1013.919] -- 0:00:26
602500 -- [-1014.447] (-1014.075) (-1014.553) (-1018.123) * (-1015.398) [-1017.216] (-1012.691) (-1016.757) -- 0:00:26
603000 -- (-1015.950) [-1012.759] (-1015.677) (-1013.639) * (-1015.156) [-1013.675] (-1013.471) (-1014.897) -- 0:00:26
603500 -- [-1013.350] (-1013.155) (-1014.876) (-1015.613) * (-1016.441) [-1013.049] (-1013.191) (-1012.856) -- 0:00:26
604000 -- [-1017.733] (-1015.798) (-1014.892) (-1014.557) * (-1015.067) (-1014.289) [-1016.730] (-1014.312) -- 0:00:26
604500 -- (-1015.184) (-1014.228) [-1014.977] (-1014.240) * (-1015.208) [-1017.321] (-1015.197) (-1013.605) -- 0:00:26
605000 -- (-1013.700) (-1013.719) (-1013.271) [-1013.373] * (-1014.618) (-1012.535) [-1014.666] (-1013.455) -- 0:00:26
Average standard deviation of split frequencies: 0.010113
605500 -- (-1015.943) (-1013.240) (-1015.113) [-1013.511] * (-1013.543) [-1013.545] (-1014.338) (-1018.253) -- 0:00:26
606000 -- (-1015.684) (-1014.840) [-1015.862] (-1013.954) * [-1013.628] (-1013.807) (-1018.925) (-1014.610) -- 0:00:26
606500 -- [-1018.997] (-1013.834) (-1013.212) (-1015.083) * [-1013.967] (-1013.352) (-1012.831) (-1016.243) -- 0:00:25
607000 -- (-1020.798) [-1014.150] (-1013.402) (-1015.382) * (-1017.590) (-1014.067) (-1014.021) [-1015.964] -- 0:00:25
607500 -- (-1018.648) (-1013.583) [-1013.566] (-1015.448) * (-1013.433) (-1014.976) [-1014.044] (-1013.458) -- 0:00:25
608000 -- (-1012.963) [-1013.799] (-1016.519) (-1016.696) * (-1015.280) (-1012.810) [-1015.594] (-1013.225) -- 0:00:25
608500 -- (-1013.755) [-1013.986] (-1015.936) (-1012.520) * (-1016.310) [-1014.471] (-1012.929) (-1017.636) -- 0:00:25
609000 -- [-1013.827] (-1019.380) (-1013.999) (-1015.144) * [-1014.360] (-1016.505) (-1013.415) (-1015.377) -- 0:00:25
609500 -- (-1015.978) [-1015.899] (-1019.441) (-1012.769) * [-1017.291] (-1017.301) (-1013.899) (-1014.011) -- 0:00:25
610000 -- (-1017.044) [-1013.490] (-1014.893) (-1013.177) * (-1016.158) (-1019.026) [-1013.047] (-1013.965) -- 0:00:25
Average standard deviation of split frequencies: 0.010499
610500 -- (-1014.448) (-1015.789) (-1014.348) [-1013.547] * [-1014.760] (-1021.782) (-1013.053) (-1014.015) -- 0:00:25
611000 -- [-1014.989] (-1013.020) (-1014.674) (-1015.499) * (-1017.298) (-1013.325) (-1014.268) [-1016.355] -- 0:00:25
611500 -- (-1013.274) (-1014.667) (-1014.657) [-1018.048] * (-1016.736) [-1013.252] (-1013.558) (-1012.605) -- 0:00:25
612000 -- (-1015.595) [-1015.535] (-1014.141) (-1020.404) * (-1014.435) [-1017.952] (-1012.519) (-1013.372) -- 0:00:25
612500 -- [-1015.166] (-1013.021) (-1013.969) (-1014.079) * (-1014.503) (-1014.902) (-1012.515) [-1013.820] -- 0:00:25
613000 -- (-1013.483) (-1014.400) [-1014.820] (-1017.869) * (-1014.066) [-1014.641] (-1012.895) (-1013.821) -- 0:00:25
613500 -- (-1012.894) [-1014.619] (-1015.562) (-1012.699) * (-1019.754) (-1014.680) (-1012.833) [-1013.704] -- 0:00:25
614000 -- (-1014.634) (-1022.859) (-1014.875) [-1015.206] * [-1016.347] (-1015.702) (-1014.710) (-1016.971) -- 0:00:25
614500 -- (-1015.854) (-1014.048) [-1017.256] (-1015.809) * (-1013.426) [-1013.350] (-1020.440) (-1013.439) -- 0:00:25
615000 -- [-1014.036] (-1013.019) (-1018.407) (-1017.362) * [-1014.184] (-1012.928) (-1019.221) (-1015.603) -- 0:00:25
Average standard deviation of split frequencies: 0.010714
615500 -- [-1014.966] (-1014.086) (-1014.053) (-1022.199) * (-1013.002) [-1015.649] (-1014.316) (-1015.359) -- 0:00:25
616000 -- [-1014.024] (-1016.243) (-1016.110) (-1015.235) * (-1012.485) (-1017.857) (-1013.092) [-1014.362] -- 0:00:25
616500 -- (-1017.369) (-1014.077) [-1013.290] (-1015.572) * (-1013.318) (-1016.515) (-1015.415) [-1013.209] -- 0:00:25
617000 -- (-1013.669) [-1013.354] (-1013.822) (-1013.111) * (-1013.132) (-1014.234) (-1013.042) [-1014.455] -- 0:00:25
617500 -- [-1015.071] (-1013.334) (-1015.639) (-1014.894) * [-1016.570] (-1015.313) (-1015.124) (-1015.663) -- 0:00:25
618000 -- (-1014.863) [-1014.662] (-1015.347) (-1015.344) * [-1013.210] (-1013.023) (-1018.461) (-1016.212) -- 0:00:25
618500 -- (-1013.990) [-1014.238] (-1018.472) (-1015.624) * (-1015.268) (-1015.519) (-1013.777) [-1012.516] -- 0:00:25
619000 -- (-1014.283) [-1013.118] (-1022.290) (-1016.170) * (-1013.733) (-1013.359) [-1016.802] (-1016.573) -- 0:00:25
619500 -- (-1014.597) [-1013.202] (-1018.948) (-1020.067) * (-1014.159) (-1018.873) (-1015.688) [-1014.385] -- 0:00:25
620000 -- (-1013.222) (-1013.221) [-1015.328] (-1013.861) * (-1013.577) (-1016.946) [-1015.364] (-1017.983) -- 0:00:25
Average standard deviation of split frequencies: 0.010431
620500 -- [-1012.536] (-1013.894) (-1017.697) (-1014.797) * (-1016.488) [-1017.688] (-1013.994) (-1015.074) -- 0:00:25
621000 -- [-1012.731] (-1016.305) (-1017.070) (-1022.359) * (-1013.877) (-1016.859) (-1015.789) [-1015.290] -- 0:00:25
621500 -- (-1016.269) [-1013.475] (-1013.822) (-1013.506) * [-1012.491] (-1013.660) (-1015.912) (-1013.096) -- 0:00:24
622000 -- (-1017.120) [-1013.445] (-1013.195) (-1014.400) * (-1016.375) (-1013.489) [-1012.503] (-1013.699) -- 0:00:24
622500 -- (-1021.522) [-1015.215] (-1013.030) (-1015.271) * (-1014.513) [-1012.509] (-1015.981) (-1015.222) -- 0:00:24
623000 -- (-1016.628) [-1013.937] (-1014.726) (-1016.512) * (-1014.701) [-1012.664] (-1013.885) (-1014.178) -- 0:00:24
623500 -- (-1015.540) (-1017.217) (-1012.749) [-1014.838] * [-1013.151] (-1014.455) (-1014.321) (-1014.384) -- 0:00:24
624000 -- (-1013.486) [-1015.928] (-1013.138) (-1016.927) * [-1014.586] (-1022.602) (-1013.810) (-1013.463) -- 0:00:24
624500 -- (-1017.435) (-1015.723) (-1014.671) [-1013.868] * (-1013.099) [-1018.584] (-1015.715) (-1014.943) -- 0:00:24
625000 -- (-1022.175) (-1016.782) [-1014.414] (-1016.169) * (-1012.856) [-1016.739] (-1015.835) (-1014.046) -- 0:00:24
Average standard deviation of split frequencies: 0.010448
625500 -- [-1022.152] (-1015.984) (-1013.683) (-1013.923) * (-1018.167) [-1017.625] (-1014.857) (-1012.919) -- 0:00:24
626000 -- (-1018.468) (-1014.903) (-1014.996) [-1013.212] * (-1016.459) (-1015.225) (-1016.054) [-1014.111] -- 0:00:24
626500 -- [-1016.360] (-1014.109) (-1013.724) (-1014.053) * (-1014.702) [-1014.175] (-1017.257) (-1013.778) -- 0:00:24
627000 -- (-1015.608) [-1015.455] (-1019.750) (-1017.448) * (-1013.136) (-1012.951) (-1015.797) [-1013.018] -- 0:00:24
627500 -- (-1013.137) (-1015.588) (-1013.220) [-1013.181] * (-1012.787) (-1013.990) (-1014.806) [-1013.885] -- 0:00:24
628000 -- (-1017.289) [-1014.035] (-1014.815) (-1015.095) * (-1013.049) (-1013.835) (-1020.039) [-1012.914] -- 0:00:24
628500 -- (-1015.662) (-1014.048) (-1014.667) [-1018.645] * (-1012.828) (-1012.365) [-1014.195] (-1015.946) -- 0:00:24
629000 -- (-1018.352) (-1014.030) [-1014.181] (-1015.626) * (-1014.059) (-1014.129) [-1014.062] (-1014.968) -- 0:00:24
629500 -- (-1013.203) (-1017.614) (-1014.603) [-1013.209] * [-1013.187] (-1014.937) (-1015.376) (-1013.799) -- 0:00:24
630000 -- (-1017.996) [-1017.703] (-1018.244) (-1013.510) * (-1017.837) (-1013.010) (-1013.069) [-1015.940] -- 0:00:24
Average standard deviation of split frequencies: 0.010138
630500 -- (-1013.115) (-1012.970) (-1015.317) [-1014.665] * (-1013.954) (-1013.975) [-1012.688] (-1013.831) -- 0:00:24
631000 -- (-1012.987) (-1017.073) [-1014.389] (-1017.394) * (-1012.749) (-1014.931) [-1012.794] (-1014.796) -- 0:00:24
631500 -- [-1013.671] (-1013.726) (-1015.913) (-1013.363) * (-1013.365) [-1014.604] (-1020.726) (-1015.253) -- 0:00:24
632000 -- (-1015.248) (-1014.927) [-1015.607] (-1014.673) * [-1016.196] (-1016.329) (-1019.315) (-1017.083) -- 0:00:24
632500 -- (-1016.072) (-1017.346) (-1013.339) [-1015.567] * (-1013.628) [-1015.497] (-1018.750) (-1012.601) -- 0:00:24
633000 -- [-1013.861] (-1016.402) (-1016.427) (-1012.979) * [-1013.886] (-1017.410) (-1021.547) (-1013.532) -- 0:00:24
633500 -- (-1012.474) (-1014.790) (-1013.322) [-1014.680] * (-1015.527) [-1015.936] (-1015.600) (-1014.766) -- 0:00:24
634000 -- (-1013.096) (-1014.638) [-1013.519] (-1016.953) * (-1016.973) (-1015.316) [-1018.961] (-1013.428) -- 0:00:24
634500 -- (-1012.442) (-1015.060) (-1013.715) [-1013.581] * (-1018.611) (-1014.022) (-1015.725) [-1012.845] -- 0:00:24
635000 -- (-1013.586) [-1016.713] (-1014.295) (-1014.240) * (-1014.556) [-1013.721] (-1015.990) (-1013.738) -- 0:00:24
Average standard deviation of split frequencies: 0.009339
635500 -- [-1014.148] (-1019.609) (-1014.293) (-1015.677) * (-1015.366) [-1013.739] (-1014.506) (-1019.007) -- 0:00:24
636000 -- (-1012.910) (-1016.610) [-1012.515] (-1014.351) * (-1015.299) (-1014.072) (-1012.893) [-1014.022] -- 0:00:24
636500 -- (-1012.412) (-1014.244) (-1012.877) [-1013.249] * (-1016.793) (-1015.255) (-1014.121) [-1015.209] -- 0:00:23
637000 -- (-1014.221) (-1015.017) (-1012.360) [-1013.406] * [-1015.536] (-1014.948) (-1015.178) (-1013.457) -- 0:00:23
637500 -- (-1015.455) (-1013.578) (-1015.298) [-1015.157] * [-1013.753] (-1014.916) (-1019.183) (-1014.024) -- 0:00:23
638000 -- (-1016.555) (-1013.240) [-1015.212] (-1014.925) * [-1015.692] (-1015.589) (-1013.657) (-1013.478) -- 0:00:23
638500 -- (-1020.166) (-1015.082) [-1014.863] (-1013.253) * (-1016.752) (-1013.122) (-1016.985) [-1013.347] -- 0:00:23
639000 -- (-1017.175) [-1014.037] (-1015.093) (-1014.364) * [-1016.352] (-1021.119) (-1017.882) (-1014.030) -- 0:00:23
639500 -- [-1013.747] (-1013.365) (-1015.834) (-1016.220) * (-1012.391) [-1012.620] (-1015.071) (-1017.274) -- 0:00:23
640000 -- (-1014.023) [-1012.689] (-1014.350) (-1015.862) * (-1012.373) (-1014.003) [-1013.624] (-1015.967) -- 0:00:23
Average standard deviation of split frequencies: 0.009418
640500 -- (-1015.305) (-1012.575) [-1013.906] (-1015.371) * (-1014.190) [-1014.690] (-1013.491) (-1013.280) -- 0:00:23
641000 -- (-1014.361) [-1017.771] (-1013.706) (-1014.218) * (-1014.360) (-1013.145) (-1015.071) [-1013.213] -- 0:00:23
641500 -- (-1013.385) (-1014.157) [-1015.349] (-1023.425) * [-1013.388] (-1014.801) (-1013.751) (-1016.173) -- 0:00:23
642000 -- [-1012.369] (-1015.458) (-1015.997) (-1014.219) * (-1019.566) (-1025.014) (-1014.536) [-1014.620] -- 0:00:23
642500 -- (-1012.536) [-1013.616] (-1015.485) (-1014.464) * (-1016.904) (-1014.537) [-1016.224] (-1016.272) -- 0:00:23
643000 -- [-1013.022] (-1013.799) (-1015.133) (-1014.719) * (-1015.045) [-1014.018] (-1017.801) (-1013.698) -- 0:00:23
643500 -- [-1013.308] (-1017.047) (-1017.522) (-1015.581) * (-1015.680) [-1012.592] (-1016.731) (-1015.802) -- 0:00:23
644000 -- (-1017.199) (-1015.811) (-1014.882) [-1014.477] * (-1014.360) (-1014.289) [-1013.545] (-1016.185) -- 0:00:23
644500 -- (-1013.974) (-1014.867) (-1015.032) [-1013.205] * [-1015.446] (-1014.550) (-1013.701) (-1013.302) -- 0:00:23
645000 -- (-1014.949) [-1014.643] (-1013.392) (-1013.010) * (-1015.135) (-1013.643) [-1012.613] (-1013.992) -- 0:00:23
Average standard deviation of split frequencies: 0.009195
645500 -- [-1013.695] (-1016.350) (-1018.776) (-1013.562) * (-1015.043) [-1015.542] (-1012.634) (-1016.408) -- 0:00:23
646000 -- [-1014.678] (-1013.659) (-1016.792) (-1013.420) * (-1016.298) (-1017.805) [-1013.493] (-1015.046) -- 0:00:23
646500 -- (-1015.305) (-1015.623) [-1016.660] (-1013.807) * (-1013.924) (-1016.744) (-1017.284) [-1014.533] -- 0:00:23
647000 -- (-1015.326) [-1014.283] (-1015.668) (-1014.192) * (-1015.273) (-1014.958) (-1014.749) [-1012.794] -- 0:00:23
647500 -- (-1014.945) (-1015.473) (-1015.720) [-1012.866] * (-1014.741) (-1013.927) (-1016.639) [-1013.854] -- 0:00:23
648000 -- (-1015.176) (-1015.993) (-1015.184) [-1012.359] * [-1014.732] (-1014.277) (-1014.792) (-1014.328) -- 0:00:23
648500 -- [-1014.309] (-1015.276) (-1014.771) (-1015.750) * [-1017.641] (-1016.069) (-1020.753) (-1013.170) -- 0:00:23
649000 -- (-1014.210) (-1015.193) (-1018.570) [-1013.646] * (-1014.343) (-1016.067) [-1014.054] (-1014.750) -- 0:00:23
649500 -- [-1017.114] (-1018.637) (-1017.525) (-1015.168) * (-1016.288) [-1013.273] (-1018.047) (-1013.029) -- 0:00:23
650000 -- (-1021.908) [-1013.252] (-1015.485) (-1014.008) * (-1013.878) (-1014.855) (-1013.915) [-1013.704] -- 0:00:23
Average standard deviation of split frequencies: 0.008513
650500 -- [-1015.280] (-1014.835) (-1015.387) (-1014.452) * [-1015.366] (-1016.221) (-1012.762) (-1018.219) -- 0:00:23
651000 -- (-1014.616) (-1015.410) (-1015.225) [-1013.943] * [-1013.318] (-1016.005) (-1015.074) (-1021.486) -- 0:00:23
651500 -- (-1014.643) [-1014.500] (-1015.739) (-1014.501) * (-1015.124) (-1012.671) (-1014.468) [-1015.376] -- 0:00:23
652000 -- (-1015.208) [-1012.515] (-1014.179) (-1013.211) * (-1016.498) [-1014.858] (-1015.165) (-1018.049) -- 0:00:22
652500 -- (-1015.293) (-1017.478) (-1016.056) [-1013.368] * (-1020.432) (-1013.353) [-1014.162] (-1017.531) -- 0:00:22
653000 -- [-1014.013] (-1013.692) (-1015.146) (-1014.319) * (-1018.528) (-1015.250) (-1013.915) [-1015.109] -- 0:00:22
653500 -- (-1013.693) (-1020.773) [-1014.372] (-1015.373) * (-1014.660) (-1012.930) (-1016.320) [-1013.355] -- 0:00:22
654000 -- (-1014.393) [-1013.479] (-1013.153) (-1014.651) * (-1014.027) (-1013.280) (-1013.819) [-1013.834] -- 0:00:22
654500 -- (-1015.435) [-1015.080] (-1014.619) (-1015.016) * (-1013.324) (-1014.054) (-1013.675) [-1012.295] -- 0:00:22
655000 -- (-1016.011) (-1013.318) (-1014.137) [-1014.981] * (-1014.094) (-1016.678) (-1013.312) [-1015.787] -- 0:00:22
Average standard deviation of split frequencies: 0.008668
655500 -- (-1012.847) (-1012.541) (-1013.926) [-1015.059] * (-1016.074) (-1015.604) [-1013.882] (-1012.735) -- 0:00:22
656000 -- [-1013.758] (-1013.794) (-1016.911) (-1014.115) * (-1014.530) (-1014.703) [-1015.248] (-1012.826) -- 0:00:22
656500 -- (-1013.710) (-1015.175) (-1013.829) [-1014.260] * [-1015.717] (-1014.696) (-1015.355) (-1012.897) -- 0:00:22
657000 -- (-1015.462) (-1013.997) [-1012.385] (-1012.643) * (-1016.196) (-1014.488) (-1013.295) [-1016.666] -- 0:00:22
657500 -- [-1015.472] (-1017.203) (-1016.263) (-1015.794) * [-1012.662] (-1016.354) (-1013.046) (-1013.602) -- 0:00:22
658000 -- (-1018.926) (-1018.033) [-1012.974] (-1012.334) * [-1014.032] (-1013.900) (-1013.046) (-1012.946) -- 0:00:22
658500 -- (-1018.549) (-1016.449) (-1012.801) [-1013.427] * (-1014.063) (-1014.946) (-1015.017) [-1013.835] -- 0:00:22
659000 -- (-1016.529) (-1013.072) [-1012.834] (-1015.624) * (-1013.808) [-1013.588] (-1014.088) (-1014.825) -- 0:00:22
659500 -- (-1012.950) (-1014.444) (-1014.145) [-1013.947] * (-1018.438) (-1015.307) (-1014.878) [-1012.764] -- 0:00:22
660000 -- [-1012.756] (-1015.159) (-1016.179) (-1013.606) * (-1016.039) [-1013.436] (-1013.833) (-1012.341) -- 0:00:22
Average standard deviation of split frequencies: 0.008964
660500 -- (-1014.598) [-1016.011] (-1013.702) (-1014.715) * (-1014.956) (-1012.769) (-1013.358) [-1013.990] -- 0:00:22
661000 -- (-1016.123) [-1016.898] (-1015.251) (-1014.322) * (-1014.949) (-1015.282) (-1021.554) [-1012.721] -- 0:00:22
661500 -- (-1016.157) (-1014.387) (-1015.007) [-1014.374] * (-1014.143) (-1014.830) [-1016.575] (-1019.645) -- 0:00:22
662000 -- (-1013.526) (-1016.281) (-1016.025) [-1015.237] * [-1014.288] (-1013.272) (-1013.944) (-1013.939) -- 0:00:22
662500 -- (-1013.480) [-1014.307] (-1017.203) (-1013.988) * (-1013.781) (-1017.255) [-1016.692] (-1012.893) -- 0:00:22
663000 -- (-1013.374) (-1014.616) [-1016.468] (-1014.306) * [-1014.747] (-1015.273) (-1017.464) (-1016.824) -- 0:00:22
663500 -- (-1015.092) (-1013.994) (-1016.386) [-1013.814] * (-1015.595) (-1016.076) [-1015.039] (-1017.852) -- 0:00:22
664000 -- (-1012.596) (-1013.145) (-1017.291) [-1013.928] * [-1013.273] (-1014.899) (-1015.107) (-1017.238) -- 0:00:22
664500 -- (-1015.663) [-1013.796] (-1014.527) (-1015.153) * (-1015.829) (-1015.745) (-1015.989) [-1016.539] -- 0:00:22
665000 -- (-1013.787) (-1013.616) [-1015.547] (-1015.537) * (-1015.672) (-1013.965) (-1013.566) [-1013.819] -- 0:00:22
Average standard deviation of split frequencies: 0.008582
665500 -- [-1014.217] (-1016.968) (-1016.648) (-1013.110) * (-1018.643) [-1013.775] (-1015.227) (-1013.987) -- 0:00:22
666000 -- (-1015.404) (-1015.500) (-1017.461) [-1013.110] * (-1013.423) [-1012.804] (-1015.708) (-1013.015) -- 0:00:22
666500 -- (-1014.835) (-1014.679) (-1013.975) [-1015.922] * [-1015.349] (-1013.790) (-1015.738) (-1013.157) -- 0:00:22
667000 -- [-1015.479] (-1014.988) (-1015.640) (-1013.936) * [-1013.577] (-1015.814) (-1013.653) (-1013.708) -- 0:00:21
667500 -- [-1013.998] (-1015.221) (-1014.430) (-1014.905) * (-1013.582) (-1013.309) (-1021.399) [-1015.350] -- 0:00:21
668000 -- (-1018.615) [-1014.813] (-1014.019) (-1015.126) * (-1016.201) (-1014.257) (-1015.845) [-1014.203] -- 0:00:21
668500 -- (-1014.184) (-1014.035) (-1013.331) [-1016.225] * (-1017.640) (-1012.830) [-1014.358] (-1013.948) -- 0:00:21
669000 -- [-1021.968] (-1014.789) (-1012.850) (-1014.721) * (-1016.109) (-1014.868) [-1014.797] (-1014.809) -- 0:00:21
669500 -- [-1013.897] (-1014.392) (-1014.915) (-1015.052) * (-1015.778) (-1014.870) (-1017.188) [-1014.888] -- 0:00:21
670000 -- (-1014.184) [-1013.861] (-1013.822) (-1015.042) * [-1015.995] (-1017.147) (-1014.959) (-1013.327) -- 0:00:21
Average standard deviation of split frequencies: 0.008215
670500 -- (-1016.108) (-1017.100) (-1013.174) [-1013.999] * (-1015.966) (-1020.003) [-1013.271] (-1016.925) -- 0:00:21
671000 -- [-1014.474] (-1014.711) (-1015.857) (-1017.261) * (-1012.834) [-1017.770] (-1013.530) (-1020.586) -- 0:00:21
671500 -- [-1014.971] (-1014.977) (-1016.828) (-1016.427) * (-1013.197) [-1015.899] (-1013.269) (-1020.927) -- 0:00:21
672000 -- (-1023.300) (-1012.266) (-1014.281) [-1015.399] * [-1016.174] (-1013.186) (-1014.773) (-1013.589) -- 0:00:21
672500 -- (-1020.387) (-1015.033) [-1015.425] (-1016.812) * (-1015.130) (-1012.646) (-1016.093) [-1014.542] -- 0:00:21
673000 -- [-1013.673] (-1013.475) (-1014.248) (-1016.362) * [-1014.674] (-1014.369) (-1014.236) (-1014.236) -- 0:00:21
673500 -- [-1013.934] (-1014.130) (-1014.836) (-1014.307) * (-1014.334) (-1017.962) [-1015.208] (-1015.228) -- 0:00:21
674000 -- (-1013.073) [-1017.110] (-1017.079) (-1013.756) * (-1013.371) [-1016.870] (-1014.727) (-1014.053) -- 0:00:21
674500 -- [-1013.433] (-1015.863) (-1014.968) (-1013.052) * (-1020.391) [-1016.071] (-1019.800) (-1016.714) -- 0:00:21
675000 -- (-1018.544) (-1014.972) [-1017.183] (-1018.898) * (-1013.742) (-1020.525) (-1014.510) [-1014.922] -- 0:00:21
Average standard deviation of split frequencies: 0.008237
675500 -- (-1017.126) [-1015.061] (-1017.919) (-1014.010) * [-1014.749] (-1015.822) (-1013.638) (-1019.218) -- 0:00:21
676000 -- [-1014.354] (-1016.681) (-1013.794) (-1014.023) * (-1016.865) (-1014.849) (-1013.856) [-1014.238] -- 0:00:21
676500 -- (-1012.275) (-1012.456) (-1014.494) [-1013.617] * [-1014.172] (-1013.356) (-1014.480) (-1014.882) -- 0:00:21
677000 -- (-1012.893) [-1014.571] (-1013.241) (-1015.203) * [-1015.424] (-1013.483) (-1014.844) (-1015.237) -- 0:00:21
677500 -- (-1013.528) [-1015.886] (-1013.751) (-1013.878) * (-1018.393) [-1016.473] (-1013.133) (-1015.397) -- 0:00:21
678000 -- (-1015.935) (-1013.917) (-1013.967) [-1015.425] * (-1016.296) (-1017.512) (-1012.414) [-1015.991] -- 0:00:21
678500 -- (-1016.546) (-1014.520) (-1016.425) [-1013.840] * (-1015.414) (-1014.498) [-1017.303] (-1019.473) -- 0:00:21
679000 -- (-1016.402) [-1018.716] (-1017.423) (-1013.816) * (-1014.541) [-1012.361] (-1024.614) (-1016.435) -- 0:00:21
679500 -- (-1013.519) (-1019.317) (-1015.459) [-1013.885] * (-1014.531) (-1014.116) (-1022.457) [-1016.014] -- 0:00:21
680000 -- (-1015.885) (-1017.630) (-1015.668) [-1013.568] * (-1013.601) (-1018.069) (-1014.509) [-1016.060] -- 0:00:21
Average standard deviation of split frequencies: 0.008224
680500 -- [-1016.142] (-1017.917) (-1016.316) (-1014.946) * (-1013.465) (-1019.307) (-1016.407) [-1012.841] -- 0:00:21
681000 -- (-1014.487) (-1013.709) (-1017.588) [-1017.814] * (-1013.553) [-1013.896] (-1019.018) (-1013.916) -- 0:00:21
681500 -- (-1017.530) (-1014.547) (-1017.213) [-1015.018] * [-1013.994] (-1013.834) (-1013.688) (-1016.368) -- 0:00:21
682000 -- (-1013.447) (-1018.041) (-1014.944) [-1018.120] * (-1013.733) (-1013.154) [-1016.495] (-1014.294) -- 0:00:20
682500 -- (-1013.532) [-1016.306] (-1015.346) (-1014.948) * (-1012.934) [-1012.411] (-1016.996) (-1015.383) -- 0:00:20
683000 -- [-1013.012] (-1014.190) (-1018.080) (-1013.536) * (-1022.444) (-1012.454) [-1015.700] (-1017.110) -- 0:00:20
683500 -- (-1014.618) (-1019.163) [-1015.623] (-1013.955) * (-1017.929) (-1012.245) [-1015.556] (-1013.268) -- 0:00:20
684000 -- (-1017.384) [-1016.786] (-1013.061) (-1014.497) * [-1015.299] (-1014.484) (-1014.340) (-1012.795) -- 0:00:20
684500 -- (-1013.999) (-1016.071) [-1017.545] (-1013.039) * (-1014.211) [-1015.382] (-1014.881) (-1013.342) -- 0:00:20
685000 -- (-1015.053) (-1013.485) [-1014.294] (-1021.389) * (-1013.846) [-1016.249] (-1014.289) (-1013.860) -- 0:00:20
Average standard deviation of split frequencies: 0.008203
685500 -- (-1013.215) [-1014.892] (-1017.599) (-1015.983) * [-1014.800] (-1013.117) (-1016.302) (-1012.981) -- 0:00:20
686000 -- [-1014.629] (-1013.370) (-1016.985) (-1017.340) * (-1015.004) (-1018.173) (-1020.326) [-1013.029] -- 0:00:20
686500 -- (-1019.708) (-1017.513) (-1013.789) [-1014.352] * (-1015.576) (-1015.550) (-1018.033) [-1020.747] -- 0:00:20
687000 -- (-1014.270) [-1015.850] (-1013.956) (-1017.512) * (-1014.378) [-1013.706] (-1014.845) (-1018.487) -- 0:00:20
687500 -- [-1013.306] (-1016.430) (-1012.480) (-1015.491) * (-1016.322) (-1012.637) (-1016.509) [-1016.960] -- 0:00:20
688000 -- (-1014.410) (-1013.654) [-1013.308] (-1015.325) * (-1013.290) [-1012.743] (-1015.395) (-1013.697) -- 0:00:20
688500 -- (-1014.517) (-1013.848) [-1013.368] (-1019.825) * (-1016.248) [-1013.044] (-1014.341) (-1017.234) -- 0:00:20
689000 -- (-1016.059) (-1013.771) (-1014.419) [-1016.443] * (-1013.494) (-1018.395) (-1013.102) [-1013.210] -- 0:00:20
689500 -- (-1012.635) [-1015.600] (-1014.122) (-1016.072) * (-1016.397) [-1016.609] (-1014.599) (-1016.727) -- 0:00:20
690000 -- (-1013.313) (-1013.972) [-1013.410] (-1017.769) * (-1014.329) (-1016.913) (-1013.201) [-1013.848] -- 0:00:20
Average standard deviation of split frequencies: 0.008918
690500 -- [-1013.765] (-1013.827) (-1012.887) (-1014.411) * (-1013.139) (-1013.830) (-1013.432) [-1017.012] -- 0:00:20
691000 -- (-1014.110) (-1013.933) (-1014.738) [-1016.173] * (-1013.984) (-1013.108) [-1013.908] (-1013.472) -- 0:00:20
691500 -- (-1014.150) [-1013.233] (-1013.338) (-1016.785) * [-1015.148] (-1018.262) (-1014.154) (-1015.615) -- 0:00:20
692000 -- (-1014.349) [-1013.552] (-1013.135) (-1017.023) * (-1013.448) (-1015.825) (-1013.424) [-1014.154] -- 0:00:20
692500 -- (-1014.646) (-1013.097) [-1013.420] (-1015.026) * (-1013.479) (-1014.229) (-1015.469) [-1012.560] -- 0:00:19
693000 -- (-1014.165) (-1018.030) (-1013.600) [-1014.752] * [-1013.402] (-1014.962) (-1013.380) (-1015.003) -- 0:00:20
693500 -- (-1017.559) [-1019.112] (-1016.552) (-1014.535) * (-1017.215) (-1017.576) [-1013.986] (-1014.135) -- 0:00:20
694000 -- (-1021.765) (-1014.644) [-1014.697] (-1014.323) * (-1014.645) (-1013.572) (-1014.396) [-1015.600] -- 0:00:20
694500 -- [-1013.065] (-1014.112) (-1018.047) (-1012.655) * (-1014.592) (-1013.460) [-1014.671] (-1016.030) -- 0:00:20
695000 -- [-1013.771] (-1013.972) (-1014.160) (-1014.411) * [-1013.378] (-1012.732) (-1014.220) (-1015.656) -- 0:00:20
Average standard deviation of split frequencies: 0.008353
695500 -- (-1017.311) (-1013.803) [-1014.859] (-1015.433) * (-1014.050) (-1015.077) (-1012.688) [-1013.509] -- 0:00:20
696000 -- [-1013.543] (-1013.904) (-1016.888) (-1014.616) * [-1014.222] (-1016.389) (-1016.244) (-1018.098) -- 0:00:20
696500 -- (-1014.062) (-1015.333) (-1014.390) [-1014.635] * (-1015.777) [-1014.135] (-1017.612) (-1016.799) -- 0:00:20
697000 -- (-1015.684) (-1015.043) (-1014.864) [-1015.037] * (-1014.336) (-1015.804) (-1017.721) [-1016.258] -- 0:00:19
697500 -- (-1014.518) [-1013.112] (-1015.238) (-1014.708) * (-1014.051) [-1015.550] (-1017.572) (-1014.110) -- 0:00:19
698000 -- (-1017.630) (-1017.487) [-1015.396] (-1014.789) * (-1014.335) [-1013.628] (-1015.297) (-1014.699) -- 0:00:19
698500 -- (-1015.551) (-1014.416) [-1019.058] (-1017.147) * [-1014.729] (-1015.613) (-1014.757) (-1013.960) -- 0:00:19
699000 -- [-1015.574] (-1013.102) (-1014.859) (-1017.117) * [-1014.964] (-1013.759) (-1012.858) (-1013.010) -- 0:00:19
699500 -- (-1014.898) (-1021.043) (-1014.774) [-1013.185] * (-1015.481) (-1013.370) (-1014.357) [-1013.712] -- 0:00:19
700000 -- (-1014.155) [-1021.303] (-1017.877) (-1014.458) * (-1014.965) (-1014.916) (-1012.897) [-1013.088] -- 0:00:19
Average standard deviation of split frequencies: 0.008567
700500 -- (-1013.735) (-1020.115) [-1014.318] (-1015.516) * [-1012.887] (-1017.219) (-1015.138) (-1016.161) -- 0:00:19
701000 -- [-1013.868] (-1015.190) (-1013.911) (-1013.592) * (-1013.043) (-1017.322) [-1015.845] (-1014.535) -- 0:00:19
701500 -- (-1014.510) (-1015.505) [-1013.547] (-1013.642) * (-1013.321) (-1016.135) (-1022.704) [-1014.219] -- 0:00:19
702000 -- (-1012.579) (-1017.421) [-1013.328] (-1015.248) * [-1015.483] (-1016.811) (-1022.099) (-1015.802) -- 0:00:19
702500 -- (-1016.746) [-1012.763] (-1012.377) (-1014.257) * (-1013.389) (-1018.538) [-1016.091] (-1015.290) -- 0:00:19
703000 -- (-1016.413) (-1013.362) [-1013.180] (-1014.504) * [-1012.847] (-1018.678) (-1014.551) (-1016.936) -- 0:00:19
703500 -- (-1016.134) (-1014.539) [-1012.802] (-1015.421) * (-1012.847) [-1016.039] (-1015.295) (-1019.228) -- 0:00:19
704000 -- [-1015.752] (-1014.540) (-1016.267) (-1015.415) * [-1012.822] (-1014.601) (-1013.442) (-1014.145) -- 0:00:19
704500 -- (-1014.347) [-1014.143] (-1013.766) (-1014.789) * (-1013.354) (-1013.236) (-1014.698) [-1013.127] -- 0:00:19
705000 -- (-1012.965) [-1017.824] (-1013.172) (-1015.295) * [-1013.498] (-1014.581) (-1015.324) (-1014.663) -- 0:00:19
Average standard deviation of split frequencies: 0.008413
705500 -- (-1013.416) (-1015.807) (-1014.062) [-1014.046] * (-1014.580) [-1014.203] (-1014.656) (-1013.840) -- 0:00:19
706000 -- (-1014.887) (-1015.340) [-1014.240] (-1014.034) * (-1014.905) [-1013.172] (-1014.641) (-1015.012) -- 0:00:19
706500 -- (-1014.488) [-1014.332] (-1016.652) (-1014.496) * (-1017.730) (-1017.227) (-1015.616) [-1014.513] -- 0:00:19
707000 -- (-1015.819) (-1014.187) (-1017.176) [-1013.320] * [-1014.716] (-1013.420) (-1014.421) (-1013.271) -- 0:00:19
707500 -- (-1017.265) [-1013.042] (-1015.772) (-1014.143) * (-1013.480) (-1014.711) (-1017.419) [-1013.582] -- 0:00:19
708000 -- [-1013.867] (-1013.369) (-1016.250) (-1014.269) * (-1017.422) [-1014.794] (-1012.883) (-1012.851) -- 0:00:18
708500 -- [-1013.383] (-1013.607) (-1014.840) (-1015.749) * (-1015.488) (-1015.363) [-1017.720] (-1013.709) -- 0:00:18
709000 -- (-1016.840) (-1019.032) [-1014.012] (-1015.112) * (-1015.522) [-1014.571] (-1015.354) (-1015.288) -- 0:00:19
709500 -- (-1014.126) [-1013.213] (-1018.579) (-1014.856) * [-1014.383] (-1014.571) (-1015.783) (-1020.969) -- 0:00:19
710000 -- (-1015.057) [-1013.582] (-1013.649) (-1015.158) * (-1017.439) (-1014.166) (-1013.576) [-1013.373] -- 0:00:19
Average standard deviation of split frequencies: 0.008137
710500 -- [-1015.058] (-1016.264) (-1013.572) (-1015.957) * (-1018.565) (-1013.083) (-1014.234) [-1016.186] -- 0:00:19
711000 -- (-1014.977) [-1016.085] (-1014.928) (-1013.014) * (-1016.954) [-1015.040] (-1013.246) (-1015.610) -- 0:00:19
711500 -- (-1014.092) (-1015.578) (-1017.470) [-1013.110] * [-1016.212] (-1017.902) (-1013.128) (-1014.238) -- 0:00:19
712000 -- [-1013.782] (-1014.265) (-1013.911) (-1013.411) * [-1016.417] (-1014.665) (-1014.431) (-1015.969) -- 0:00:19
712500 -- (-1012.797) [-1014.968] (-1013.138) (-1015.145) * (-1013.526) (-1019.228) [-1013.697] (-1013.706) -- 0:00:18
713000 -- (-1019.336) (-1016.415) [-1013.649] (-1018.351) * (-1013.989) (-1014.024) (-1016.296) [-1013.804] -- 0:00:18
713500 -- (-1020.850) (-1014.307) [-1012.507] (-1015.951) * (-1016.084) (-1016.092) [-1015.261] (-1015.099) -- 0:00:18
714000 -- (-1016.889) (-1012.796) [-1015.489] (-1015.857) * (-1013.853) (-1016.826) (-1013.597) [-1014.207] -- 0:00:18
714500 -- (-1015.845) (-1017.151) (-1014.692) [-1016.332] * (-1015.368) (-1017.684) (-1013.485) [-1015.784] -- 0:00:18
715000 -- (-1013.300) (-1016.591) (-1013.439) [-1015.689] * [-1015.262] (-1015.427) (-1014.712) (-1015.928) -- 0:00:18
Average standard deviation of split frequencies: 0.008340
715500 -- (-1012.744) [-1012.498] (-1015.522) (-1016.173) * (-1013.687) (-1016.229) (-1013.765) [-1014.190] -- 0:00:18
716000 -- (-1018.248) (-1015.046) (-1012.454) [-1013.324] * (-1015.630) (-1022.482) [-1013.955] (-1012.685) -- 0:00:18
716500 -- [-1014.823] (-1015.855) (-1014.491) (-1012.858) * (-1018.792) (-1012.928) [-1013.949] (-1012.832) -- 0:00:18
717000 -- (-1012.820) (-1014.533) (-1013.705) [-1014.645] * (-1021.164) (-1017.993) (-1015.111) [-1014.719] -- 0:00:18
717500 -- [-1012.726] (-1015.322) (-1017.218) (-1013.530) * (-1013.523) (-1015.804) [-1014.293] (-1015.089) -- 0:00:18
718000 -- (-1015.071) (-1017.998) [-1015.939] (-1014.554) * [-1014.914] (-1015.883) (-1012.946) (-1018.528) -- 0:00:18
718500 -- [-1013.669] (-1015.285) (-1013.171) (-1013.601) * (-1015.192) (-1013.199) [-1012.950] (-1012.950) -- 0:00:18
719000 -- [-1019.407] (-1013.423) (-1013.252) (-1017.928) * (-1023.100) (-1015.188) [-1012.788] (-1014.809) -- 0:00:18
719500 -- (-1013.509) [-1013.084] (-1014.450) (-1024.898) * [-1013.166] (-1012.854) (-1014.831) (-1013.781) -- 0:00:18
720000 -- (-1013.597) (-1015.304) (-1016.879) [-1013.715] * (-1016.224) (-1013.772) (-1014.285) [-1014.812] -- 0:00:18
Average standard deviation of split frequencies: 0.008547
720500 -- (-1012.742) [-1013.965] (-1012.904) (-1016.423) * (-1017.004) [-1014.887] (-1012.844) (-1014.819) -- 0:00:18
721000 -- [-1012.751] (-1016.029) (-1013.444) (-1013.042) * (-1017.098) (-1013.622) (-1013.491) [-1018.368] -- 0:00:18
721500 -- [-1012.642] (-1018.322) (-1013.432) (-1014.552) * (-1017.842) (-1013.002) [-1019.370] (-1019.734) -- 0:00:18
722000 -- (-1013.428) [-1012.520] (-1020.045) (-1016.692) * [-1017.260] (-1014.520) (-1017.317) (-1017.181) -- 0:00:18
722500 -- [-1014.438] (-1012.894) (-1018.540) (-1014.393) * (-1017.977) (-1014.118) (-1016.778) [-1012.967] -- 0:00:18
723000 -- (-1015.304) (-1013.251) (-1015.440) [-1013.499] * (-1013.297) [-1014.876] (-1017.047) (-1012.859) -- 0:00:18
723500 -- [-1016.112] (-1013.054) (-1014.065) (-1014.619) * (-1015.057) (-1017.215) (-1019.637) [-1012.978] -- 0:00:17
724000 -- (-1015.744) (-1012.844) (-1014.678) [-1014.315] * (-1013.308) (-1015.661) (-1013.873) [-1015.436] -- 0:00:17
724500 -- (-1019.976) [-1013.408] (-1014.040) (-1014.828) * (-1013.779) (-1015.157) (-1014.938) [-1014.912] -- 0:00:17
725000 -- (-1020.501) [-1012.727] (-1013.417) (-1013.320) * (-1015.154) (-1014.383) (-1016.741) [-1014.941] -- 0:00:17
Average standard deviation of split frequencies: 0.008441
725500 -- (-1015.717) (-1017.006) [-1013.127] (-1021.025) * (-1013.522) [-1012.564] (-1012.685) (-1014.049) -- 0:00:18
726000 -- (-1014.330) (-1020.193) (-1013.946) [-1019.026] * (-1017.091) (-1013.766) [-1012.592] (-1014.316) -- 0:00:18
726500 -- [-1014.150] (-1014.102) (-1013.439) (-1014.001) * (-1014.955) [-1014.495] (-1012.677) (-1013.655) -- 0:00:18
727000 -- [-1015.064] (-1016.745) (-1015.961) (-1015.583) * (-1014.850) (-1015.038) (-1014.268) [-1014.399] -- 0:00:18
727500 -- (-1016.563) (-1013.999) [-1015.905] (-1013.554) * (-1015.299) [-1015.115] (-1017.363) (-1022.554) -- 0:00:17
728000 -- (-1015.043) [-1014.592] (-1016.653) (-1013.384) * (-1014.656) (-1018.493) (-1015.898) [-1021.139] -- 0:00:17
728500 -- (-1014.558) [-1014.850] (-1016.177) (-1012.968) * (-1019.184) (-1015.088) [-1013.152] (-1017.537) -- 0:00:17
729000 -- (-1015.742) (-1015.025) (-1018.728) [-1014.603] * (-1015.012) [-1015.584] (-1016.508) (-1016.041) -- 0:00:17
729500 -- (-1015.655) [-1016.602] (-1017.690) (-1014.158) * (-1015.593) (-1015.072) (-1012.508) [-1015.591] -- 0:00:17
730000 -- (-1015.646) (-1013.237) [-1013.968] (-1016.575) * (-1013.209) (-1013.868) [-1013.187] (-1015.183) -- 0:00:17
Average standard deviation of split frequencies: 0.008086
730500 -- (-1014.237) [-1014.443] (-1015.600) (-1017.011) * [-1014.320] (-1019.618) (-1015.503) (-1016.269) -- 0:00:17
731000 -- (-1014.899) [-1015.740] (-1015.106) (-1016.045) * (-1014.736) [-1017.116] (-1016.473) (-1014.506) -- 0:00:17
731500 -- [-1013.837] (-1016.180) (-1013.938) (-1012.963) * [-1013.362] (-1014.663) (-1014.710) (-1016.335) -- 0:00:17
732000 -- [-1014.577] (-1017.665) (-1013.662) (-1017.332) * (-1013.070) (-1015.586) [-1014.802] (-1020.789) -- 0:00:17
732500 -- (-1020.950) (-1018.038) (-1015.313) [-1019.338] * (-1014.224) (-1017.996) (-1012.958) [-1014.753] -- 0:00:17
733000 -- (-1014.679) (-1015.550) [-1013.732] (-1013.055) * [-1013.924] (-1021.175) (-1013.180) (-1017.242) -- 0:00:17
733500 -- [-1015.467] (-1017.683) (-1014.727) (-1012.462) * (-1013.907) (-1015.939) [-1012.595] (-1014.348) -- 0:00:17
734000 -- (-1019.369) [-1017.842] (-1014.091) (-1012.995) * (-1013.978) [-1015.102] (-1018.968) (-1013.453) -- 0:00:17
734500 -- (-1012.776) [-1014.732] (-1017.997) (-1013.412) * (-1013.108) (-1012.425) (-1013.962) [-1013.223] -- 0:00:17
735000 -- (-1012.928) [-1013.132] (-1016.123) (-1015.062) * (-1014.800) (-1013.418) (-1018.005) [-1016.827] -- 0:00:17
Average standard deviation of split frequencies: 0.008326
735500 -- (-1013.718) (-1016.956) [-1013.576] (-1014.087) * (-1013.261) [-1013.008] (-1014.364) (-1014.959) -- 0:00:17
736000 -- (-1016.263) [-1014.536] (-1014.150) (-1016.271) * (-1015.674) [-1013.746] (-1015.753) (-1013.574) -- 0:00:17
736500 -- [-1017.448] (-1015.738) (-1013.390) (-1015.472) * (-1018.696) (-1018.861) [-1013.466] (-1015.975) -- 0:00:17
737000 -- (-1014.928) (-1016.947) (-1013.339) [-1013.254] * (-1020.429) (-1015.488) [-1014.814] (-1021.898) -- 0:00:17
737500 -- (-1015.480) (-1014.600) [-1016.904] (-1014.026) * (-1017.116) (-1017.225) (-1016.074) [-1016.076] -- 0:00:17
738000 -- (-1013.526) (-1014.506) (-1016.216) [-1015.273] * [-1012.587] (-1015.555) (-1017.645) (-1017.266) -- 0:00:17
738500 -- [-1014.969] (-1014.066) (-1015.224) (-1019.024) * (-1016.737) [-1015.330] (-1014.585) (-1014.387) -- 0:00:16
739000 -- (-1016.056) (-1014.499) [-1015.773] (-1017.114) * (-1015.514) (-1015.120) (-1014.496) [-1013.331] -- 0:00:16
739500 -- (-1015.676) [-1014.529] (-1017.612) (-1013.386) * (-1014.148) [-1012.624] (-1018.060) (-1013.583) -- 0:00:16
740000 -- (-1017.646) [-1014.425] (-1018.546) (-1015.750) * [-1015.627] (-1013.821) (-1014.123) (-1014.004) -- 0:00:16
Average standard deviation of split frequencies: 0.008529
740500 -- (-1015.323) [-1013.858] (-1016.007) (-1014.165) * (-1014.637) (-1012.362) [-1016.413] (-1013.790) -- 0:00:16
741000 -- (-1015.083) [-1014.356] (-1015.371) (-1012.977) * [-1015.260] (-1014.114) (-1015.523) (-1014.626) -- 0:00:16
741500 -- [-1012.786] (-1014.872) (-1017.345) (-1016.284) * (-1013.734) [-1013.341] (-1015.865) (-1014.795) -- 0:00:16
742000 -- (-1018.098) (-1014.703) (-1013.199) [-1012.674] * [-1013.490] (-1013.682) (-1015.927) (-1015.505) -- 0:00:17
742500 -- (-1016.388) (-1015.634) [-1013.997] (-1012.674) * (-1015.953) (-1014.054) [-1013.090] (-1015.120) -- 0:00:16
743000 -- (-1013.635) (-1014.227) (-1015.202) [-1013.769] * [-1013.043] (-1017.820) (-1015.642) (-1013.404) -- 0:00:16
743500 -- (-1015.789) (-1014.687) (-1012.822) [-1015.585] * [-1012.796] (-1013.689) (-1017.434) (-1012.953) -- 0:00:16
744000 -- (-1014.516) (-1018.320) [-1015.091] (-1014.119) * (-1013.627) [-1014.172] (-1013.683) (-1014.356) -- 0:00:16
744500 -- (-1017.127) (-1014.380) (-1017.373) [-1015.419] * (-1016.796) (-1013.191) (-1014.385) [-1013.021] -- 0:00:16
745000 -- [-1016.250] (-1013.065) (-1016.046) (-1012.774) * (-1016.322) (-1013.373) (-1016.870) [-1014.759] -- 0:00:16
Average standard deviation of split frequencies: 0.007920
745500 -- (-1014.753) (-1013.557) [-1014.461] (-1012.938) * (-1015.907) (-1013.988) (-1012.927) [-1014.042] -- 0:00:16
746000 -- (-1014.220) [-1014.085] (-1016.776) (-1015.210) * (-1015.738) [-1013.251] (-1013.054) (-1015.731) -- 0:00:16
746500 -- (-1014.206) (-1015.522) (-1013.294) [-1016.998] * (-1014.051) (-1013.522) [-1013.481] (-1014.488) -- 0:00:16
747000 -- (-1016.663) (-1018.418) (-1015.155) [-1016.682] * [-1013.282] (-1012.501) (-1015.628) (-1015.648) -- 0:00:16
747500 -- (-1013.000) [-1012.926] (-1014.424) (-1016.694) * [-1016.730] (-1014.032) (-1017.227) (-1018.876) -- 0:00:16
748000 -- (-1013.629) (-1013.468) [-1015.568] (-1016.970) * [-1015.924] (-1013.001) (-1014.640) (-1016.022) -- 0:00:16
748500 -- (-1014.154) (-1017.150) [-1018.321] (-1014.362) * (-1015.998) (-1013.057) [-1015.055] (-1015.556) -- 0:00:16
749000 -- [-1014.154] (-1013.604) (-1013.537) (-1015.624) * (-1015.829) (-1015.498) [-1014.838] (-1013.461) -- 0:00:16
749500 -- (-1016.295) (-1015.178) [-1013.748] (-1013.476) * (-1012.975) (-1016.835) [-1014.539] (-1017.713) -- 0:00:16
750000 -- (-1017.294) [-1017.295] (-1018.009) (-1016.142) * [-1014.756] (-1013.509) (-1014.942) (-1013.680) -- 0:00:16
Average standard deviation of split frequencies: 0.007703
750500 -- [-1014.694] (-1013.084) (-1019.679) (-1013.919) * (-1015.722) (-1014.936) [-1013.704] (-1014.309) -- 0:00:16
751000 -- (-1013.383) [-1013.313] (-1013.904) (-1014.106) * (-1013.900) [-1015.772] (-1013.444) (-1013.382) -- 0:00:16
751500 -- (-1015.973) (-1013.288) (-1013.676) [-1017.750] * (-1014.683) (-1013.071) (-1017.662) [-1013.802] -- 0:00:16
752000 -- (-1014.602) [-1018.584] (-1013.032) (-1017.108) * [-1015.951] (-1012.823) (-1018.162) (-1014.338) -- 0:00:16
752500 -- [-1016.803] (-1015.998) (-1015.241) (-1016.025) * (-1014.599) (-1014.322) [-1013.818] (-1014.756) -- 0:00:16
753000 -- (-1015.259) [-1014.008] (-1015.574) (-1019.131) * (-1015.187) (-1017.711) [-1015.308] (-1014.939) -- 0:00:16
753500 -- (-1015.768) (-1013.226) (-1016.232) [-1014.881] * (-1015.585) [-1014.753] (-1013.302) (-1015.201) -- 0:00:16
754000 -- [-1013.095] (-1012.714) (-1012.521) (-1021.389) * [-1012.989] (-1017.618) (-1016.412) (-1017.713) -- 0:00:15
754500 -- (-1014.325) (-1013.896) [-1014.304] (-1023.592) * (-1013.384) (-1016.132) [-1013.897] (-1018.548) -- 0:00:15
755000 -- (-1015.343) (-1013.411) (-1015.570) [-1014.189] * (-1013.326) [-1015.826] (-1014.793) (-1016.181) -- 0:00:15
Average standard deviation of split frequencies: 0.007857
755500 -- (-1014.038) (-1014.885) [-1012.744] (-1015.485) * (-1014.033) [-1012.760] (-1013.481) (-1019.425) -- 0:00:15
756000 -- (-1014.163) (-1014.919) [-1014.507] (-1016.820) * (-1014.672) (-1013.088) (-1013.116) [-1015.344] -- 0:00:15
756500 -- (-1015.433) (-1015.562) [-1014.529] (-1013.645) * [-1013.409] (-1012.836) (-1013.074) (-1018.889) -- 0:00:15
757000 -- [-1016.919] (-1014.199) (-1014.687) (-1013.201) * [-1013.508] (-1018.751) (-1013.724) (-1015.416) -- 0:00:15
757500 -- (-1017.301) (-1012.775) [-1014.285] (-1013.159) * (-1016.388) (-1013.048) (-1016.666) [-1014.953] -- 0:00:15
758000 -- (-1013.480) (-1013.713) (-1014.657) [-1015.218] * [-1013.881] (-1015.075) (-1014.747) (-1013.047) -- 0:00:15
758500 -- (-1013.890) (-1015.454) [-1014.870] (-1014.135) * (-1016.542) (-1014.236) [-1016.215] (-1013.971) -- 0:00:15
759000 -- [-1015.655] (-1013.678) (-1018.375) (-1015.838) * (-1014.474) (-1012.979) (-1014.827) [-1014.847] -- 0:00:15
759500 -- (-1015.394) (-1012.995) (-1015.827) [-1014.824] * [-1013.645] (-1012.446) (-1014.097) (-1013.413) -- 0:00:15
760000 -- (-1014.658) (-1016.146) (-1015.471) [-1015.430] * (-1014.188) (-1014.581) [-1018.170] (-1016.121) -- 0:00:15
Average standard deviation of split frequencies: 0.007974
760500 -- (-1012.853) [-1014.005] (-1013.884) (-1014.438) * [-1014.890] (-1015.707) (-1016.686) (-1014.649) -- 0:00:15
761000 -- (-1014.015) (-1013.969) [-1014.699] (-1014.906) * [-1014.155] (-1013.323) (-1014.967) (-1014.048) -- 0:00:15
761500 -- (-1014.231) [-1013.560] (-1014.621) (-1013.660) * (-1018.066) (-1013.270) [-1013.658] (-1015.467) -- 0:00:15
762000 -- (-1013.795) (-1015.155) (-1014.627) [-1013.080] * (-1015.986) (-1013.470) (-1013.248) [-1015.986] -- 0:00:15
762500 -- (-1014.316) (-1014.309) [-1014.045] (-1014.046) * (-1016.374) (-1015.817) [-1014.066] (-1015.831) -- 0:00:15
763000 -- (-1015.577) (-1017.030) [-1014.743] (-1014.587) * [-1014.218] (-1015.487) (-1015.067) (-1014.046) -- 0:00:15
763500 -- [-1013.406] (-1015.652) (-1016.531) (-1014.448) * [-1013.272] (-1016.178) (-1015.843) (-1013.351) -- 0:00:15
764000 -- (-1016.594) [-1013.669] (-1017.418) (-1014.055) * (-1015.441) (-1017.704) (-1013.582) [-1016.642] -- 0:00:15
764500 -- [-1013.731] (-1015.634) (-1016.447) (-1014.953) * [-1013.992] (-1021.581) (-1015.414) (-1016.317) -- 0:00:15
765000 -- (-1013.705) (-1013.890) [-1013.419] (-1017.118) * [-1016.531] (-1021.621) (-1014.595) (-1016.921) -- 0:00:15
Average standard deviation of split frequencies: 0.007959
765500 -- (-1014.030) (-1015.423) (-1015.158) [-1017.732] * (-1015.954) (-1015.960) [-1014.204] (-1013.344) -- 0:00:15
766000 -- [-1014.229] (-1013.250) (-1016.115) (-1016.577) * (-1015.692) (-1014.798) [-1014.142] (-1014.342) -- 0:00:15
766500 -- (-1018.423) (-1015.149) [-1013.554] (-1014.287) * [-1014.590] (-1013.670) (-1012.632) (-1014.175) -- 0:00:15
767000 -- (-1016.338) [-1012.896] (-1016.427) (-1016.788) * (-1016.956) (-1014.583) [-1012.417] (-1013.815) -- 0:00:15
767500 -- (-1013.045) [-1012.763] (-1017.864) (-1014.101) * (-1015.708) (-1014.843) [-1013.054] (-1013.624) -- 0:00:15
768000 -- (-1012.576) (-1012.954) [-1017.188] (-1016.340) * (-1016.478) [-1014.174] (-1014.200) (-1014.213) -- 0:00:15
768500 -- (-1013.814) [-1014.222] (-1017.350) (-1016.342) * (-1013.732) [-1014.651] (-1020.528) (-1012.558) -- 0:00:15
769000 -- (-1015.367) (-1015.187) [-1015.147] (-1012.724) * (-1016.987) (-1016.202) [-1014.492] (-1014.734) -- 0:00:15
769500 -- (-1018.155) (-1016.611) [-1016.028] (-1013.631) * (-1020.346) (-1015.978) [-1016.829] (-1014.050) -- 0:00:14
770000 -- (-1016.215) (-1014.985) (-1014.966) [-1015.161] * (-1016.136) [-1014.884] (-1016.272) (-1015.665) -- 0:00:14
Average standard deviation of split frequencies: 0.007870
770500 -- (-1013.813) (-1015.026) [-1013.639] (-1014.764) * [-1018.206] (-1016.209) (-1014.138) (-1018.554) -- 0:00:14
771000 -- (-1013.736) (-1013.528) [-1015.784] (-1015.510) * [-1019.605] (-1013.424) (-1017.575) (-1016.604) -- 0:00:14
771500 -- [-1015.606] (-1014.207) (-1013.264) (-1013.844) * (-1015.307) [-1015.516] (-1015.298) (-1015.710) -- 0:00:14
772000 -- (-1019.736) (-1018.824) [-1013.151] (-1015.316) * [-1015.316] (-1014.253) (-1014.064) (-1013.046) -- 0:00:14
772500 -- (-1019.998) (-1016.413) (-1015.376) [-1019.521] * (-1015.365) (-1016.308) (-1013.939) [-1016.585] -- 0:00:14
773000 -- (-1019.321) (-1014.956) [-1013.048] (-1016.559) * [-1016.782] (-1017.069) (-1015.270) (-1013.855) -- 0:00:14
773500 -- [-1013.281] (-1014.465) (-1014.602) (-1015.529) * (-1015.868) (-1014.358) [-1015.354] (-1013.962) -- 0:00:14
774000 -- (-1013.274) [-1012.683] (-1014.588) (-1017.523) * (-1013.249) (-1013.679) [-1013.406] (-1013.610) -- 0:00:14
774500 -- [-1017.069] (-1015.609) (-1015.880) (-1016.920) * (-1013.945) [-1013.017] (-1013.980) (-1013.934) -- 0:00:14
775000 -- (-1017.313) (-1013.515) [-1016.935] (-1014.666) * [-1013.455] (-1014.381) (-1013.623) (-1012.856) -- 0:00:14
Average standard deviation of split frequencies: 0.008140
775500 -- (-1014.234) [-1014.850] (-1013.431) (-1015.494) * (-1013.968) (-1013.173) (-1016.608) [-1012.967] -- 0:00:14
776000 -- (-1014.287) (-1018.785) [-1014.009] (-1021.797) * (-1014.153) [-1013.395] (-1014.877) (-1012.355) -- 0:00:14
776500 -- [-1016.246] (-1015.342) (-1016.236) (-1018.549) * (-1015.986) [-1016.187] (-1014.287) (-1013.595) -- 0:00:14
777000 -- [-1013.382] (-1018.886) (-1016.252) (-1012.730) * (-1013.843) (-1014.052) (-1013.320) [-1014.802] -- 0:00:14
777500 -- [-1013.570] (-1015.244) (-1014.133) (-1016.830) * (-1014.406) (-1014.841) [-1015.814] (-1014.721) -- 0:00:14
778000 -- [-1014.208] (-1014.106) (-1013.322) (-1015.035) * (-1013.772) (-1018.321) (-1017.046) [-1014.029] -- 0:00:14
778500 -- (-1014.316) (-1013.876) (-1013.537) [-1014.355] * (-1015.107) [-1014.643] (-1016.472) (-1016.817) -- 0:00:14
779000 -- (-1012.838) (-1018.007) [-1012.572] (-1013.017) * (-1014.734) (-1014.254) (-1017.094) [-1012.721] -- 0:00:14
779500 -- (-1014.431) (-1014.630) (-1012.933) [-1014.174] * (-1013.684) (-1012.967) (-1014.558) [-1014.069] -- 0:00:14
780000 -- [-1014.691] (-1015.573) (-1014.282) (-1014.030) * (-1013.605) [-1014.357] (-1017.975) (-1014.632) -- 0:00:14
Average standard deviation of split frequencies: 0.008011
780500 -- (-1019.040) (-1019.693) (-1015.328) [-1016.001] * (-1013.669) [-1013.594] (-1015.441) (-1018.282) -- 0:00:14
781000 -- [-1015.098] (-1013.146) (-1013.531) (-1016.518) * (-1014.049) (-1013.175) [-1013.506] (-1015.563) -- 0:00:14
781500 -- [-1014.714] (-1013.232) (-1012.617) (-1017.337) * (-1013.930) (-1015.426) [-1013.775] (-1016.912) -- 0:00:14
782000 -- [-1013.277] (-1014.256) (-1013.235) (-1019.359) * (-1015.184) (-1014.852) (-1013.650) [-1014.355] -- 0:00:14
782500 -- (-1022.755) (-1014.231) (-1013.162) [-1018.415] * (-1014.676) (-1013.509) [-1014.346] (-1013.836) -- 0:00:14
783000 -- (-1013.029) [-1013.419] (-1016.273) (-1014.182) * (-1014.100) (-1014.898) [-1014.040] (-1017.097) -- 0:00:14
783500 -- (-1013.012) (-1013.318) [-1013.895] (-1013.922) * (-1015.175) (-1014.619) (-1014.387) [-1016.171] -- 0:00:14
784000 -- [-1014.497] (-1015.029) (-1013.553) (-1013.326) * (-1014.032) (-1013.573) (-1013.295) [-1015.218] -- 0:00:14
784500 -- [-1014.044] (-1012.918) (-1016.502) (-1013.003) * (-1013.012) [-1013.306] (-1012.977) (-1017.243) -- 0:00:14
785000 -- [-1013.208] (-1014.354) (-1014.520) (-1013.543) * (-1017.224) [-1014.963] (-1013.956) (-1014.841) -- 0:00:13
Average standard deviation of split frequencies: 0.007677
785500 -- (-1012.654) [-1017.051] (-1018.074) (-1012.950) * [-1015.547] (-1014.647) (-1013.973) (-1013.760) -- 0:00:13
786000 -- (-1013.546) (-1014.866) [-1015.305] (-1014.869) * (-1013.631) (-1013.178) (-1013.763) [-1016.660] -- 0:00:13
786500 -- (-1014.076) (-1014.033) (-1013.555) [-1015.257] * [-1014.997] (-1013.351) (-1013.769) (-1013.708) -- 0:00:13
787000 -- (-1015.930) (-1016.481) [-1013.488] (-1013.637) * (-1015.417) [-1014.987] (-1014.325) (-1013.597) -- 0:00:13
787500 -- [-1015.006] (-1018.187) (-1016.533) (-1013.697) * (-1015.714) (-1017.711) [-1012.420] (-1014.058) -- 0:00:13
788000 -- (-1014.621) [-1015.501] (-1013.846) (-1015.684) * [-1014.641] (-1015.423) (-1013.211) (-1013.055) -- 0:00:13
788500 -- (-1014.426) (-1013.892) (-1013.341) [-1015.878] * (-1014.678) (-1015.803) [-1013.072] (-1012.939) -- 0:00:13
789000 -- [-1015.640] (-1019.358) (-1013.794) (-1015.814) * [-1016.949] (-1016.383) (-1012.692) (-1012.955) -- 0:00:13
789500 -- (-1015.131) (-1013.825) (-1013.868) [-1014.692] * [-1016.613] (-1016.969) (-1014.433) (-1013.139) -- 0:00:13
790000 -- (-1016.636) (-1014.106) [-1014.040] (-1015.721) * (-1013.109) (-1017.149) (-1016.155) [-1013.180] -- 0:00:13
Average standard deviation of split frequencies: 0.007790
790500 -- (-1012.867) [-1013.899] (-1013.614) (-1016.282) * (-1013.174) [-1013.359] (-1013.963) (-1014.547) -- 0:00:13
791000 -- (-1019.166) [-1013.410] (-1013.797) (-1016.797) * [-1018.392] (-1014.209) (-1014.716) (-1013.046) -- 0:00:13
791500 -- (-1015.616) (-1012.701) (-1014.307) [-1013.826] * (-1014.203) [-1012.930] (-1013.802) (-1014.470) -- 0:00:13
792000 -- (-1015.650) (-1017.132) (-1013.190) [-1014.351] * [-1016.501] (-1012.985) (-1017.351) (-1014.409) -- 0:00:13
792500 -- (-1014.522) [-1014.890] (-1013.411) (-1013.941) * (-1015.970) (-1013.171) (-1015.041) [-1018.723] -- 0:00:13
793000 -- [-1013.385] (-1014.305) (-1014.180) (-1016.786) * (-1014.838) (-1013.344) [-1013.175] (-1014.254) -- 0:00:13
793500 -- (-1014.827) [-1014.036] (-1017.789) (-1016.754) * (-1015.308) [-1017.243] (-1013.224) (-1018.356) -- 0:00:13
794000 -- (-1015.789) (-1015.024) [-1013.374] (-1015.960) * (-1017.219) (-1017.122) (-1013.242) [-1016.604] -- 0:00:13
794500 -- [-1017.509] (-1015.508) (-1014.848) (-1013.676) * (-1014.829) (-1014.417) (-1014.011) [-1016.280] -- 0:00:13
795000 -- (-1017.097) (-1015.934) [-1015.420] (-1018.223) * (-1013.317) [-1014.873] (-1014.509) (-1013.211) -- 0:00:13
Average standard deviation of split frequencies: 0.007304
795500 -- [-1015.170] (-1013.306) (-1015.233) (-1017.025) * (-1015.253) (-1016.635) (-1013.201) [-1013.592] -- 0:00:13
796000 -- (-1013.560) [-1013.312] (-1013.047) (-1016.480) * (-1014.544) [-1017.216] (-1014.092) (-1015.333) -- 0:00:13
796500 -- (-1012.946) (-1012.617) [-1012.938] (-1014.432) * (-1018.437) [-1016.968] (-1018.272) (-1013.830) -- 0:00:13
797000 -- (-1015.127) (-1012.981) (-1013.379) [-1012.776] * (-1018.045) (-1016.837) (-1015.456) [-1016.218] -- 0:00:13
797500 -- (-1016.454) (-1019.742) (-1012.985) [-1013.817] * (-1015.296) (-1013.599) (-1012.852) [-1013.052] -- 0:00:13
798000 -- (-1016.145) [-1014.507] (-1015.590) (-1013.143) * (-1016.612) (-1014.996) (-1014.442) [-1013.335] -- 0:00:13
798500 -- (-1017.061) [-1014.158] (-1013.683) (-1015.262) * [-1013.488] (-1015.277) (-1015.625) (-1015.084) -- 0:00:13
799000 -- (-1017.261) (-1015.520) (-1016.392) [-1014.519] * [-1013.535] (-1016.606) (-1013.177) (-1012.558) -- 0:00:13
799500 -- (-1016.164) (-1015.830) (-1013.814) [-1015.200] * (-1014.031) (-1013.514) (-1013.030) [-1015.141] -- 0:00:13
800000 -- (-1013.364) (-1014.863) (-1013.327) [-1015.433] * (-1016.440) [-1013.567] (-1012.397) (-1015.521) -- 0:00:12
Average standard deviation of split frequencies: 0.007615
800500 -- (-1013.414) (-1016.993) [-1017.873] (-1017.621) * (-1014.134) (-1013.747) [-1013.408] (-1013.938) -- 0:00:12
801000 -- (-1016.017) (-1013.049) [-1016.235] (-1017.560) * [-1017.149] (-1014.870) (-1015.657) (-1013.507) -- 0:00:12
801500 -- (-1013.526) [-1013.662] (-1015.110) (-1015.589) * (-1016.421) (-1015.390) (-1013.254) [-1013.378] -- 0:00:12
802000 -- (-1014.299) (-1014.800) [-1014.270] (-1012.509) * (-1015.370) (-1015.288) [-1012.898] (-1013.783) -- 0:00:12
802500 -- (-1015.212) (-1015.360) (-1017.646) [-1014.004] * (-1014.809) (-1019.109) (-1014.741) [-1016.015] -- 0:00:12
803000 -- (-1012.659) [-1017.253] (-1017.929) (-1013.871) * (-1013.430) [-1014.025] (-1016.202) (-1015.255) -- 0:00:12
803500 -- [-1013.981] (-1012.796) (-1013.978) (-1017.811) * (-1015.031) (-1017.811) [-1016.088] (-1015.967) -- 0:00:12
804000 -- [-1013.083] (-1013.410) (-1016.997) (-1015.573) * [-1012.694] (-1013.357) (-1013.314) (-1014.166) -- 0:00:12
804500 -- (-1017.877) [-1015.596] (-1018.543) (-1018.145) * (-1015.036) (-1013.463) (-1012.751) [-1015.789] -- 0:00:12
805000 -- [-1012.555] (-1015.263) (-1019.744) (-1014.190) * [-1014.804] (-1016.902) (-1014.111) (-1016.625) -- 0:00:12
Average standard deviation of split frequencies: 0.007291
805500 -- (-1016.293) (-1013.882) (-1016.621) [-1015.173] * (-1014.288) (-1014.678) (-1014.871) [-1014.807] -- 0:00:12
806000 -- [-1016.635] (-1013.849) (-1016.725) (-1015.078) * [-1014.690] (-1014.693) (-1012.797) (-1015.115) -- 0:00:12
806500 -- (-1015.012) (-1013.829) [-1014.945] (-1014.763) * [-1014.640] (-1014.891) (-1013.156) (-1015.852) -- 0:00:12
807000 -- (-1014.035) [-1014.408] (-1014.115) (-1013.614) * (-1013.991) (-1016.939) (-1015.163) [-1015.917] -- 0:00:12
807500 -- [-1016.500] (-1013.221) (-1014.477) (-1012.347) * (-1013.522) [-1014.943] (-1017.146) (-1013.325) -- 0:00:12
808000 -- (-1015.326) (-1013.412) [-1014.781] (-1017.345) * (-1013.387) (-1019.756) (-1013.440) [-1014.099] -- 0:00:12
808500 -- (-1017.364) (-1013.615) [-1018.291] (-1013.638) * (-1014.713) (-1014.894) [-1015.858] (-1015.796) -- 0:00:12
809000 -- (-1014.668) (-1013.475) [-1014.414] (-1018.425) * [-1013.261] (-1012.789) (-1015.968) (-1012.965) -- 0:00:12
809500 -- (-1016.139) (-1015.731) [-1014.170] (-1013.613) * (-1012.869) (-1012.733) (-1013.841) [-1013.667] -- 0:00:12
810000 -- (-1014.920) [-1014.860] (-1012.780) (-1015.068) * (-1014.897) (-1013.078) (-1014.012) [-1013.071] -- 0:00:12
Average standard deviation of split frequencies: 0.007172
810500 -- (-1016.122) [-1015.607] (-1012.880) (-1016.763) * [-1015.719] (-1016.905) (-1015.166) (-1014.216) -- 0:00:12
811000 -- (-1018.657) [-1012.986] (-1018.376) (-1017.199) * [-1015.216] (-1014.444) (-1015.425) (-1015.487) -- 0:00:12
811500 -- [-1015.941] (-1018.343) (-1013.267) (-1017.823) * (-1017.263) (-1015.498) [-1013.380] (-1015.479) -- 0:00:12
812000 -- [-1014.681] (-1015.827) (-1014.766) (-1013.104) * (-1014.610) [-1013.967] (-1014.245) (-1013.349) -- 0:00:12
812500 -- (-1012.921) [-1014.706] (-1013.824) (-1014.089) * (-1014.514) [-1015.513] (-1013.229) (-1018.595) -- 0:00:12
813000 -- (-1015.576) [-1015.190] (-1014.317) (-1013.524) * (-1021.584) (-1016.969) [-1016.027] (-1015.744) -- 0:00:12
813500 -- (-1019.686) (-1014.148) [-1015.265] (-1014.542) * (-1016.291) (-1019.117) (-1014.131) [-1016.365] -- 0:00:12
814000 -- (-1018.084) [-1012.712] (-1013.725) (-1016.366) * (-1015.897) (-1014.324) (-1013.023) [-1014.407] -- 0:00:12
814500 -- (-1016.907) [-1012.965] (-1016.251) (-1013.304) * (-1014.947) [-1017.225] (-1013.464) (-1014.925) -- 0:00:12
815000 -- (-1016.148) (-1012.675) [-1016.181] (-1014.455) * (-1023.260) (-1013.643) (-1015.980) [-1013.548] -- 0:00:12
Average standard deviation of split frequencies: 0.007086
815500 -- (-1012.450) (-1014.798) [-1014.326] (-1013.999) * (-1015.261) (-1015.434) (-1015.440) [-1014.907] -- 0:00:11
816000 -- (-1013.969) [-1014.817] (-1014.750) (-1014.542) * (-1015.109) (-1016.522) [-1016.432] (-1016.682) -- 0:00:11
816500 -- [-1016.575] (-1014.212) (-1013.968) (-1014.377) * [-1013.455] (-1016.212) (-1014.319) (-1015.981) -- 0:00:11
817000 -- (-1017.279) [-1014.606] (-1013.268) (-1012.935) * (-1017.248) (-1019.598) (-1013.380) [-1014.098] -- 0:00:11
817500 -- (-1016.617) (-1014.284) [-1013.353] (-1015.543) * [-1016.029] (-1014.937) (-1013.750) (-1013.798) -- 0:00:11
818000 -- (-1013.184) [-1014.496] (-1017.992) (-1014.289) * [-1015.801] (-1014.624) (-1015.576) (-1016.696) -- 0:00:11
818500 -- (-1014.959) (-1013.154) [-1017.801] (-1013.186) * (-1013.644) (-1015.982) (-1013.240) [-1017.294] -- 0:00:11
819000 -- (-1015.802) [-1013.215] (-1013.432) (-1013.343) * (-1018.843) (-1017.512) [-1014.470] (-1016.114) -- 0:00:11
819500 -- [-1013.157] (-1013.558) (-1016.143) (-1016.735) * [-1016.370] (-1014.425) (-1015.399) (-1014.355) -- 0:00:11
820000 -- (-1012.716) (-1013.324) (-1016.465) [-1014.223] * (-1014.215) (-1013.171) (-1016.746) [-1014.235] -- 0:00:11
Average standard deviation of split frequencies: 0.007467
820500 -- (-1015.546) [-1013.667] (-1012.357) (-1016.220) * (-1013.859) [-1015.877] (-1012.680) (-1014.275) -- 0:00:11
821000 -- (-1022.185) [-1015.044] (-1014.613) (-1017.404) * (-1016.064) (-1013.804) (-1013.876) [-1015.594] -- 0:00:11
821500 -- (-1017.870) (-1015.036) (-1013.509) [-1014.427] * [-1015.533] (-1017.896) (-1015.393) (-1013.869) -- 0:00:11
822000 -- (-1013.945) (-1012.685) (-1012.693) [-1014.217] * (-1021.186) (-1013.965) (-1015.772) [-1014.332] -- 0:00:11
822500 -- (-1015.551) (-1014.322) [-1013.784] (-1013.647) * (-1012.972) [-1012.367] (-1013.002) (-1019.712) -- 0:00:11
823000 -- (-1015.736) [-1013.822] (-1015.417) (-1014.363) * (-1017.632) (-1012.276) [-1013.475] (-1019.057) -- 0:00:11
823500 -- (-1013.515) [-1015.757] (-1017.249) (-1014.277) * [-1013.803] (-1013.440) (-1019.305) (-1015.574) -- 0:00:11
824000 -- (-1013.774) (-1013.318) [-1015.644] (-1014.139) * (-1014.788) (-1013.739) [-1014.694] (-1015.338) -- 0:00:11
824500 -- [-1014.908] (-1015.449) (-1015.985) (-1015.447) * (-1017.650) [-1015.622] (-1016.668) (-1014.855) -- 0:00:11
825000 -- [-1016.970] (-1017.270) (-1015.555) (-1016.585) * (-1017.014) (-1013.590) [-1019.371] (-1014.430) -- 0:00:11
Average standard deviation of split frequencies: 0.007381
825500 -- (-1015.834) (-1016.734) [-1015.077] (-1013.347) * [-1018.339] (-1016.730) (-1015.113) (-1013.463) -- 0:00:11
826000 -- (-1013.739) (-1018.021) [-1014.379] (-1014.918) * (-1016.669) (-1014.667) (-1013.634) [-1014.715] -- 0:00:11
826500 -- (-1020.065) [-1014.298] (-1014.643) (-1022.763) * (-1014.315) (-1015.488) (-1014.089) [-1013.312] -- 0:00:11
827000 -- (-1015.355) (-1015.299) (-1015.212) [-1014.415] * (-1014.795) (-1013.802) [-1013.048] (-1013.515) -- 0:00:11
827500 -- [-1014.805] (-1015.148) (-1016.643) (-1013.589) * (-1017.772) (-1013.788) [-1013.234] (-1013.706) -- 0:00:11
828000 -- (-1012.564) (-1013.122) [-1018.898] (-1018.275) * [-1017.450] (-1014.948) (-1013.210) (-1012.740) -- 0:00:11
828500 -- [-1014.714] (-1013.771) (-1017.354) (-1013.229) * (-1013.625) (-1016.787) [-1013.324] (-1013.617) -- 0:00:11
829000 -- (-1017.900) (-1013.359) [-1013.904] (-1013.589) * [-1012.758] (-1019.354) (-1013.848) (-1013.805) -- 0:00:11
829500 -- [-1015.663] (-1017.127) (-1016.798) (-1019.431) * (-1014.014) (-1014.383) [-1013.040] (-1016.881) -- 0:00:11
830000 -- (-1013.760) (-1019.293) [-1016.335] (-1020.704) * (-1013.586) [-1015.852] (-1013.577) (-1012.506) -- 0:00:11
Average standard deviation of split frequencies: 0.007340
830500 -- [-1013.254] (-1013.606) (-1013.674) (-1014.788) * (-1012.339) (-1015.956) (-1013.062) [-1014.001] -- 0:00:11
831000 -- (-1012.553) (-1015.129) (-1014.536) [-1016.332] * (-1016.613) (-1016.026) [-1013.853] (-1015.396) -- 0:00:10
831500 -- (-1012.848) [-1012.405] (-1012.813) (-1016.837) * [-1013.284] (-1015.482) (-1018.219) (-1013.294) -- 0:00:10
832000 -- (-1012.630) (-1013.364) [-1018.124] (-1015.045) * [-1015.651] (-1014.950) (-1014.086) (-1014.912) -- 0:00:10
832500 -- (-1015.130) (-1013.158) (-1014.462) [-1014.009] * (-1016.475) [-1017.056] (-1014.380) (-1014.555) -- 0:00:10
833000 -- (-1014.643) (-1015.611) [-1014.340] (-1013.241) * [-1015.469] (-1016.027) (-1013.752) (-1014.293) -- 0:00:10
833500 -- (-1015.348) (-1013.741) [-1014.298] (-1012.752) * [-1014.427] (-1014.092) (-1018.964) (-1013.762) -- 0:00:10
834000 -- (-1015.348) [-1013.572] (-1013.010) (-1014.232) * (-1015.614) (-1013.409) (-1014.548) [-1013.863] -- 0:00:10
834500 -- (-1019.345) (-1016.606) [-1013.928] (-1018.974) * (-1018.068) [-1014.433] (-1013.133) (-1013.093) -- 0:00:10
835000 -- (-1014.646) (-1018.529) [-1013.868] (-1013.811) * [-1012.753] (-1014.935) (-1014.577) (-1016.601) -- 0:00:10
Average standard deviation of split frequencies: 0.007753
835500 -- (-1014.921) (-1017.574) (-1013.136) [-1014.277] * (-1012.522) (-1014.022) [-1016.606] (-1012.473) -- 0:00:10
836000 -- [-1015.423] (-1015.290) (-1013.479) (-1015.073) * [-1013.416] (-1014.159) (-1021.441) (-1013.831) -- 0:00:10
836500 -- (-1014.396) [-1015.569] (-1019.166) (-1015.392) * (-1013.192) [-1020.042] (-1016.836) (-1016.528) -- 0:00:10
837000 -- (-1018.243) [-1013.896] (-1013.453) (-1015.986) * (-1017.441) [-1015.406] (-1018.614) (-1014.039) -- 0:00:10
837500 -- (-1017.300) (-1013.896) [-1015.880] (-1018.743) * (-1015.315) (-1014.525) [-1019.968] (-1015.537) -- 0:00:10
838000 -- (-1019.219) [-1012.557] (-1014.641) (-1016.422) * (-1014.383) (-1014.348) [-1017.862] (-1013.409) -- 0:00:10
838500 -- (-1014.959) (-1015.356) (-1013.296) [-1013.675] * (-1015.492) (-1015.842) [-1012.770] (-1017.437) -- 0:00:10
839000 -- (-1014.221) [-1014.794] (-1014.058) (-1016.027) * (-1019.900) (-1015.162) (-1013.677) [-1013.191] -- 0:00:10
839500 -- [-1015.633] (-1014.953) (-1017.968) (-1014.018) * (-1017.669) (-1018.376) [-1013.401] (-1016.552) -- 0:00:10
840000 -- (-1012.957) (-1013.521) (-1014.005) [-1018.353] * (-1013.139) (-1013.136) [-1013.889] (-1013.215) -- 0:00:10
Average standard deviation of split frequencies: 0.007402
840500 -- (-1016.700) [-1015.020] (-1013.838) (-1015.880) * (-1014.695) [-1013.649] (-1016.456) (-1014.037) -- 0:00:10
841000 -- (-1015.501) (-1014.214) [-1015.422] (-1015.979) * (-1013.616) (-1015.304) [-1013.626] (-1014.389) -- 0:00:10
841500 -- (-1012.823) (-1015.299) (-1016.779) [-1013.088] * (-1016.223) [-1013.074] (-1013.106) (-1014.023) -- 0:00:10
842000 -- (-1015.393) (-1017.148) (-1014.200) [-1013.816] * (-1014.735) (-1014.901) (-1015.428) [-1013.564] -- 0:00:10
842500 -- (-1013.908) (-1014.968) (-1016.567) [-1013.314] * [-1013.144] (-1012.276) (-1013.369) (-1014.957) -- 0:00:10
843000 -- (-1013.473) (-1018.160) [-1015.008] (-1014.505) * [-1015.804] (-1014.397) (-1014.650) (-1014.048) -- 0:00:10
843500 -- (-1015.723) [-1015.402] (-1014.051) (-1016.185) * (-1013.467) (-1014.483) [-1012.793] (-1016.189) -- 0:00:10
844000 -- (-1012.959) (-1017.318) [-1014.454] (-1016.211) * (-1012.959) (-1013.122) [-1012.834] (-1016.440) -- 0:00:10
844500 -- (-1013.011) (-1015.470) [-1014.821] (-1014.617) * (-1016.091) (-1015.484) [-1012.975] (-1014.189) -- 0:00:10
845000 -- [-1017.787] (-1014.839) (-1013.399) (-1016.951) * [-1018.658] (-1015.609) (-1016.228) (-1013.614) -- 0:00:10
Average standard deviation of split frequencies: 0.007727
845500 -- (-1015.347) (-1015.609) [-1014.971] (-1019.067) * (-1013.391) [-1014.036] (-1015.321) (-1012.687) -- 0:00:10
846000 -- (-1014.494) (-1020.067) (-1014.314) [-1013.928] * [-1013.326] (-1015.048) (-1013.329) (-1012.685) -- 0:00:10
846500 -- [-1012.896] (-1013.793) (-1015.128) (-1012.657) * (-1015.575) (-1013.901) (-1014.933) [-1016.314] -- 0:00:09
847000 -- (-1013.901) (-1014.258) [-1015.811] (-1013.083) * (-1014.595) [-1015.499] (-1014.793) (-1016.902) -- 0:00:09
847500 -- (-1013.611) (-1013.462) (-1018.055) [-1013.204] * (-1015.989) (-1013.684) (-1014.611) [-1013.797] -- 0:00:09
848000 -- (-1015.297) (-1012.920) [-1016.092] (-1015.686) * (-1015.294) (-1014.737) (-1014.972) [-1015.250] -- 0:00:09
848500 -- [-1015.221] (-1014.650) (-1014.609) (-1012.519) * [-1013.275] (-1014.689) (-1018.484) (-1015.062) -- 0:00:09
849000 -- (-1016.405) (-1014.260) [-1014.145] (-1017.847) * (-1015.754) (-1015.896) [-1012.901] (-1015.433) -- 0:00:09
849500 -- (-1012.973) (-1018.433) [-1012.661] (-1015.569) * [-1017.910] (-1016.433) (-1016.894) (-1015.323) -- 0:00:09
850000 -- (-1012.905) (-1015.102) (-1014.038) [-1014.978] * (-1014.882) (-1015.508) (-1017.828) [-1018.569] -- 0:00:09
Average standard deviation of split frequencies: 0.007574
850500 -- (-1017.237) (-1013.486) (-1018.471) [-1015.047] * [-1013.344] (-1014.352) (-1013.978) (-1014.113) -- 0:00:09
851000 -- (-1015.118) (-1012.931) (-1015.165) [-1017.705] * (-1014.181) (-1013.586) (-1015.993) [-1014.088] -- 0:00:09
851500 -- (-1015.924) [-1014.074] (-1015.343) (-1014.737) * (-1018.655) (-1018.255) [-1014.958] (-1012.519) -- 0:00:09
852000 -- [-1012.630] (-1016.662) (-1018.540) (-1016.111) * (-1012.876) (-1014.750) (-1013.013) [-1013.428] -- 0:00:09
852500 -- (-1014.964) (-1016.738) (-1021.272) [-1015.967] * (-1012.887) (-1016.539) [-1012.977] (-1017.628) -- 0:00:09
853000 -- (-1014.332) (-1019.849) [-1015.509] (-1018.031) * (-1016.004) (-1014.646) (-1015.990) [-1013.281] -- 0:00:09
853500 -- (-1013.940) (-1015.814) (-1013.063) [-1017.198] * (-1017.574) (-1015.365) [-1015.509] (-1016.713) -- 0:00:09
854000 -- (-1017.108) [-1013.415] (-1013.218) (-1016.261) * (-1014.082) (-1013.969) (-1014.917) [-1014.615] -- 0:00:09
854500 -- (-1013.155) (-1019.430) [-1013.396] (-1017.727) * (-1013.462) (-1020.180) (-1013.416) [-1013.443] -- 0:00:09
855000 -- [-1012.891] (-1015.040) (-1013.565) (-1013.385) * [-1015.897] (-1017.497) (-1014.209) (-1012.455) -- 0:00:09
Average standard deviation of split frequencies: 0.007086
855500 -- [-1014.069] (-1016.530) (-1013.708) (-1014.104) * (-1014.946) (-1016.671) (-1015.202) [-1012.799] -- 0:00:09
856000 -- (-1014.993) [-1017.011] (-1016.540) (-1013.296) * (-1014.596) (-1016.640) (-1015.751) [-1014.348] -- 0:00:09
856500 -- (-1015.231) (-1014.167) (-1013.889) [-1015.204] * (-1014.378) (-1015.550) (-1014.880) [-1018.820] -- 0:00:09
857000 -- (-1015.613) (-1014.167) [-1012.922] (-1016.312) * (-1014.991) (-1016.577) [-1015.212] (-1013.603) -- 0:00:09
857500 -- [-1015.015] (-1016.141) (-1014.577) (-1018.481) * (-1015.910) [-1013.710] (-1014.574) (-1015.177) -- 0:00:09
858000 -- (-1014.455) [-1015.042] (-1015.131) (-1014.803) * (-1016.219) [-1013.275] (-1014.235) (-1013.202) -- 0:00:09
858500 -- (-1016.406) (-1012.997) (-1016.008) [-1014.611] * (-1018.456) (-1012.467) [-1013.815] (-1018.088) -- 0:00:09
859000 -- (-1014.583) [-1014.706] (-1013.126) (-1014.292) * (-1015.367) (-1013.690) (-1015.279) [-1015.540] -- 0:00:09
859500 -- (-1013.924) (-1015.086) (-1014.428) [-1017.456] * (-1016.463) (-1015.119) (-1012.482) [-1018.308] -- 0:00:09
860000 -- [-1013.610] (-1014.380) (-1013.817) (-1014.913) * (-1018.614) (-1015.820) [-1015.292] (-1019.568) -- 0:00:09
Average standard deviation of split frequencies: 0.007011
860500 -- (-1014.594) [-1013.302] (-1014.692) (-1014.058) * (-1012.680) [-1013.368] (-1013.939) (-1013.488) -- 0:00:09
861000 -- (-1012.874) (-1012.935) (-1014.930) [-1014.788] * [-1012.585] (-1014.750) (-1012.872) (-1013.316) -- 0:00:09
861500 -- (-1012.935) (-1014.008) [-1014.325] (-1013.123) * [-1013.463] (-1014.764) (-1014.717) (-1013.187) -- 0:00:09
862000 -- (-1015.803) (-1013.177) (-1013.425) [-1016.445] * (-1024.457) (-1015.556) (-1014.000) [-1013.406] -- 0:00:08
862500 -- (-1017.852) (-1017.132) (-1016.715) [-1015.378] * (-1012.654) (-1014.424) [-1013.924] (-1015.292) -- 0:00:08
863000 -- (-1016.818) (-1015.948) [-1023.544] (-1014.467) * (-1012.771) (-1014.409) (-1015.663) [-1014.250] -- 0:00:08
863500 -- (-1016.443) (-1012.864) [-1015.101] (-1017.242) * (-1013.291) (-1014.022) (-1014.839) [-1014.975] -- 0:00:08
864000 -- [-1015.910] (-1012.662) (-1013.588) (-1014.911) * [-1013.921] (-1013.202) (-1021.591) (-1018.368) -- 0:00:08
864500 -- (-1015.967) [-1015.097] (-1014.539) (-1014.530) * (-1015.149) [-1014.236] (-1016.348) (-1013.103) -- 0:00:08
865000 -- (-1015.350) [-1014.513] (-1013.830) (-1015.309) * (-1015.215) (-1017.626) (-1015.372) [-1014.156] -- 0:00:08
Average standard deviation of split frequencies: 0.007512
865500 -- [-1012.672] (-1018.287) (-1014.755) (-1013.109) * (-1017.391) (-1013.320) [-1013.409] (-1013.772) -- 0:00:08
866000 -- (-1012.505) [-1018.914] (-1014.901) (-1014.268) * (-1014.650) (-1015.035) [-1014.239] (-1014.154) -- 0:00:08
866500 -- [-1014.180] (-1015.853) (-1014.882) (-1019.280) * (-1016.508) (-1013.139) [-1014.508] (-1015.646) -- 0:00:08
867000 -- (-1012.652) [-1014.393] (-1015.227) (-1015.162) * (-1013.300) [-1016.298] (-1016.533) (-1013.014) -- 0:00:08
867500 -- (-1013.891) (-1014.326) [-1013.020] (-1013.125) * (-1014.672) (-1017.218) [-1016.217] (-1013.994) -- 0:00:08
868000 -- (-1016.497) (-1013.018) (-1013.190) [-1013.452] * [-1014.946] (-1012.993) (-1013.403) (-1015.389) -- 0:00:08
868500 -- (-1014.251) (-1013.852) [-1013.682] (-1015.022) * (-1013.887) (-1022.309) (-1016.655) [-1015.347] -- 0:00:08
869000 -- (-1017.371) (-1014.097) [-1012.757] (-1019.126) * [-1015.364] (-1022.610) (-1016.657) (-1015.543) -- 0:00:08
869500 -- (-1015.327) (-1015.429) [-1013.944] (-1015.815) * [-1014.940] (-1015.889) (-1013.915) (-1013.011) -- 0:00:08
870000 -- (-1013.609) [-1015.499] (-1015.681) (-1014.004) * [-1015.140] (-1013.579) (-1016.616) (-1015.466) -- 0:00:08
Average standard deviation of split frequencies: 0.007472
870500 -- (-1015.673) (-1017.329) (-1012.862) [-1016.283] * (-1015.724) (-1013.376) (-1015.703) [-1017.036] -- 0:00:08
871000 -- (-1013.826) (-1015.577) [-1013.232] (-1014.511) * (-1014.101) [-1013.265] (-1014.800) (-1013.461) -- 0:00:08
871500 -- (-1013.736) (-1023.053) [-1021.410] (-1015.861) * (-1017.671) [-1013.740] (-1015.243) (-1016.106) -- 0:00:08
872000 -- [-1013.770] (-1013.934) (-1013.444) (-1013.307) * (-1015.894) [-1013.796] (-1012.897) (-1013.760) -- 0:00:08
872500 -- (-1015.126) (-1013.032) (-1014.014) [-1013.769] * (-1013.900) [-1015.138] (-1013.192) (-1013.309) -- 0:00:08
873000 -- [-1015.698] (-1012.917) (-1014.071) (-1013.635) * (-1015.046) [-1016.150] (-1014.091) (-1013.220) -- 0:00:08
873500 -- [-1013.737] (-1014.874) (-1013.525) (-1014.739) * (-1014.124) (-1016.994) [-1014.397] (-1017.851) -- 0:00:08
874000 -- (-1013.791) (-1016.696) (-1014.758) [-1013.776] * [-1014.213] (-1013.000) (-1013.040) (-1015.539) -- 0:00:08
874500 -- (-1016.112) [-1016.632] (-1013.465) (-1012.979) * (-1016.948) (-1013.874) (-1012.552) [-1013.433] -- 0:00:08
875000 -- (-1014.791) (-1014.995) [-1013.904] (-1014.093) * (-1013.512) [-1016.851] (-1013.835) (-1015.087) -- 0:00:08
Average standard deviation of split frequencies: 0.007247
875500 -- [-1014.214] (-1013.088) (-1013.650) (-1013.423) * (-1013.235) (-1015.689) [-1014.323] (-1016.627) -- 0:00:08
876000 -- (-1020.118) [-1013.263] (-1017.066) (-1019.181) * [-1016.171] (-1013.599) (-1016.947) (-1015.251) -- 0:00:08
876500 -- [-1019.132] (-1014.619) (-1016.514) (-1017.527) * (-1013.449) (-1013.338) (-1017.902) [-1013.155] -- 0:00:08
877000 -- [-1013.086] (-1015.745) (-1015.291) (-1013.352) * (-1014.530) [-1013.107] (-1014.860) (-1013.656) -- 0:00:07
877500 -- (-1013.452) (-1015.626) [-1014.358] (-1024.869) * [-1013.691] (-1012.967) (-1014.312) (-1014.992) -- 0:00:07
878000 -- [-1015.104] (-1014.953) (-1015.073) (-1015.253) * [-1013.442] (-1013.714) (-1013.744) (-1014.544) -- 0:00:07
878500 -- (-1014.591) [-1016.618] (-1014.659) (-1015.330) * (-1015.267) (-1017.532) (-1012.735) [-1016.664] -- 0:00:07
879000 -- (-1014.517) [-1015.181] (-1016.458) (-1015.130) * (-1016.743) [-1014.004] (-1016.597) (-1015.652) -- 0:00:07
879500 -- [-1012.285] (-1016.520) (-1014.254) (-1016.003) * (-1014.467) (-1016.186) [-1014.791] (-1013.527) -- 0:00:07
880000 -- (-1012.292) (-1014.821) (-1014.517) [-1014.138] * [-1018.996] (-1015.608) (-1018.067) (-1012.639) -- 0:00:07
Average standard deviation of split frequencies: 0.007208
880500 -- (-1013.613) (-1012.491) [-1014.035] (-1014.329) * (-1015.414) (-1015.465) [-1017.562] (-1014.911) -- 0:00:07
881000 -- [-1014.827] (-1016.244) (-1014.172) (-1013.539) * (-1014.919) (-1014.987) (-1016.347) [-1016.375] -- 0:00:07
881500 -- [-1016.432] (-1013.463) (-1016.960) (-1012.378) * (-1015.847) (-1016.352) (-1017.051) [-1017.114] -- 0:00:07
882000 -- (-1012.852) [-1013.709] (-1013.087) (-1016.467) * (-1020.045) (-1015.017) [-1018.590] (-1014.627) -- 0:00:07
882500 -- [-1012.365] (-1018.417) (-1014.267) (-1020.122) * (-1018.966) (-1017.874) (-1012.743) [-1013.025] -- 0:00:07
883000 -- [-1013.267] (-1013.810) (-1013.150) (-1015.516) * (-1014.916) [-1014.934] (-1015.027) (-1013.594) -- 0:00:07
883500 -- [-1016.160] (-1014.016) (-1014.003) (-1015.876) * [-1019.356] (-1016.313) (-1016.180) (-1014.701) -- 0:00:07
884000 -- (-1017.109) (-1015.271) (-1013.659) [-1017.720] * (-1016.989) (-1021.451) (-1013.967) [-1016.327] -- 0:00:07
884500 -- (-1017.826) [-1013.668] (-1017.703) (-1016.067) * (-1013.923) (-1017.965) (-1013.976) [-1012.763] -- 0:00:07
885000 -- (-1016.170) (-1013.446) (-1019.491) [-1013.583] * (-1014.554) (-1013.700) [-1013.307] (-1015.882) -- 0:00:07
Average standard deviation of split frequencies: 0.007201
885500 -- [-1014.494] (-1013.442) (-1013.362) (-1014.124) * (-1014.574) (-1013.603) [-1014.232] (-1013.204) -- 0:00:07
886000 -- (-1013.494) [-1014.068] (-1015.885) (-1014.787) * [-1012.466] (-1013.951) (-1013.682) (-1012.287) -- 0:00:07
886500 -- [-1013.625] (-1014.176) (-1019.532) (-1013.123) * (-1014.145) (-1013.755) [-1014.141] (-1012.308) -- 0:00:07
887000 -- (-1015.192) (-1015.799) (-1015.093) [-1013.611] * (-1012.496) [-1014.167] (-1013.825) (-1019.504) -- 0:00:07
887500 -- (-1016.153) [-1013.273] (-1018.529) (-1015.063) * (-1014.349) (-1018.297) [-1013.272] (-1013.488) -- 0:00:07
888000 -- (-1018.370) [-1017.008] (-1018.484) (-1014.669) * [-1015.687] (-1016.455) (-1012.953) (-1013.356) -- 0:00:07
888500 -- (-1014.154) (-1015.773) (-1017.681) [-1013.216] * (-1013.981) (-1013.805) [-1014.767] (-1014.544) -- 0:00:07
889000 -- (-1015.261) (-1014.347) (-1012.850) [-1012.711] * (-1015.828) (-1015.952) (-1014.143) [-1013.802] -- 0:00:07
889500 -- (-1014.157) [-1013.415] (-1014.476) (-1016.083) * (-1014.310) (-1013.366) [-1013.773] (-1012.676) -- 0:00:07
890000 -- [-1019.919] (-1014.038) (-1015.556) (-1017.499) * (-1016.664) (-1015.642) [-1013.748] (-1015.929) -- 0:00:07
Average standard deviation of split frequencies: 0.007586
890500 -- (-1016.350) [-1014.387] (-1014.344) (-1018.279) * (-1015.354) [-1016.060] (-1017.782) (-1014.556) -- 0:00:07
891000 -- [-1012.711] (-1015.861) (-1013.742) (-1014.348) * (-1017.143) (-1017.370) (-1015.898) [-1015.042] -- 0:00:07
891500 -- [-1015.332] (-1015.170) (-1017.360) (-1018.350) * (-1016.500) (-1014.739) (-1016.153) [-1015.271] -- 0:00:07
892000 -- (-1015.262) (-1015.105) (-1013.991) [-1015.070] * [-1013.427] (-1013.046) (-1015.081) (-1015.014) -- 0:00:07
892500 -- [-1015.305] (-1016.615) (-1012.793) (-1014.084) * (-1015.140) (-1014.796) (-1016.518) [-1013.975] -- 0:00:06
893000 -- (-1014.120) (-1016.174) [-1014.637] (-1014.983) * (-1013.890) (-1014.888) [-1015.673] (-1014.571) -- 0:00:06
893500 -- [-1012.744] (-1013.843) (-1015.573) (-1016.455) * [-1014.717] (-1013.391) (-1019.992) (-1014.159) -- 0:00:06
894000 -- [-1014.087] (-1013.415) (-1015.873) (-1014.205) * (-1015.427) [-1016.676] (-1015.081) (-1020.824) -- 0:00:06
894500 -- [-1014.025] (-1014.933) (-1014.595) (-1012.771) * (-1015.141) [-1016.943] (-1018.332) (-1017.479) -- 0:00:06
895000 -- (-1013.252) (-1018.664) (-1016.279) [-1015.177] * (-1013.524) (-1016.690) [-1018.288] (-1020.497) -- 0:00:06
Average standard deviation of split frequencies: 0.007611
895500 -- [-1015.702] (-1017.100) (-1016.209) (-1016.534) * (-1017.417) (-1015.557) (-1015.912) [-1014.516] -- 0:00:06
896000 -- [-1017.265] (-1017.429) (-1012.751) (-1018.617) * (-1018.138) (-1016.192) (-1015.082) [-1014.201] -- 0:00:06
896500 -- (-1017.316) (-1014.163) [-1017.298] (-1015.087) * (-1016.953) [-1014.042] (-1012.825) (-1018.122) -- 0:00:06
897000 -- [-1017.718] (-1016.366) (-1015.096) (-1016.542) * (-1017.567) (-1014.438) [-1014.436] (-1017.161) -- 0:00:06
897500 -- (-1014.828) (-1014.210) [-1013.713] (-1012.529) * [-1013.100] (-1014.367) (-1013.560) (-1013.983) -- 0:00:06
898000 -- (-1014.729) (-1017.152) [-1014.479] (-1015.687) * (-1016.122) (-1014.948) [-1012.672] (-1014.392) -- 0:00:06
898500 -- (-1013.375) [-1013.142] (-1018.031) (-1012.410) * (-1012.871) (-1016.042) [-1014.131] (-1014.184) -- 0:00:06
899000 -- (-1013.152) (-1012.686) [-1014.364] (-1012.429) * (-1013.535) [-1014.564] (-1014.037) (-1014.132) -- 0:00:06
899500 -- [-1014.471] (-1016.164) (-1015.852) (-1016.523) * [-1013.849] (-1014.810) (-1016.854) (-1019.423) -- 0:00:06
900000 -- (-1015.253) (-1014.490) (-1013.610) [-1013.340] * [-1013.748] (-1014.494) (-1016.137) (-1012.504) -- 0:00:06
Average standard deviation of split frequencies: 0.007642
900500 -- (-1013.512) (-1013.368) [-1013.261] (-1014.915) * (-1014.112) (-1013.362) (-1014.592) [-1012.861] -- 0:00:06
901000 -- [-1016.350] (-1014.988) (-1014.654) (-1016.138) * (-1014.233) [-1014.659] (-1016.746) (-1015.984) -- 0:00:06
901500 -- (-1013.913) [-1015.226] (-1013.748) (-1013.796) * [-1013.666] (-1012.580) (-1016.506) (-1016.699) -- 0:00:06
902000 -- (-1016.128) (-1014.817) (-1014.321) [-1014.406] * (-1014.296) (-1017.199) (-1012.609) [-1016.881] -- 0:00:06
902500 -- (-1017.383) (-1013.927) [-1013.280] (-1016.199) * (-1015.615) (-1013.481) [-1014.370] (-1014.835) -- 0:00:06
903000 -- [-1014.459] (-1015.056) (-1012.995) (-1016.850) * (-1015.560) [-1014.127] (-1014.462) (-1016.342) -- 0:00:06
903500 -- (-1014.237) (-1014.530) [-1014.510] (-1013.700) * (-1014.272) (-1015.297) (-1014.569) [-1016.413] -- 0:00:06
904000 -- [-1014.246] (-1017.517) (-1014.339) (-1013.214) * (-1018.095) [-1014.206] (-1014.409) (-1015.299) -- 0:00:06
904500 -- (-1015.298) [-1016.302] (-1015.392) (-1012.525) * (-1018.519) (-1014.332) (-1016.945) [-1014.725] -- 0:00:06
905000 -- (-1015.386) [-1012.738] (-1015.965) (-1018.906) * (-1014.372) (-1014.179) [-1015.312] (-1014.385) -- 0:00:06
Average standard deviation of split frequencies: 0.007839
905500 -- [-1013.595] (-1016.099) (-1016.585) (-1015.124) * (-1014.360) (-1015.058) (-1016.464) [-1015.805] -- 0:00:06
906000 -- (-1013.433) (-1019.072) (-1016.365) [-1016.040] * [-1015.352] (-1013.092) (-1013.386) (-1016.550) -- 0:00:06
906500 -- (-1013.447) (-1015.272) [-1013.386] (-1017.687) * (-1014.515) [-1013.092] (-1013.442) (-1014.841) -- 0:00:06
907000 -- [-1013.386] (-1013.261) (-1015.949) (-1016.155) * (-1014.427) (-1012.784) [-1012.421] (-1014.652) -- 0:00:06
907500 -- [-1018.617] (-1012.909) (-1016.671) (-1015.690) * (-1014.749) (-1014.487) (-1012.821) [-1013.758] -- 0:00:06
908000 -- (-1015.408) (-1014.054) [-1015.115] (-1013.013) * (-1017.337) [-1015.215] (-1014.851) (-1014.427) -- 0:00:05
908500 -- (-1014.354) (-1013.031) (-1015.545) [-1013.289] * (-1016.014) (-1013.341) [-1013.435] (-1014.831) -- 0:00:05
909000 -- [-1012.825] (-1014.312) (-1013.064) (-1012.747) * (-1016.262) [-1013.876] (-1015.288) (-1015.852) -- 0:00:05
909500 -- [-1013.394] (-1014.586) (-1012.916) (-1012.540) * (-1016.468) (-1017.067) (-1017.018) [-1014.333] -- 0:00:05
910000 -- (-1013.489) (-1015.492) [-1014.436] (-1012.841) * (-1014.129) [-1013.884] (-1016.990) (-1014.947) -- 0:00:05
Average standard deviation of split frequencies: 0.007696
910500 -- (-1016.401) (-1013.698) (-1015.065) [-1013.384] * (-1015.277) (-1013.965) (-1017.785) [-1013.610] -- 0:00:05
911000 -- (-1015.554) (-1015.484) [-1013.939] (-1016.346) * (-1015.015) [-1013.631] (-1020.592) (-1017.855) -- 0:00:05
911500 -- (-1018.541) (-1014.033) (-1013.404) [-1015.823] * (-1013.934) (-1013.728) (-1015.380) [-1012.685] -- 0:00:05
912000 -- (-1019.219) (-1013.027) [-1012.981] (-1012.625) * (-1015.599) (-1013.224) (-1016.127) [-1012.745] -- 0:00:05
912500 -- [-1018.365] (-1013.482) (-1015.401) (-1013.215) * (-1015.218) (-1014.278) [-1015.263] (-1012.730) -- 0:00:05
913000 -- [-1015.691] (-1015.113) (-1014.740) (-1016.928) * (-1014.051) (-1016.479) [-1014.471] (-1014.173) -- 0:00:05
913500 -- [-1014.741] (-1017.010) (-1014.807) (-1015.229) * (-1014.659) (-1020.541) (-1014.069) [-1014.476] -- 0:00:05
914000 -- (-1013.103) (-1016.783) (-1016.984) [-1013.517] * (-1017.235) (-1017.244) (-1014.399) [-1013.987] -- 0:00:05
914500 -- [-1012.585] (-1015.742) (-1014.243) (-1015.936) * (-1013.090) (-1015.744) (-1013.914) [-1014.913] -- 0:00:05
915000 -- (-1016.008) [-1017.397] (-1014.653) (-1015.866) * (-1017.136) (-1021.108) (-1020.618) [-1016.105] -- 0:00:05
Average standard deviation of split frequencies: 0.007857
915500 -- (-1013.180) [-1014.332] (-1013.673) (-1017.737) * (-1017.461) [-1017.703] (-1015.438) (-1016.923) -- 0:00:05
916000 -- (-1015.100) (-1015.450) (-1013.602) [-1017.605] * [-1013.142] (-1015.073) (-1015.765) (-1016.073) -- 0:00:05
916500 -- [-1013.680] (-1017.068) (-1013.074) (-1018.078) * (-1015.907) (-1015.255) (-1014.206) [-1014.933] -- 0:00:05
917000 -- (-1016.776) [-1015.830] (-1018.198) (-1015.160) * [-1019.989] (-1014.252) (-1017.772) (-1013.895) -- 0:00:05
917500 -- (-1016.711) (-1012.836) [-1014.122] (-1012.415) * (-1013.690) (-1014.750) [-1014.164] (-1020.034) -- 0:00:05
918000 -- [-1017.445] (-1013.189) (-1016.010) (-1013.101) * (-1014.175) (-1013.723) [-1015.319] (-1016.846) -- 0:00:05
918500 -- (-1020.682) [-1013.746] (-1012.552) (-1019.749) * (-1014.433) (-1015.677) (-1013.512) [-1013.931] -- 0:00:05
919000 -- (-1016.258) (-1014.628) [-1013.866] (-1017.501) * (-1014.580) (-1015.085) [-1014.252] (-1013.340) -- 0:00:05
919500 -- (-1017.607) [-1012.556] (-1015.159) (-1020.425) * (-1015.630) [-1015.315] (-1013.425) (-1013.150) -- 0:00:05
920000 -- (-1012.681) [-1013.132] (-1015.836) (-1014.106) * [-1014.750] (-1013.835) (-1014.433) (-1012.690) -- 0:00:05
Average standard deviation of split frequencies: 0.007715
920500 -- (-1017.666) (-1013.342) [-1013.992] (-1018.060) * (-1014.056) (-1013.294) [-1012.905] (-1016.438) -- 0:00:05
921000 -- (-1015.615) (-1015.350) [-1013.187] (-1021.074) * (-1017.299) (-1015.243) [-1013.343] (-1016.621) -- 0:00:05
921500 -- (-1018.586) (-1015.772) (-1012.629) [-1014.927] * (-1016.484) (-1017.820) (-1013.734) [-1013.991] -- 0:00:05
922000 -- [-1015.505] (-1014.220) (-1014.345) (-1013.992) * [-1015.072] (-1018.950) (-1016.292) (-1016.551) -- 0:00:05
922500 -- (-1012.455) (-1013.802) (-1012.878) [-1017.091] * (-1018.515) [-1017.576] (-1014.158) (-1015.917) -- 0:00:05
923000 -- (-1013.869) [-1012.664] (-1024.956) (-1014.645) * (-1020.005) [-1014.260] (-1014.291) (-1013.135) -- 0:00:05
923500 -- [-1013.954] (-1013.440) (-1012.339) (-1020.683) * (-1017.951) (-1015.662) [-1015.540] (-1014.554) -- 0:00:04
924000 -- (-1013.566) [-1019.296] (-1015.935) (-1020.407) * (-1016.948) (-1018.770) [-1015.355] (-1015.948) -- 0:00:04
924500 -- [-1013.776] (-1015.735) (-1014.097) (-1013.423) * (-1017.350) (-1013.151) [-1013.906] (-1012.814) -- 0:00:04
925000 -- (-1015.413) (-1015.777) (-1012.336) [-1013.736] * [-1013.557] (-1014.803) (-1013.748) (-1014.007) -- 0:00:04
Average standard deviation of split frequencies: 0.007534
925500 -- [-1017.542] (-1012.275) (-1012.913) (-1013.278) * (-1012.815) (-1013.639) [-1014.759] (-1012.999) -- 0:00:04
926000 -- [-1019.230] (-1014.147) (-1012.843) (-1015.381) * [-1012.438] (-1015.002) (-1014.364) (-1019.880) -- 0:00:04
926500 -- (-1016.057) (-1015.728) [-1021.908] (-1015.280) * [-1015.151] (-1017.000) (-1013.885) (-1017.065) -- 0:00:04
927000 -- [-1015.022] (-1019.287) (-1022.195) (-1013.455) * [-1012.267] (-1018.455) (-1012.995) (-1013.634) -- 0:00:04
927500 -- [-1013.127] (-1016.207) (-1018.518) (-1013.914) * (-1017.806) (-1015.844) (-1014.015) [-1013.612] -- 0:00:04
928000 -- (-1013.508) (-1015.005) (-1017.221) [-1016.961] * (-1012.758) (-1015.136) (-1017.078) [-1012.978] -- 0:00:04
928500 -- (-1012.628) [-1015.797] (-1017.873) (-1013.089) * (-1013.377) (-1013.053) (-1017.784) [-1012.372] -- 0:00:04
929000 -- [-1014.532] (-1013.910) (-1014.247) (-1014.814) * (-1015.144) (-1017.005) (-1015.815) [-1013.388] -- 0:00:04
929500 -- [-1016.265] (-1016.448) (-1018.301) (-1013.927) * [-1012.689] (-1014.178) (-1014.884) (-1015.813) -- 0:00:04
930000 -- (-1014.035) (-1015.955) (-1017.002) [-1012.527] * [-1013.825] (-1013.049) (-1014.103) (-1014.118) -- 0:00:04
Average standard deviation of split frequencies: 0.007699
930500 -- [-1014.172] (-1015.302) (-1015.264) (-1013.617) * [-1014.019] (-1015.778) (-1015.744) (-1014.685) -- 0:00:04
931000 -- (-1013.643) [-1014.744] (-1013.384) (-1014.784) * (-1015.498) [-1015.134] (-1013.031) (-1012.758) -- 0:00:04
931500 -- [-1016.777] (-1014.881) (-1018.103) (-1014.591) * (-1012.958) (-1015.240) (-1013.883) [-1013.745] -- 0:00:04
932000 -- [-1015.226] (-1017.537) (-1016.943) (-1013.263) * [-1014.454] (-1013.255) (-1014.595) (-1015.113) -- 0:00:04
932500 -- (-1016.030) [-1012.619] (-1015.929) (-1016.897) * (-1014.299) (-1012.679) [-1015.226] (-1015.267) -- 0:00:04
933000 -- (-1013.961) (-1014.189) (-1016.062) [-1013.002] * [-1013.606] (-1013.986) (-1014.663) (-1018.827) -- 0:00:04
933500 -- (-1014.397) (-1016.540) (-1017.106) [-1016.757] * [-1016.146] (-1014.337) (-1016.122) (-1013.085) -- 0:00:04
934000 -- (-1015.628) [-1015.508] (-1013.005) (-1013.959) * [-1012.382] (-1013.498) (-1014.457) (-1015.100) -- 0:00:04
934500 -- [-1016.369] (-1014.494) (-1014.660) (-1013.786) * [-1013.672] (-1012.824) (-1013.578) (-1016.729) -- 0:00:04
935000 -- (-1013.845) [-1018.525] (-1013.948) (-1016.190) * [-1012.857] (-1014.045) (-1014.795) (-1015.137) -- 0:00:04
Average standard deviation of split frequencies: 0.008058
935500 -- (-1015.521) [-1016.640] (-1014.987) (-1013.217) * [-1013.550] (-1013.898) (-1016.444) (-1016.199) -- 0:00:04
936000 -- (-1014.025) (-1016.902) [-1014.986] (-1013.884) * [-1016.112] (-1013.595) (-1016.481) (-1015.529) -- 0:00:04
936500 -- (-1014.405) (-1013.784) [-1014.143] (-1015.419) * (-1014.037) (-1014.158) (-1014.955) [-1015.184] -- 0:00:04
937000 -- [-1015.489] (-1014.200) (-1014.175) (-1014.597) * (-1012.365) [-1014.172] (-1015.845) (-1014.764) -- 0:00:04
937500 -- (-1017.340) [-1014.038] (-1013.458) (-1015.407) * (-1015.871) [-1014.413] (-1012.648) (-1015.969) -- 0:00:04
938000 -- (-1014.712) (-1016.261) (-1019.759) [-1015.043] * (-1016.403) (-1013.463) [-1012.684] (-1013.105) -- 0:00:04
938500 -- [-1012.749] (-1016.117) (-1021.611) (-1015.368) * [-1016.155] (-1013.551) (-1015.723) (-1014.998) -- 0:00:03
939000 -- (-1012.760) [-1012.713] (-1016.040) (-1012.489) * (-1015.181) (-1018.879) [-1014.063] (-1018.873) -- 0:00:03
939500 -- (-1013.648) [-1013.680] (-1015.595) (-1012.656) * (-1013.322) (-1017.601) (-1013.579) [-1013.946] -- 0:00:03
940000 -- (-1016.219) [-1013.599] (-1014.648) (-1016.992) * (-1015.670) (-1015.890) [-1014.269] (-1014.926) -- 0:00:03
Average standard deviation of split frequencies: 0.007951
940500 -- (-1015.800) [-1013.316] (-1012.712) (-1013.052) * (-1015.224) (-1014.793) (-1015.354) [-1014.848] -- 0:00:03
941000 -- (-1017.949) (-1012.884) [-1012.900] (-1013.114) * [-1013.289] (-1014.840) (-1015.359) (-1014.260) -- 0:00:03
941500 -- (-1015.332) (-1017.971) [-1013.724] (-1012.905) * [-1012.538] (-1017.928) (-1013.686) (-1013.093) -- 0:00:03
942000 -- (-1014.116) (-1016.090) [-1013.643] (-1014.349) * (-1013.501) (-1013.796) (-1013.740) [-1014.818] -- 0:00:03
942500 -- [-1018.497] (-1016.223) (-1015.356) (-1014.096) * (-1013.670) (-1013.585) [-1012.608] (-1014.791) -- 0:00:03
943000 -- (-1013.169) (-1017.741) (-1018.596) [-1013.445] * (-1016.160) (-1016.050) [-1013.882] (-1016.125) -- 0:00:03
943500 -- [-1014.021] (-1014.693) (-1013.263) (-1015.255) * (-1015.399) [-1014.564] (-1017.663) (-1016.392) -- 0:00:03
944000 -- [-1014.026] (-1016.024) (-1012.974) (-1012.952) * (-1013.546) (-1015.758) [-1014.673] (-1016.818) -- 0:00:03
944500 -- (-1013.259) (-1014.698) [-1015.841] (-1016.720) * (-1018.705) [-1013.878] (-1014.677) (-1012.826) -- 0:00:03
945000 -- (-1013.144) [-1014.645] (-1015.097) (-1017.052) * (-1018.718) (-1015.331) (-1017.987) [-1014.861] -- 0:00:03
Average standard deviation of split frequencies: 0.008372
945500 -- (-1013.694) (-1014.788) (-1015.056) [-1013.450] * [-1012.578] (-1019.578) (-1015.746) (-1015.273) -- 0:00:03
946000 -- (-1014.594) (-1013.137) [-1013.687] (-1024.588) * (-1014.546) [-1022.232] (-1013.501) (-1014.241) -- 0:00:03
946500 -- (-1013.086) (-1017.193) (-1013.107) [-1017.969] * [-1014.662] (-1014.432) (-1015.396) (-1014.899) -- 0:00:03
947000 -- (-1015.180) (-1016.634) (-1013.337) [-1019.131] * (-1015.782) [-1014.905] (-1015.897) (-1015.563) -- 0:00:03
947500 -- (-1014.041) (-1016.640) [-1014.869] (-1018.217) * (-1013.173) (-1017.951) [-1012.776] (-1014.944) -- 0:00:03
948000 -- [-1017.365] (-1015.345) (-1012.796) (-1021.522) * [-1013.346] (-1017.068) (-1013.902) (-1014.559) -- 0:00:03
948500 -- (-1019.706) (-1013.812) [-1013.830] (-1017.269) * (-1013.771) [-1015.382] (-1012.945) (-1014.837) -- 0:00:03
949000 -- (-1016.653) (-1018.165) [-1012.814] (-1017.460) * (-1014.946) (-1014.478) (-1017.404) [-1014.359] -- 0:00:03
949500 -- (-1012.819) (-1017.954) (-1017.496) [-1016.468] * (-1016.657) [-1013.988] (-1014.643) (-1013.002) -- 0:00:03
950000 -- (-1015.043) (-1013.646) (-1018.519) [-1012.769] * (-1013.941) (-1013.311) [-1013.444] (-1014.760) -- 0:00:03
Average standard deviation of split frequencies: 0.007835
950500 -- (-1019.928) (-1015.254) [-1015.440] (-1015.205) * [-1015.187] (-1013.214) (-1013.217) (-1013.482) -- 0:00:03
951000 -- (-1017.894) (-1013.375) (-1015.551) [-1013.675] * (-1013.914) (-1014.100) [-1014.767] (-1016.356) -- 0:00:03
951500 -- [-1015.410] (-1013.488) (-1013.940) (-1014.187) * [-1018.936] (-1019.452) (-1016.866) (-1016.408) -- 0:00:03
952000 -- (-1014.528) (-1014.219) [-1015.448] (-1012.884) * (-1014.780) (-1014.954) (-1016.948) [-1016.388] -- 0:00:03
952500 -- (-1013.252) (-1015.297) (-1014.091) [-1015.948] * [-1017.894] (-1017.134) (-1015.874) (-1015.030) -- 0:00:03
953000 -- (-1017.766) [-1012.935] (-1013.209) (-1016.062) * (-1016.778) [-1016.172] (-1013.941) (-1016.539) -- 0:00:03
953500 -- [-1017.349] (-1014.635) (-1013.828) (-1014.822) * (-1023.395) [-1015.311] (-1012.951) (-1014.938) -- 0:00:03
954000 -- (-1014.221) [-1013.500] (-1013.924) (-1013.001) * (-1015.143) [-1013.911] (-1013.410) (-1012.607) -- 0:00:02
954500 -- (-1017.493) (-1013.607) [-1013.801] (-1015.197) * (-1012.795) (-1013.834) (-1014.544) [-1013.573] -- 0:00:02
955000 -- (-1017.812) [-1013.772] (-1014.305) (-1014.398) * (-1012.757) [-1014.072] (-1015.342) (-1014.835) -- 0:00:02
Average standard deviation of split frequencies: 0.007824
955500 -- (-1013.332) (-1015.383) (-1013.577) [-1016.164] * (-1015.318) [-1013.410] (-1015.449) (-1014.462) -- 0:00:02
956000 -- (-1014.541) (-1013.059) [-1015.696] (-1013.801) * (-1014.176) [-1014.835] (-1021.557) (-1022.971) -- 0:00:02
956500 -- (-1013.108) (-1015.470) (-1014.539) [-1014.652] * (-1016.012) (-1013.422) [-1018.772] (-1017.573) -- 0:00:02
957000 -- (-1013.456) (-1018.785) (-1014.736) [-1013.850] * [-1013.519] (-1016.323) (-1013.368) (-1017.760) -- 0:00:02
957500 -- (-1016.022) [-1014.779] (-1014.552) (-1014.277) * (-1015.477) [-1016.654] (-1014.998) (-1017.289) -- 0:00:02
958000 -- (-1015.462) [-1013.846] (-1016.004) (-1014.222) * [-1013.603] (-1020.108) (-1014.239) (-1015.554) -- 0:00:02
958500 -- (-1015.791) [-1013.718] (-1014.380) (-1016.864) * [-1013.967] (-1014.204) (-1013.139) (-1014.652) -- 0:00:02
959000 -- (-1013.595) (-1018.303) [-1013.784] (-1014.069) * (-1013.596) (-1013.670) [-1016.975] (-1017.661) -- 0:00:02
959500 -- (-1013.766) (-1014.433) (-1013.643) [-1016.320] * [-1014.586] (-1013.643) (-1014.742) (-1014.367) -- 0:00:02
960000 -- (-1013.616) [-1013.643] (-1015.946) (-1016.330) * (-1014.692) [-1015.282] (-1014.200) (-1016.192) -- 0:00:02
Average standard deviation of split frequencies: 0.007262
960500 -- (-1014.357) [-1014.292] (-1022.306) (-1012.463) * (-1012.946) [-1014.471] (-1013.544) (-1012.359) -- 0:00:02
961000 -- (-1013.854) (-1014.754) [-1014.862] (-1015.909) * [-1016.284] (-1013.532) (-1013.691) (-1014.494) -- 0:00:02
961500 -- (-1015.291) [-1015.437] (-1016.069) (-1012.875) * (-1015.174) (-1013.801) (-1013.088) [-1016.295] -- 0:00:02
962000 -- (-1014.420) [-1017.263] (-1014.943) (-1014.902) * (-1016.158) (-1012.762) (-1017.285) [-1016.650] -- 0:00:02
962500 -- (-1016.662) (-1015.697) [-1014.999] (-1013.481) * (-1014.054) (-1016.165) (-1014.616) [-1016.933] -- 0:00:02
963000 -- [-1016.032] (-1014.099) (-1016.034) (-1013.868) * (-1014.344) (-1013.499) (-1016.864) [-1016.411] -- 0:00:02
963500 -- (-1016.357) (-1014.290) [-1013.080] (-1014.247) * (-1015.597) [-1013.607] (-1014.570) (-1017.130) -- 0:00:02
964000 -- [-1013.498] (-1018.752) (-1013.498) (-1012.921) * (-1015.277) [-1013.849] (-1013.164) (-1017.640) -- 0:00:02
964500 -- [-1014.855] (-1013.553) (-1015.595) (-1012.871) * (-1016.443) (-1015.627) [-1016.210] (-1015.023) -- 0:00:02
965000 -- (-1015.266) (-1013.532) (-1014.756) [-1015.071] * (-1015.115) [-1015.396] (-1018.132) (-1015.865) -- 0:00:02
Average standard deviation of split frequencies: 0.007352
965500 -- (-1014.479) (-1015.274) [-1014.302] (-1015.119) * (-1014.425) [-1016.363] (-1016.384) (-1017.051) -- 0:00:02
966000 -- (-1013.346) (-1015.215) [-1013.913] (-1015.132) * [-1015.244] (-1015.770) (-1019.918) (-1014.935) -- 0:00:02
966500 -- (-1013.994) (-1015.403) [-1013.933] (-1014.769) * [-1014.689] (-1015.797) (-1018.386) (-1015.833) -- 0:00:02
967000 -- (-1013.413) (-1015.158) (-1013.488) [-1013.383] * [-1016.922] (-1018.867) (-1022.973) (-1013.712) -- 0:00:02
967500 -- (-1013.370) [-1015.889] (-1012.651) (-1014.969) * [-1013.708] (-1016.506) (-1014.358) (-1015.827) -- 0:00:02
968000 -- (-1012.609) (-1014.694) [-1013.946] (-1012.996) * (-1016.847) (-1016.223) [-1013.385] (-1014.633) -- 0:00:02
968500 -- (-1013.063) [-1013.968] (-1013.144) (-1014.704) * [-1013.808] (-1016.386) (-1013.842) (-1014.283) -- 0:00:02
969000 -- (-1013.447) (-1016.057) [-1014.118] (-1015.581) * (-1018.701) (-1013.908) [-1014.433] (-1014.798) -- 0:00:02
969500 -- (-1014.103) [-1016.943] (-1014.705) (-1015.006) * (-1016.179) (-1016.046) [-1013.739] (-1013.301) -- 0:00:01
970000 -- (-1017.370) (-1015.696) (-1017.065) [-1013.396] * (-1015.123) (-1020.176) [-1018.151] (-1013.459) -- 0:00:01
Average standard deviation of split frequencies: 0.007576
970500 -- (-1017.935) [-1013.798] (-1015.966) (-1014.125) * [-1012.945] (-1013.866) (-1013.535) (-1013.338) -- 0:00:01
971000 -- (-1014.540) [-1014.648] (-1013.874) (-1014.750) * [-1014.103] (-1017.673) (-1013.797) (-1015.732) -- 0:00:01
971500 -- (-1013.198) (-1016.564) [-1013.723] (-1016.817) * (-1015.769) (-1017.116) (-1014.644) [-1015.612] -- 0:00:01
972000 -- (-1017.903) (-1014.094) [-1012.831] (-1013.011) * (-1015.852) (-1015.553) (-1015.154) [-1012.413] -- 0:00:01
972500 -- (-1015.582) [-1012.602] (-1014.380) (-1014.584) * (-1014.027) [-1017.526] (-1015.092) (-1016.444) -- 0:00:01
973000 -- [-1014.182] (-1015.740) (-1013.889) (-1013.693) * [-1012.714] (-1014.667) (-1014.677) (-1017.805) -- 0:00:01
973500 -- (-1019.233) [-1013.365] (-1014.809) (-1013.757) * (-1017.369) (-1016.281) (-1013.500) [-1014.530] -- 0:00:01
974000 -- [-1015.327] (-1013.273) (-1016.080) (-1019.421) * (-1013.648) (-1015.353) (-1017.161) [-1014.428] -- 0:00:01
974500 -- (-1013.233) [-1016.364] (-1014.333) (-1013.909) * [-1014.281] (-1014.244) (-1017.297) (-1012.543) -- 0:00:01
975000 -- [-1013.987] (-1014.791) (-1014.874) (-1016.164) * [-1016.336] (-1014.321) (-1016.908) (-1013.292) -- 0:00:01
Average standard deviation of split frequencies: 0.007631
975500 -- (-1014.751) (-1014.364) [-1013.651] (-1013.399) * (-1016.327) (-1013.283) [-1015.240] (-1013.705) -- 0:00:01
976000 -- (-1014.941) (-1013.340) [-1015.787] (-1018.546) * (-1014.199) (-1014.838) [-1015.705] (-1014.056) -- 0:00:01
976500 -- (-1014.526) (-1014.711) [-1014.048] (-1016.055) * (-1014.454) (-1029.044) (-1015.538) [-1016.032] -- 0:00:01
977000 -- (-1014.572) [-1015.695] (-1015.503) (-1014.313) * (-1013.355) (-1017.739) (-1015.353) [-1015.592] -- 0:00:01
977500 -- (-1013.666) [-1013.753] (-1016.098) (-1014.627) * (-1015.566) (-1016.565) (-1013.225) [-1013.955] -- 0:00:01
978000 -- (-1015.072) (-1012.509) (-1019.129) [-1013.589] * [-1013.096] (-1015.339) (-1015.547) (-1012.921) -- 0:00:01
978500 -- [-1018.348] (-1016.960) (-1017.152) (-1012.682) * (-1013.040) [-1013.113] (-1013.199) (-1012.762) -- 0:00:01
979000 -- (-1016.232) (-1013.257) [-1012.521] (-1013.736) * [-1012.607] (-1012.745) (-1013.172) (-1012.989) -- 0:00:01
979500 -- (-1014.041) (-1013.521) [-1013.841] (-1015.744) * [-1012.482] (-1012.979) (-1014.163) (-1013.001) -- 0:00:01
980000 -- (-1018.575) [-1014.342] (-1015.558) (-1015.849) * (-1012.698) (-1013.425) (-1013.016) [-1013.111] -- 0:00:01
Average standard deviation of split frequencies: 0.007467
980500 -- (-1014.395) [-1012.843] (-1014.620) (-1015.685) * [-1014.473] (-1016.661) (-1013.695) (-1013.086) -- 0:00:01
981000 -- [-1013.896] (-1012.547) (-1017.084) (-1017.795) * (-1014.859) (-1016.438) (-1013.270) [-1013.539] -- 0:00:01
981500 -- (-1018.897) [-1012.818] (-1019.850) (-1016.724) * (-1013.683) (-1016.336) [-1014.742] (-1013.617) -- 0:00:01
982000 -- (-1014.058) (-1020.255) [-1014.415] (-1017.713) * (-1013.068) (-1017.980) (-1015.707) [-1014.987] -- 0:00:01
982500 -- (-1016.806) [-1017.098] (-1016.404) (-1014.795) * (-1014.551) (-1016.645) (-1014.745) [-1016.050] -- 0:00:01
983000 -- (-1013.023) [-1015.296] (-1016.466) (-1013.950) * (-1013.553) (-1019.039) [-1012.624] (-1015.237) -- 0:00:01
983500 -- (-1013.904) (-1014.858) [-1019.194] (-1014.944) * (-1015.790) (-1016.083) [-1013.026] (-1021.005) -- 0:00:01
984000 -- [-1013.233] (-1014.799) (-1012.799) (-1018.289) * (-1013.629) [-1015.967] (-1013.671) (-1014.877) -- 0:00:01
984500 -- (-1013.093) (-1014.992) (-1014.262) [-1015.175] * [-1014.095] (-1014.868) (-1013.971) (-1014.217) -- 0:00:01
985000 -- [-1013.922] (-1014.360) (-1014.351) (-1015.506) * (-1013.803) [-1017.941] (-1015.949) (-1014.493) -- 0:00:00
Average standard deviation of split frequencies: 0.007140
985500 -- (-1013.818) [-1013.048] (-1014.708) (-1017.220) * (-1019.032) (-1014.603) (-1014.198) [-1012.381] -- 0:00:00
986000 -- [-1012.865] (-1014.800) (-1015.443) (-1014.543) * (-1018.036) (-1013.732) [-1015.095] (-1017.650) -- 0:00:00
986500 -- (-1014.313) (-1015.220) [-1016.349] (-1013.050) * (-1021.457) (-1014.045) [-1013.214] (-1015.502) -- 0:00:00
987000 -- (-1015.560) (-1014.608) [-1013.385] (-1013.798) * (-1014.914) (-1014.695) (-1016.709) [-1014.586] -- 0:00:00
987500 -- (-1015.267) (-1013.243) [-1014.950] (-1014.097) * (-1013.006) (-1017.884) (-1012.848) [-1013.135] -- 0:00:00
988000 -- (-1017.750) (-1017.353) (-1014.415) [-1013.434] * [-1015.071] (-1013.125) (-1014.607) (-1014.083) -- 0:00:00
988500 -- [-1014.594] (-1016.486) (-1016.389) (-1014.643) * (-1015.169) (-1014.153) [-1015.768] (-1015.462) -- 0:00:00
989000 -- (-1014.658) (-1014.504) [-1019.194] (-1014.236) * (-1015.954) [-1015.062] (-1014.114) (-1012.898) -- 0:00:00
989500 -- (-1014.020) (-1017.891) [-1017.333] (-1013.746) * (-1015.321) [-1016.231] (-1016.031) (-1014.364) -- 0:00:00
990000 -- (-1013.892) (-1015.139) [-1015.796] (-1014.224) * (-1017.338) (-1013.719) (-1012.742) [-1013.303] -- 0:00:00
Average standard deviation of split frequencies: 0.007296
990500 -- (-1015.487) (-1015.711) (-1017.155) [-1015.614] * (-1018.204) (-1014.959) (-1013.067) [-1016.202] -- 0:00:00
991000 -- (-1016.757) (-1016.618) [-1015.027] (-1020.528) * (-1017.511) (-1015.151) (-1012.815) [-1013.109] -- 0:00:00
991500 -- (-1013.910) (-1016.732) [-1015.384] (-1014.919) * (-1016.170) (-1016.290) [-1013.755] (-1014.179) -- 0:00:00
992000 -- [-1015.745] (-1012.910) (-1013.298) (-1014.045) * [-1013.800] (-1015.275) (-1013.255) (-1014.315) -- 0:00:00
992500 -- (-1014.965) [-1012.914] (-1015.003) (-1019.545) * (-1015.036) (-1015.669) [-1013.084] (-1014.294) -- 0:00:00
993000 -- (-1015.177) (-1013.440) [-1015.808] (-1018.648) * (-1013.208) (-1016.405) (-1015.063) [-1014.108] -- 0:00:00
993500 -- [-1013.932] (-1012.931) (-1013.812) (-1015.036) * (-1012.517) (-1016.600) [-1022.213] (-1013.637) -- 0:00:00
994000 -- [-1012.790] (-1013.545) (-1014.540) (-1013.106) * (-1013.713) (-1015.988) (-1016.597) [-1012.465] -- 0:00:00
994500 -- [-1013.834] (-1018.328) (-1013.720) (-1012.771) * (-1013.575) [-1012.555] (-1014.718) (-1012.296) -- 0:00:00
995000 -- (-1016.227) (-1015.265) [-1014.364] (-1014.210) * [-1012.942] (-1013.126) (-1015.054) (-1012.297) -- 0:00:00
Average standard deviation of split frequencies: 0.007383
995500 -- [-1013.910] (-1014.643) (-1016.264) (-1016.384) * (-1014.370) [-1015.716] (-1014.486) (-1013.101) -- 0:00:00
996000 -- (-1015.039) [-1013.477] (-1018.327) (-1014.325) * [-1015.161] (-1013.673) (-1017.176) (-1016.253) -- 0:00:00
996500 -- (-1014.089) (-1014.686) (-1016.009) [-1013.998] * (-1017.512) [-1012.779] (-1013.687) (-1013.943) -- 0:00:00
997000 -- (-1014.410) (-1017.056) [-1013.190] (-1015.017) * (-1015.582) [-1012.469] (-1012.735) (-1015.125) -- 0:00:00
997500 -- [-1014.201] (-1017.232) (-1015.229) (-1015.182) * (-1014.356) (-1014.925) (-1016.762) [-1016.016] -- 0:00:00
998000 -- [-1013.819] (-1013.436) (-1015.379) (-1015.398) * (-1018.164) (-1014.922) (-1013.759) [-1015.445] -- 0:00:00
998500 -- (-1015.161) [-1014.455] (-1018.788) (-1013.464) * [-1014.511] (-1014.993) (-1014.499) (-1017.039) -- 0:00:00
999000 -- (-1015.703) (-1014.758) [-1018.859] (-1013.352) * [-1014.513] (-1016.496) (-1013.560) (-1016.045) -- 0:00:00
999500 -- (-1015.720) (-1016.884) [-1014.859] (-1015.722) * (-1015.210) (-1016.128) [-1013.231] (-1013.664) -- 0:00:00
1000000 -- (-1013.360) [-1018.543] (-1015.568) (-1015.122) * [-1014.700] (-1015.027) (-1013.440) (-1012.803) -- 0:00:00
Average standard deviation of split frequencies: 0.007443
Analysis completed in 1 mins 5 seconds
Analysis used 63.77 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1012.21
Likelihood of best state for "cold" chain of run 2 was -1012.21
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 74 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
27.1 % ( 24 %) Dirichlet(Pi{all})
29.2 % ( 25 %) Slider(Pi{all})
78.9 % ( 64 %) Multiplier(Alpha{1,2})
77.9 % ( 64 %) Multiplier(Alpha{3})
21.1 % ( 30 %) Slider(Pinvar{all})
98.7 % ( 98 %) ExtSPR(Tau{all},V{all})
70.0 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.7 % ( 93 %) ParsSPR(Tau{all},V{all})
28.1 % ( 27 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.5 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.4 % ( 74 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
28.0 % ( 33 %) Dirichlet(Pi{all})
29.4 % ( 25 %) Slider(Pi{all})
79.0 % ( 49 %) Multiplier(Alpha{1,2})
77.9 % ( 56 %) Multiplier(Alpha{3})
21.0 % ( 24 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.2 % ( 66 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 88 %) ParsSPR(Tau{all},V{all})
28.2 % ( 21 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.4 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.49
2 | 167105 0.82 0.67
3 | 165935 165854 0.83
4 | 167304 167091 166711
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166402 0.82 0.67
3 | 166999 166884 0.84
4 | 166729 166334 166652
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1013.89
| 1 2 |
| 2 |
| 1 12 21 1 2 2 |
| 2 1 1 2 2 1 12 1 1 1 |
| 22 1 1 2 212 2 2 21 2 2 |
|2 11 2 1 1 1 1 2 2 21 22 1 12|
| 1 22 22 1 2 1 211 1 2 2 1 |
|1 1 2 1 2 1 |
| * 21 2 211 12 1 1 11 1 1 1 1 2 |
| 22 * 2 1 2 2 1 2 2 2 1|
| 2 2 212 2 |
| 1 1 1 |
| 2 |
| 2 1 |
| 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1015.68
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1013.94 -1017.51
2 -1013.91 -1016.98
--------------------------------------
TOTAL -1013.93 -1017.28
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894533 0.088077 0.380438 1.485567 0.862434 1427.60 1455.70 1.000
r(A<->C){all} 0.168308 0.020530 0.000163 0.468959 0.134348 223.51 314.42 1.002
r(A<->G){all} 0.163213 0.019852 0.000116 0.443303 0.123767 90.13 227.60 1.002
r(A<->T){all} 0.158229 0.018722 0.000015 0.426112 0.122208 115.65 205.24 1.005
r(C<->G){all} 0.171803 0.019783 0.000094 0.457705 0.138501 195.54 204.68 1.005
r(C<->T){all} 0.176929 0.021904 0.000126 0.469276 0.137723 197.35 249.44 1.000
r(G<->T){all} 0.161519 0.018401 0.000030 0.445547 0.124672 166.94 190.11 1.000
pi(A){all} 0.194434 0.000205 0.164416 0.220746 0.194244 1224.75 1292.69 1.000
pi(C){all} 0.305094 0.000285 0.272260 0.337951 0.305271 1073.75 1212.52 1.000
pi(G){all} 0.318106 0.000275 0.284874 0.348482 0.318069 1230.32 1267.09 1.000
pi(T){all} 0.182366 0.000198 0.155661 0.209723 0.182517 1277.92 1352.30 1.000
alpha{1,2} 0.423614 0.234739 0.000146 1.388243 0.264944 1293.17 1327.20 1.000
alpha{3} 0.458522 0.253838 0.000249 1.409712 0.301136 1265.90 1334.85 1.000
pinvar{all} 0.997898 0.000007 0.993232 0.999998 0.998722 1401.36 1410.05 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*...*
8 -- ..****
9 -- ...**.
10 -- ..*..*
11 -- .***.*
12 -- .**.**
13 -- .*.***
14 -- .****.
15 -- ..**..
16 -- .**...
17 -- ..*.*.
18 -- .*.*..
19 -- ...*.*
20 -- ....**
21 -- .*..*.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 456 0.151899 0.011306 0.143904 0.159893 2
8 450 0.149900 0.007537 0.144570 0.155230 2
9 448 0.149234 0.013191 0.139907 0.158561 2
10 440 0.146569 0.008480 0.140573 0.152565 2
11 438 0.145903 0.010364 0.138574 0.153231 2
12 435 0.144903 0.005182 0.141239 0.148568 2
13 432 0.143904 0.004711 0.140573 0.147235 2
14 431 0.143571 0.001413 0.142572 0.144570 2
15 429 0.142905 0.000471 0.142572 0.143238 2
16 423 0.140906 0.000471 0.140573 0.141239 2
17 420 0.139907 0.010364 0.132578 0.147235 2
18 419 0.139574 0.016488 0.127915 0.151233 2
19 415 0.138241 0.008009 0.132578 0.143904 2
20 415 0.138241 0.006124 0.133911 0.142572 2
21 398 0.132578 0.007537 0.127249 0.137908 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100197 0.010178 0.000047 0.310418 0.068714 1.000 2
length{all}[2] 0.101224 0.010255 0.000017 0.300662 0.068671 1.000 2
length{all}[3] 0.096885 0.009291 0.000036 0.287079 0.065510 1.000 2
length{all}[4] 0.095650 0.008810 0.000051 0.278272 0.067581 1.000 2
length{all}[5] 0.095684 0.009517 0.000100 0.288285 0.066448 1.000 2
length{all}[6] 0.100124 0.010173 0.000027 0.298283 0.069514 1.000 2
length{all}[7] 0.098208 0.010315 0.000411 0.287345 0.069078 1.000 2
length{all}[8] 0.099153 0.008696 0.000141 0.280579 0.072948 0.999 2
length{all}[9] 0.101183 0.009056 0.000200 0.309603 0.071384 1.000 2
length{all}[10] 0.103393 0.013443 0.000014 0.297302 0.067947 1.000 2
length{all}[11] 0.104009 0.012942 0.000535 0.295473 0.069432 1.001 2
length{all}[12] 0.098290 0.010338 0.000110 0.304154 0.064240 1.010 2
length{all}[13] 0.101831 0.010057 0.000445 0.306951 0.073275 1.001 2
length{all}[14] 0.099745 0.008809 0.000197 0.313845 0.074343 0.999 2
length{all}[15] 0.098687 0.008072 0.000001 0.270744 0.071272 1.001 2
length{all}[16] 0.103846 0.010490 0.000336 0.310292 0.071817 0.998 2
length{all}[17] 0.104092 0.009853 0.000020 0.288685 0.073608 0.998 2
length{all}[18] 0.109213 0.009766 0.000095 0.315999 0.079481 1.000 2
length{all}[19] 0.107292 0.011521 0.000190 0.326568 0.067666 0.998 2
length{all}[20] 0.100009 0.010363 0.000078 0.302498 0.068206 0.998 2
length{all}[21] 0.101666 0.011299 0.000252 0.330917 0.065486 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007443
Maximum standard deviation of split frequencies = 0.016488
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.010
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|-------------------------------------------------------------------- C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 747
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 54 patterns at 249 / 249 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 54 patterns at 249 / 249 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
52704 bytes for conP
4752 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.089996 0.033979 0.023015 0.109644 0.042680 0.014297 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1063.382361
Iterating by ming2
Initial: fx= 1063.382361
x= 0.09000 0.03398 0.02301 0.10964 0.04268 0.01430 0.30000 1.30000
1 h-m-p 0.0000 0.0001 597.3490 ++ 1042.588892 m 0.0001 13 | 1/8
2 h-m-p 0.0006 0.0080 54.9848 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 545.9758 ++ 1031.982450 m 0.0000 44 | 2/8
4 h-m-p 0.0004 0.0104 44.2746 ----------.. | 2/8
5 h-m-p 0.0000 0.0000 488.2834 ++ 1021.288443 m 0.0000 74 | 3/8
6 h-m-p 0.0005 0.0132 35.3778 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 422.8000 ++ 1014.916460 m 0.0000 105 | 4/8
8 h-m-p 0.0005 0.0168 27.0966 -----------.. | 4/8
9 h-m-p 0.0000 0.0002 344.5348 +++ 991.617438 m 0.0002 137 | 5/8
10 h-m-p 0.0028 0.0313 16.7721 ------------.. | 5/8
11 h-m-p 0.0000 0.0001 245.3412 ++ 986.705336 m 0.0001 169 | 6/8
12 h-m-p 0.3932 8.0000 0.0000 +++ 986.705336 m 8.0000 181 | 6/8
13 h-m-p 0.1439 8.0000 0.0003 ----C 986.705336 0 0.0002 198 | 6/8
14 h-m-p 0.0160 8.0000 0.0018 +++++ 986.705336 m 8.0000 214 | 6/8
15 h-m-p 0.0051 0.1164 2.7707 ---------C 986.705336 0 0.0000 236 | 6/8
16 h-m-p 0.9617 8.0000 0.0000 --------------C 986.705336 0 0.0000 261 | 6/8
17 h-m-p 0.0160 8.0000 0.0000 +++++ 986.705336 m 8.0000 277 | 6/8
18 h-m-p 0.0153 7.6351 1.7298 +++++ 986.705299 m 7.6351 293 | 6/8
19 h-m-p -0.0000 -0.0000 0.0184
h-m-p: -5.22649908e-15 -2.61324954e-14 1.84425966e-02 986.705299
.. | 6/8
20 h-m-p 0.0160 8.0000 0.0000 +++++ 986.705299 m 8.0000 317 | 6/8
21 h-m-p 0.0160 8.0000 0.1958 +++++ 986.705284 m 8.0000 333 | 6/8
22 h-m-p 1.6000 8.0000 0.8022 ++ 986.705271 m 8.0000 346 | 6/8
23 h-m-p 1.6000 8.0000 1.0257 ++ 986.705268 m 8.0000 359 | 6/8
24 h-m-p 1.6000 8.0000 0.8609 ++ 986.705266 m 8.0000 370 | 6/8
25 h-m-p 0.3068 1.5342 15.0413 ---------Y 986.705266 0 0.0000 392 | 6/8
26 h-m-p 0.4727 8.0000 0.0000 +++ 986.705266 m 8.0000 404 | 6/8
27 h-m-p 0.7178 8.0000 0.0001 ++ 986.705266 m 8.0000 417 | 6/8
28 h-m-p 0.0160 8.0000 0.0887 -------------.. | 6/8
29 h-m-p 0.0160 8.0000 0.0000 -C 986.705266 0 0.0010 455
Out..
lnL = -986.705266
456 lfun, 456 eigenQcodon, 2736 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.094611 0.018273 0.027046 0.071641 0.105200 0.103508 23.073434 0.851650 0.241025
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 1.287250
np = 9
lnL0 = -1086.947613
Iterating by ming2
Initial: fx= 1086.947613
x= 0.09461 0.01827 0.02705 0.07164 0.10520 0.10351 23.07343 0.85165 0.24103
1 h-m-p 0.0000 0.0001 564.1380 ++ 1062.169272 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0001 452.2482 ++ 1051.480629 m 0.0001 26 | 2/9
3 h-m-p 0.0000 0.0002 512.8306 ++ 1011.380518 m 0.0002 38 | 3/9
4 h-m-p 0.0001 0.0004 358.6154 ++ 994.335933 m 0.0004 50 | 3/9
5 h-m-p 0.0001 0.0003 23.6389 ---------.. | 3/9
6 h-m-p 0.0000 0.0000 427.3190 ++ 989.739955 m 0.0000 81 | 4/9
7 h-m-p 0.0000 0.0000 20.5065 ++ 989.739901 m 0.0000 93 | 4/9
8 h-m-p -0.0000 -0.0000 20.3573
h-m-p: -0.00000000e+00 -0.00000000e+00 2.03572790e+01 989.739901
.. | 4/9
9 h-m-p 0.0000 0.0000 352.9855 ++ 986.971837 m 0.0000 114 | 5/9
10 h-m-p 0.0003 0.0014 18.2203 ++ 986.705470 m 0.0014 126 | 6/9
11 h-m-p 1.6000 8.0000 0.0005 ++ 986.705468 m 8.0000 138 | 6/9
12 h-m-p 0.0223 4.5364 0.1918 ++++ 986.705355 m 4.5364 155 | 7/9
13 h-m-p 1.6000 8.0000 0.0000 ------C 986.705355 0 0.0001 176 | 7/9
14 h-m-p 0.0160 8.0000 0.0000 ----N 986.705355 0 0.0000 194
Out..
lnL = -986.705355
195 lfun, 585 eigenQcodon, 2340 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.104154 0.038747 0.020851 0.109719 0.092829 0.034641 23.073140 1.192567 0.202758 0.410099 16.717191
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.257537
np = 11
lnL0 = -1047.018891
Iterating by ming2
Initial: fx= 1047.018891
x= 0.10415 0.03875 0.02085 0.10972 0.09283 0.03464 23.07314 1.19257 0.20276 0.41010 16.71719
1 h-m-p 0.0000 0.0002 248.3415 +++ 1033.690013 m 0.0002 17 | 1/11
2 h-m-p 0.0011 0.0110 39.7985 ++ 1015.547801 m 0.0110 31 | 2/11
3 h-m-p 0.0000 0.0002 162.3751 ++ 1013.402036 m 0.0002 45 | 3/11
4 h-m-p 0.0000 0.0002 128.1654 ++ 1012.919886 m 0.0002 59 | 4/11
5 h-m-p 0.0000 0.0009 819.9728 +++ 992.100109 m 0.0009 74 | 5/11
6 h-m-p 0.0009 0.0045 12.3963 ++ 991.859613 m 0.0045 88 | 6/11
7 h-m-p 0.0129 6.4291 15.3497 -------------.. | 6/11
8 h-m-p 0.0000 0.0001 222.1752 ++ 986.705288 m 0.0001 127 | 7/11
9 h-m-p 1.6000 8.0000 0.0000 ++ 986.705288 m 8.0000 141 | 7/11
10 h-m-p 0.0542 8.0000 0.0005 ++++ 986.705288 m 8.0000 161 | 7/11
11 h-m-p 0.0160 8.0000 0.9634 +++Y 986.705285 0 1.8348 182 | 7/11
12 h-m-p 1.6000 8.0000 0.1975 C 986.705285 0 1.6000 200 | 7/11
13 h-m-p 1.6000 8.0000 0.0127 Y 986.705285 0 0.8970 218 | 7/11
14 h-m-p 1.6000 8.0000 0.0009 ++ 986.705285 m 8.0000 236 | 7/11
15 h-m-p 1.6000 8.0000 0.0019 ++ 986.705285 m 8.0000 254 | 7/11
16 h-m-p 0.9442 8.0000 0.0164 +Y 986.705285 0 4.8560 273 | 7/11
17 h-m-p 1.6000 8.0000 0.0028 ++ 986.705285 m 8.0000 291 | 7/11
18 h-m-p 0.0160 8.0000 6.4908 ++++Y 986.705265 0 5.9104 313 | 7/11
19 h-m-p 1.6000 8.0000 2.6866 ++ 986.705259 m 8.0000 327 | 7/11
20 h-m-p 1.6000 8.0000 1.3809 ++ 986.705259 m 8.0000 341 | 7/11
21 h-m-p 1.6000 8.0000 3.0332 ++ 986.705258 m 8.0000 355 | 7/11
22 h-m-p 1.1893 8.0000 20.4034 ++ 986.705257 m 8.0000 369 | 7/11
23 h-m-p 1.2221 6.1105 44.8669 C 986.705257 0 0.3055 383 | 7/11
24 h-m-p 0.5948 8.0000 23.0474 ++ 986.705256 m 8.0000 397 | 7/11
25 h-m-p 1.6000 8.0000 38.6681 C 986.705256 0 1.6000 411 | 7/11
26 h-m-p 1.6000 8.0000 37.7974 +C 986.705256 0 6.2985 426 | 7/11
27 h-m-p 0.0819 0.4093 932.3627 -----------Y 986.705256 0 0.0000 451 | 7/11
28 h-m-p 0.0024 1.1812 323.1190 ------------.. | 7/11
29 h-m-p 0.0160 8.0000 0.0000 Y 986.705256 0 0.0160 489 | 7/11
30 h-m-p 0.2394 8.0000 0.0000 -----------Y 986.705256 0 0.0000 518
Out..
lnL = -986.705256
519 lfun, 2076 eigenQcodon, 9342 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -986.699544 S = -986.699447 -0.000037
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:04
did 20 / 54 patterns 0:04
did 30 / 54 patterns 0:04
did 40 / 54 patterns 0:04
did 50 / 54 patterns 0:04
did 54 / 54 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.033737 0.080277 0.057734 0.025995 0.068520 0.022641 64.895669 0.418728 1.357605
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.567670
np = 9
lnL0 = -1056.383541
Iterating by ming2
Initial: fx= 1056.383541
x= 0.03374 0.08028 0.05773 0.02599 0.06852 0.02264 64.89567 0.41873 1.35761
1 h-m-p 0.0000 0.0001 570.5279 ++ 1024.797632 m 0.0001 14 | 1/9
2 h-m-p 0.0032 0.0877 15.6084 ------------.. | 1/9
3 h-m-p 0.0000 0.0000 537.5010 ++ 1020.772108 m 0.0000 48 | 2/9
4 h-m-p 0.0006 0.1251 11.1252 -----------.. | 2/9
5 h-m-p 0.0000 0.0000 480.5665 ++ 1013.297653 m 0.0000 81 | 3/9
6 h-m-p 0.0016 0.1641 8.4745 -----------.. | 3/9
7 h-m-p 0.0000 0.0001 417.6165 ++ 995.385496 m 0.0001 114 | 4/9
8 h-m-p 0.0049 0.2506 7.0672 ------------.. | 4/9
9 h-m-p 0.0000 0.0000 349.6030 ++ 989.806695 m 0.0000 148 | 5/9
10 h-m-p 0.0014 0.3986 8.0752 -----------.. | 5/9
11 h-m-p 0.0000 0.0000 248.9906 ++ 986.705469 m 0.0000 181 | 6/9
12 h-m-p 0.4927 8.0000 0.0000 +++ 986.705469 m 8.0000 194 | 6/9
13 h-m-p 0.2169 8.0000 0.0002 +++ 986.705469 m 8.0000 210 | 6/9
14 h-m-p 0.0160 8.0000 0.5928 +++++ 986.705463 m 8.0000 228 | 6/9
15 h-m-p 1.6000 8.0000 0.3194 ++ 986.705463 m 8.0000 243 | 6/9
16 h-m-p 0.8980 8.0000 2.8450 ++ 986.705462 m 8.0000 258 | 6/9
17 h-m-p 1.1184 5.5922 5.5974 ----------------.. | 6/9
18 h-m-p 0.0160 8.0000 0.0000 +++++ 986.705462 m 8.0000 299 | 6/9
19 h-m-p 0.0160 8.0000 0.0031 -----Y 986.705462 0 0.0000 319 | 6/9
20 h-m-p 0.0160 8.0000 0.0005 ------N 986.705462 0 0.0000 340 | 6/9
21 h-m-p 0.0160 8.0000 0.0000 +++++ 986.705462 m 8.0000 358 | 6/9
22 h-m-p 0.0160 8.0000 0.1183 +++++ 986.705457 m 8.0000 376 | 6/9
23 h-m-p 0.0254 0.9424 37.2045 ++
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
+ 986.705355 m 0.9424 392
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77601, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
24 h-m-p -0.0000 -0.0000 0.0178
h-m-p: -1.35469664e-14 -6.77348322e-14 1.78081962e-02 986.705355
..
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77654, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77545, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
25 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
Y 986.705355 0 0.0160 416
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77654, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77545, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
26 h-m-p -0.0000 -0.0000 0.0069
h-m-p: -3.09425257e-11 -1.54712628e-10 6.93830362e-03 986.705355
..
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77654, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77545, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
27 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
Y 986.705355 0 0.0003 444
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -986.705355
445 lfun, 4895 eigenQcodon, 26700 P(t)
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.77600, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:12
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.054559 0.052873 0.037683 0.053395 0.034022 0.054269 56.078263 0.900000 0.294834 1.102306 14.956153
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.206773
np = 11
lnL0 = -1028.594830
Iterating by ming2
Initial: fx= 1028.594830
x= 0.05456 0.05287 0.03768 0.05339 0.03402 0.05427 56.07826 0.90000 0.29483 1.10231 14.95615
1 h-m-p 0.0000 0.0003 243.9942 +++ 1003.695173 m 0.0003 17 | 1/11
2 h-m-p 0.0011 0.0057 32.1553 +YYYYC 1000.446220 4 0.0045 36 | 1/11
3 h-m-p 0.0001 0.0007 140.5696 ++ 997.703378 m 0.0007 50 | 2/11
4 h-m-p 0.0000 0.0000 11093.4876 ++ 997.625485 m 0.0000 64 | 3/11
5 h-m-p 0.0000 0.0000 678.9957 ++ 997.123459 m 0.0000 78 | 4/11
6 h-m-p 0.0000 0.0000 2347.1481 ++ 997.010728 m 0.0000 92 | 5/11
7 h-m-p 0.0000 0.0002 281.7137 ++ 995.628740 m 0.0002 106 | 6/11
8 h-m-p 0.0160 8.0000 1.6859 -------------.. | 6/11
9 h-m-p 0.0000 0.0002 246.4988 +++ 986.705429 m 0.0002 146 | 7/11
10 h-m-p 1.6000 8.0000 0.0000 ++ 986.705429 m 8.0000 160 | 7/11
11 h-m-p 0.0160 8.0000 0.2586 +++++ 986.705279 m 8.0000 181 | 7/11
12 h-m-p 1.6000 8.0000 0.0507 ++ 986.705275 m 8.0000 199 | 7/11
13 h-m-p 0.3671 3.8559 1.1054 ++ 986.705262 m 3.8559 217 | 8/11
14 h-m-p 1.6000 8.0000 0.8936 ++ 986.705260 m 8.0000 231 | 8/11
15 h-m-p 0.1359 8.0000 52.6164 +++ 986.705256 m 8.0000 249 | 8/11
16 h-m-p 1.6000 8.0000 27.0239 ++ 986.705256 m 8.0000 263 | 8/11
17 h-m-p 0.0206 0.1031 3231.8308 ++ 986.705255 m 0.1031 277 | 9/11
18 h-m-p 1.6000 8.0000 0.0822 -----Y 986.705255 0 0.0004 296 | 9/11
19 h-m-p 0.0249 8.0000 0.0013 -------------.. | 9/11
20 h-m-p 0.0160 8.0000 0.0000 --------Y 986.705255 0 0.0000 347
Out..
lnL = -986.705255
348 lfun, 4176 eigenQcodon, 22968 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -986.699448 S = -986.699429 -0.000008
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:18
did 20 / 54 patterns 0:18
did 30 / 54 patterns 0:18
did 40 / 54 patterns 0:19
did 50 / 54 patterns 0:19
did 54 / 54 patterns 0:19
Time used: 0:19
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=249
NC_011896_1_WP_010908987_1_2784_MLBR_RS13250 MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
NC_002677_1_NP_302668_1_1540_ML2604 MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
NZ_LVXE01000045_1_WP_010908987_1_1933_A3216_RS10900 MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
NZ_LYPH01000051_1_WP_010908987_1_1942_A8144_RS09280 MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
NZ_CP029543_1_WP_010908987_1_2815_DIJ64_RS14330 MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
NZ_AP014567_1_WP_010908987_1_2883_JK2ML_RS14670 MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
**************************************************
NC_011896_1_WP_010908987_1_2784_MLBR_RS13250 VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
NC_002677_1_NP_302668_1_1540_ML2604 VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
NZ_LVXE01000045_1_WP_010908987_1_1933_A3216_RS10900 VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
NZ_LYPH01000051_1_WP_010908987_1_1942_A8144_RS09280 VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
NZ_CP029543_1_WP_010908987_1_2815_DIJ64_RS14330 VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
NZ_AP014567_1_WP_010908987_1_2883_JK2ML_RS14670 VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
**************************************************
NC_011896_1_WP_010908987_1_2784_MLBR_RS13250 FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
NC_002677_1_NP_302668_1_1540_ML2604 FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
NZ_LVXE01000045_1_WP_010908987_1_1933_A3216_RS10900 FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
NZ_LYPH01000051_1_WP_010908987_1_1942_A8144_RS09280 FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
NZ_CP029543_1_WP_010908987_1_2815_DIJ64_RS14330 FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
NZ_AP014567_1_WP_010908987_1_2883_JK2ML_RS14670 FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
**************************************************
NC_011896_1_WP_010908987_1_2784_MLBR_RS13250 QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
NC_002677_1_NP_302668_1_1540_ML2604 QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
NZ_LVXE01000045_1_WP_010908987_1_1933_A3216_RS10900 QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
NZ_LYPH01000051_1_WP_010908987_1_1942_A8144_RS09280 QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
NZ_CP029543_1_WP_010908987_1_2815_DIJ64_RS14330 QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
NZ_AP014567_1_WP_010908987_1_2883_JK2ML_RS14670 QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
**************************************************
NC_011896_1_WP_010908987_1_2784_MLBR_RS13250 ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
NC_002677_1_NP_302668_1_1540_ML2604 ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
NZ_LVXE01000045_1_WP_010908987_1_1933_A3216_RS10900 ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
NZ_LYPH01000051_1_WP_010908987_1_1942_A8144_RS09280 ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
NZ_CP029543_1_WP_010908987_1_2815_DIJ64_RS14330 ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
NZ_AP014567_1_WP_010908987_1_2883_JK2ML_RS14670 ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
*************************************************
>NC_011896_1_WP_010908987_1_2784_MLBR_RS13250 ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA >NC_002677_1_NP_302668_1_1540_ML2604 ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA >NZ_LVXE01000045_1_WP_010908987_1_1933_A3216_RS10900 ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA >NZ_LYPH01000051_1_WP_010908987_1_1942_A8144_RS09280 ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA >NZ_CP029543_1_WP_010908987_1_2815_DIJ64_RS14330 ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA >NZ_AP014567_1_WP_010908987_1_2883_JK2ML_RS14670 ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA
>NC_011896_1_WP_010908987_1_2784_MLBR_RS13250 MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR >NC_002677_1_NP_302668_1_1540_ML2604 MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR >NZ_LVXE01000045_1_WP_010908987_1_1933_A3216_RS10900 MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR >NZ_LYPH01000051_1_WP_010908987_1_1942_A8144_RS09280 MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR >NZ_CP029543_1_WP_010908987_1_2815_DIJ64_RS14330 MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR >NZ_AP014567_1_WP_010908987_1_2883_JK2ML_RS14670 MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
#NEXUS
[ID: 5247378630]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908987_1_2784_MLBR_RS13250
NC_002677_1_NP_302668_1_1540_ML2604
NZ_LVXE01000045_1_WP_010908987_1_1933_A3216_RS10900
NZ_LYPH01000051_1_WP_010908987_1_1942_A8144_RS09280
NZ_CP029543_1_WP_010908987_1_2815_DIJ64_RS14330
NZ_AP014567_1_WP_010908987_1_2883_JK2ML_RS14670
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908987_1_2784_MLBR_RS13250,
2 NC_002677_1_NP_302668_1_1540_ML2604,
3 NZ_LVXE01000045_1_WP_010908987_1_1933_A3216_RS10900,
4 NZ_LYPH01000051_1_WP_010908987_1_1942_A8144_RS09280,
5 NZ_CP029543_1_WP_010908987_1_2815_DIJ64_RS14330,
6 NZ_AP014567_1_WP_010908987_1_2883_JK2ML_RS14670
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06871379,2:0.06867138,3:0.06551015,4:0.0675812,5:0.06644836,6:0.06951378);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06871379,2:0.06867138,3:0.06551015,4:0.0675812,5:0.06644836,6:0.06951378);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1013.94 -1017.51
2 -1013.91 -1016.98
--------------------------------------
TOTAL -1013.93 -1017.28
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894533 0.088077 0.380438 1.485567 0.862434 1427.60 1455.70 1.000
r(A<->C){all} 0.168308 0.020530 0.000163 0.468959 0.134348 223.51 314.42 1.002
r(A<->G){all} 0.163213 0.019852 0.000116 0.443303 0.123767 90.13 227.60 1.002
r(A<->T){all} 0.158229 0.018722 0.000015 0.426112 0.122208 115.65 205.24 1.005
r(C<->G){all} 0.171803 0.019783 0.000094 0.457705 0.138501 195.54 204.68 1.005
r(C<->T){all} 0.176929 0.021904 0.000126 0.469276 0.137723 197.35 249.44 1.000
r(G<->T){all} 0.161519 0.018401 0.000030 0.445547 0.124672 166.94 190.11 1.000
pi(A){all} 0.194434 0.000205 0.164416 0.220746 0.194244 1224.75 1292.69 1.000
pi(C){all} 0.305094 0.000285 0.272260 0.337951 0.305271 1073.75 1212.52 1.000
pi(G){all} 0.318106 0.000275 0.284874 0.348482 0.318069 1230.32 1267.09 1.000
pi(T){all} 0.182366 0.000198 0.155661 0.209723 0.182517 1277.92 1352.30 1.000
alpha{1,2} 0.423614 0.234739 0.000146 1.388243 0.264944 1293.17 1327.20 1.000
alpha{3} 0.458522 0.253838 0.000249 1.409712 0.301136 1265.90 1334.85 1.000
pinvar{all} 0.997898 0.000007 0.993232 0.999998 0.998722 1401.36 1410.05 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2604/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 249
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 5 5 5 5 5 5 | Cys TGT 1 1 1 1 1 1
TTC 3 3 3 3 3 3 | TCC 0 0 0 0 0 0 | TAC 4 4 4 4 4 4 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 9 9 9 9 9 9 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 1 1 1 1 1 1 | His CAT 3 3 3 3 3 3 | Arg CGT 5 5 5 5 5 5
CTC 3 3 3 3 3 3 | CCC 2 2 2 2 2 2 | CAC 1 1 1 1 1 1 | CGC 7 7 7 7 7 7
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 2 2 2 2 2 2 | CGA 5 5 5 5 5 5
CTG 11 11 11 11 11 11 | CCG 2 2 2 2 2 2 | CAG 8 8 8 8 8 8 | CGG 7 7 7 7 7 7
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 6 6 6 6 6 6 | Asn AAT 2 2 2 2 2 2 | Ser AGT 1 1 1 1 1 1
ATC 8 8 8 8 8 8 | ACC 9 9 9 9 9 9 | AAC 6 6 6 6 6 6 | AGC 3 3 3 3 3 3
ATA 2 2 2 2 2 2 | ACA 3 3 3 3 3 3 | Lys AAA 1 1 1 1 1 1 | Arg AGA 2 2 2 2 2 2
Met ATG 5 5 5 5 5 5 | ACG 4 4 4 4 4 4 | AAG 2 2 2 2 2 2 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 9 9 9 9 9 9 | Asp GAT 4 4 4 4 4 4 | Gly GGT 3 3 3 3 3 3
GTC 2 2 2 2 2 2 | GCC 16 16 16 16 16 16 | GAC 11 11 11 11 11 11 | GGC 6 6 6 6 6 6
GTA 2 2 2 2 2 2 | GCA 8 8 8 8 8 8 | Glu GAA 3 3 3 3 3 3 | GGA 3 3 3 3 3 3
GTG 6 6 6 6 6 6 | GCG 18 18 18 18 18 18 | GAG 6 6 6 6 6 6 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908987_1_2784_MLBR_RS13250
position 1: T:0.13655 C:0.23293 A:0.22490 G:0.40562
position 2: T:0.21285 C:0.35743 A:0.23293 G:0.19679
position 3: T:0.19679 C:0.32530 A:0.12450 G:0.35341
Average T:0.18206 C:0.30522 A:0.19411 G:0.31861
#2: NC_002677_1_NP_302668_1_1540_ML2604
position 1: T:0.13655 C:0.23293 A:0.22490 G:0.40562
position 2: T:0.21285 C:0.35743 A:0.23293 G:0.19679
position 3: T:0.19679 C:0.32530 A:0.12450 G:0.35341
Average T:0.18206 C:0.30522 A:0.19411 G:0.31861
#3: NZ_LVXE01000045_1_WP_010908987_1_1933_A3216_RS10900
position 1: T:0.13655 C:0.23293 A:0.22490 G:0.40562
position 2: T:0.21285 C:0.35743 A:0.23293 G:0.19679
position 3: T:0.19679 C:0.32530 A:0.12450 G:0.35341
Average T:0.18206 C:0.30522 A:0.19411 G:0.31861
#4: NZ_LYPH01000051_1_WP_010908987_1_1942_A8144_RS09280
position 1: T:0.13655 C:0.23293 A:0.22490 G:0.40562
position 2: T:0.21285 C:0.35743 A:0.23293 G:0.19679
position 3: T:0.19679 C:0.32530 A:0.12450 G:0.35341
Average T:0.18206 C:0.30522 A:0.19411 G:0.31861
#5: NZ_CP029543_1_WP_010908987_1_2815_DIJ64_RS14330
position 1: T:0.13655 C:0.23293 A:0.22490 G:0.40562
position 2: T:0.21285 C:0.35743 A:0.23293 G:0.19679
position 3: T:0.19679 C:0.32530 A:0.12450 G:0.35341
Average T:0.18206 C:0.30522 A:0.19411 G:0.31861
#6: NZ_AP014567_1_WP_010908987_1_2883_JK2ML_RS14670
position 1: T:0.13655 C:0.23293 A:0.22490 G:0.40562
position 2: T:0.21285 C:0.35743 A:0.23293 G:0.19679
position 3: T:0.19679 C:0.32530 A:0.12450 G:0.35341
Average T:0.18206 C:0.30522 A:0.19411 G:0.31861
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 18 | Ser S TCT 12 | Tyr Y TAT 30 | Cys C TGT 6
TTC 18 | TCC 0 | TAC 24 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 54 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 6 | His H CAT 18 | Arg R CGT 30
CTC 18 | CCC 12 | CAC 6 | CGC 42
CTA 0 | CCA 0 | Gln Q CAA 12 | CGA 30
CTG 66 | CCG 12 | CAG 48 | CGG 42
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 36 | Asn N AAT 12 | Ser S AGT 6
ATC 48 | ACC 54 | AAC 36 | AGC 18
ATA 12 | ACA 18 | Lys K AAA 6 | Arg R AGA 12
Met M ATG 30 | ACG 24 | AAG 12 | AGG 0
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 54 | Asp D GAT 24 | Gly G GGT 18
GTC 12 | GCC 96 | GAC 66 | GGC 36
GTA 12 | GCA 48 | Glu E GAA 18 | GGA 18
GTG 36 | GCG 108 | GAG 36 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13655 C:0.23293 A:0.22490 G:0.40562
position 2: T:0.21285 C:0.35743 A:0.23293 G:0.19679
position 3: T:0.19679 C:0.32530 A:0.12450 G:0.35341
Average T:0.18206 C:0.30522 A:0.19411 G:0.31861
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -986.705266 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 23.073434 14.956153
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908987_1_2784_MLBR_RS13250: 0.000004, NC_002677_1_NP_302668_1_1540_ML2604: 0.000004, NZ_LVXE01000045_1_WP_010908987_1_1933_A3216_RS10900: 0.000004, NZ_LYPH01000051_1_WP_010908987_1_1942_A8144_RS09280: 0.000004, NZ_CP029543_1_WP_010908987_1_2815_DIJ64_RS14330: 0.000004, NZ_AP014567_1_WP_010908987_1_2883_JK2ML_RS14670: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 23.07343
omega (dN/dS) = 14.95615
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 521.6 225.4 14.9562 0.0000 0.0000 0.0 0.0
7..2 0.000 521.6 225.4 14.9562 0.0000 0.0000 0.0 0.0
7..3 0.000 521.6 225.4 14.9562 0.0000 0.0000 0.0 0.0
7..4 0.000 521.6 225.4 14.9562 0.0000 0.0000 0.0 0.0
7..5 0.000 521.6 225.4 14.9562 0.0000 0.0000 0.0 0.0
7..6 0.000 521.6 225.4 14.9562 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -986.705355 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 23.073140 0.000010 0.396534
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908987_1_2784_MLBR_RS13250: 0.000004, NC_002677_1_NP_302668_1_1540_ML2604: 0.000004, NZ_LVXE01000045_1_WP_010908987_1_1933_A3216_RS10900: 0.000004, NZ_LYPH01000051_1_WP_010908987_1_1942_A8144_RS09280: 0.000004, NZ_CP029543_1_WP_010908987_1_2815_DIJ64_RS14330: 0.000004, NZ_AP014567_1_WP_010908987_1_2883_JK2ML_RS14670: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 23.07314
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.39653 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 521.6 225.4 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 521.6 225.4 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 521.6 225.4 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 521.6 225.4 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 521.6 225.4 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 521.6 225.4 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -986.705256 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 64.895669 0.000000 0.765776 0.000001 619.023837
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908987_1_2784_MLBR_RS13250: 0.000004, NC_002677_1_NP_302668_1_1540_ML2604: 0.000004, NZ_LVXE01000045_1_WP_010908987_1_1933_A3216_RS10900: 0.000004, NZ_LYPH01000051_1_WP_010908987_1_1942_A8144_RS09280: 0.000004, NZ_CP029543_1_WP_010908987_1_2815_DIJ64_RS14330: 0.000004, NZ_AP014567_1_WP_010908987_1_2883_JK2ML_RS14670: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 64.89567
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.76578 0.23422
w: 0.00000 1.00000 619.02384
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 519.7 227.3 145.7561 0.0000 0.0000 0.0 0.0
7..2 0.000 519.7 227.3 145.7561 0.0000 0.0000 0.0 0.0
7..3 0.000 519.7 227.3 145.7561 0.0000 0.0000 0.0 0.0
7..4 0.000 519.7 227.3 145.7561 0.0000 0.0000 0.0 0.0
7..5 0.000 519.7 227.3 145.7561 0.0000 0.0000 0.0 0.0
7..6 0.000 519.7 227.3 145.7561 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908987_1_2784_MLBR_RS13250)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908987_1_2784_MLBR_RS13250)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -986.705355 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 56.078263 28.775997 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908987_1_2784_MLBR_RS13250: 0.000004, NC_002677_1_NP_302668_1_1540_ML2604: 0.000004, NZ_LVXE01000045_1_WP_010908987_1_1933_A3216_RS10900: 0.000004, NZ_LYPH01000051_1_WP_010908987_1_1942_A8144_RS09280: 0.000004, NZ_CP029543_1_WP_010908987_1_2815_DIJ64_RS14330: 0.000004, NZ_AP014567_1_WP_010908987_1_2883_JK2ML_RS14670: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 56.07826
Parameters in M7 (beta):
p = 28.77600 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 519.9 227.1 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 519.9 227.1 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 519.9 227.1 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 519.9 227.1 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 519.9 227.1 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 519.9 227.1 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:12
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -986.705255 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 55.677831 0.000010 0.005000 1.129436 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908987_1_2784_MLBR_RS13250: 0.000004, NC_002677_1_NP_302668_1_1540_ML2604: 0.000004, NZ_LVXE01000045_1_WP_010908987_1_1933_A3216_RS10900: 0.000004, NZ_LYPH01000051_1_WP_010908987_1_1942_A8144_RS09280: 0.000004, NZ_CP029543_1_WP_010908987_1_2815_DIJ64_RS14330: 0.000004, NZ_AP014567_1_WP_010908987_1_2883_JK2ML_RS14670: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 55.67783
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 1.12944
(p1 = 0.99999) w = 999.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 519.9 227.1 998.9900 0.0000 0.0000 0.0 0.0
7..2 0.000 519.9 227.1 998.9900 0.0000 0.0000 0.0 0.0
7..3 0.000 519.9 227.1 998.9900 0.0000 0.0000 0.0 0.0
7..4 0.000 519.9 227.1 998.9900 0.0000 0.0000 0.0 0.0
7..5 0.000 519.9 227.1 998.9900 0.0000 0.0000 0.0 0.0
7..6 0.000 519.9 227.1 998.9900 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908987_1_2784_MLBR_RS13250)
Pr(w>1) post mean +- SE for w
1 M 1.000** 998.990
2 T 1.000** 998.990
3 D 1.000** 998.990
4 N 1.000** 998.990
5 K 1.000** 998.990
6 M 1.000** 998.990
7 L 1.000** 998.990
8 A 1.000** 998.990
9 R 1.000** 998.990
10 I 1.000** 998.990
11 A 1.000** 998.990
12 A 1.000** 998.990
13 L 1.000** 998.990
14 L 1.000** 998.990
15 R 1.000** 998.990
16 Q 1.000** 998.990
17 A 1.000** 998.990
18 E 1.000** 998.990
19 G 1.000** 998.990
20 T 1.000** 998.990
21 D 1.000** 998.990
22 N 1.000** 998.990
23 A 1.000** 998.990
24 H 1.000** 998.990
25 E 1.000** 998.990
26 A 1.000** 998.990
27 D 1.000** 998.990
28 A 1.000** 998.990
29 F 1.000** 998.990
30 M 1.000** 998.990
31 A 1.000** 998.990
32 T 1.000** 998.990
33 A 1.000** 998.990
34 Q 1.000** 998.990
35 R 1.000** 998.990
36 L 1.000** 998.990
37 A 1.000** 998.990
38 T 1.000** 998.990
39 A 1.000** 998.990
40 A 1.000** 998.990
41 S 1.000** 998.990
42 I 1.000** 998.990
43 D 1.000** 998.990
44 L 1.000** 998.990
45 A 1.000** 998.990
46 V 1.000** 998.990
47 A 1.000** 998.990
48 R 1.000** 998.990
49 S 1.000** 998.990
50 H 1.000** 998.990
51 V 1.000** 998.990
52 A 1.000** 998.990
53 N 1.000** 998.990
54 R 1.000** 998.990
55 S 1.000** 998.990
56 T 1.000** 998.990
57 A 1.000** 998.990
58 Q 1.000** 998.990
59 A 1.000** 998.990
60 P 1.000** 998.990
61 T 1.000** 998.990
62 Q 1.000** 998.990
63 R 1.000** 998.990
64 T 1.000** 998.990
65 I 1.000** 998.990
66 T 1.000** 998.990
67 I 1.000** 998.990
68 G 1.000** 998.990
69 T 1.000** 998.990
70 A 1.000** 998.990
71 G 1.000** 998.990
72 T 1.000** 998.990
73 R 1.000** 998.990
74 G 1.000** 998.990
75 L 1.000** 998.990
76 R 1.000** 998.990
77 T 1.000** 998.990
78 Y 1.000** 998.990
79 V 1.000** 998.990
80 Q 1.000** 998.990
81 L 1.000** 998.990
82 F 1.000** 998.990
83 V 1.000** 998.990
84 L 1.000** 998.990
85 I 1.000** 998.990
86 A 1.000** 998.990
87 A 1.000** 998.990
88 A 1.000** 998.990
89 N 1.000** 998.990
90 D 1.000** 998.990
91 V 1.000** 998.990
92 R 1.000** 998.990
93 C 1.000** 998.990
94 D 1.000** 998.990
95 V 1.000** 998.990
96 A 1.000** 998.990
97 S 1.000** 998.990
98 N 1.000** 998.990
99 S 1.000** 998.990
100 T 1.000** 998.990
101 F 1.000** 998.990
102 L 1.000** 998.990
103 Y 1.000** 998.990
104 A 1.000** 998.990
105 Y 1.000** 998.990
106 G 1.000** 998.990
107 F 1.000** 998.990
108 A 1.000** 998.990
109 E 1.000** 998.990
110 D 1.000** 998.990
111 I 1.000** 998.990
112 D 1.000** 998.990
113 A 1.000** 998.990
114 T 1.000** 998.990
115 H 1.000** 998.990
116 A 1.000** 998.990
117 L 1.000** 998.990
118 Y 1.000** 998.990
119 A 1.000** 998.990
120 S 1.000** 998.990
121 L 1.000** 998.990
122 V 1.000** 998.990
123 V 1.000** 998.990
124 Q 1.000** 998.990
125 M 1.000** 998.990
126 V 1.000** 998.990
127 R 1.000** 998.990
128 E 1.000** 998.990
129 S 1.000** 998.990
130 D 1.000** 998.990
131 A 1.000** 998.990
132 Y 1.000** 998.990
133 L 1.000** 998.990
134 A 1.000** 998.990
135 S 1.000** 998.990
136 G 1.000** 998.990
137 A 1.000** 998.990
138 Y 1.000** 998.990
139 R 1.000** 998.990
140 P 1.000** 998.990
141 T 1.000** 998.990
142 P 1.000** 998.990
143 T 1.000** 998.990
144 I 1.000** 998.990
145 T 1.000** 998.990
146 A 1.000** 998.990
147 R 1.000** 998.990
148 L 1.000** 998.990
149 N 1.000** 998.990
150 F 1.000** 998.990
151 Q 1.000** 998.990
152 L 1.000** 998.990
153 G 1.000** 998.990
154 F 1.000** 998.990
155 G 1.000** 998.990
156 M 1.000** 998.990
157 R 1.000** 998.990
158 V 1.000** 998.990
159 G 1.000** 998.990
160 Q 1.000** 998.990
161 R 1.000** 998.990
162 L 1.000** 998.990
163 T 1.000** 998.990
164 E 1.000** 998.990
165 A 1.000** 998.990
166 R 1.000** 998.990
167 D 1.000** 998.990
168 H 1.000** 998.990
169 I 1.000** 998.990
170 R 1.000** 998.990
171 S 1.000** 998.990
172 A 1.000** 998.990
173 V 1.000** 998.990
174 T 1.000** 998.990
175 E 1.000** 998.990
176 A 1.000** 998.990
177 W 1.000** 998.990
178 D 1.000** 998.990
179 R 1.000** 998.990
180 P 1.000** 998.990
181 T 1.000** 998.990
182 A 1.000** 998.990
183 T 1.000** 998.990
184 A 1.000** 998.990
185 I 1.000** 998.990
186 A 1.000** 998.990
187 L 1.000** 998.990
188 R 1.000** 998.990
189 D 1.000** 998.990
190 K 1.000** 998.990
191 E 1.000** 998.990
192 I 1.000** 998.990
193 E 1.000** 998.990
194 L 1.000** 998.990
195 I 1.000** 998.990
196 D 1.000** 998.990
197 Y 1.000** 998.990
198 Y 1.000** 998.990
199 R 1.000** 998.990
200 S 1.000** 998.990
201 A 1.000** 998.990
202 S 1.000** 998.990
203 K 1.000** 998.990
204 A 1.000** 998.990
205 R 1.000** 998.990
206 G 1.000** 998.990
207 T 1.000** 998.990
208 W 1.000** 998.990
209 Q 1.000** 998.990
210 A 1.000** 998.990
211 A 1.000** 998.990
212 R 1.000** 998.990
213 A 1.000** 998.990
214 S 1.000** 998.990
215 A 1.000** 998.990
216 G 1.000** 998.990
217 Y 1.000** 998.990
218 S 1.000** 998.990
219 S 1.000** 998.990
220 A 1.000** 998.990
221 A 1.000** 998.990
222 R 1.000** 998.990
223 N 1.000** 998.990
224 A 1.000** 998.990
225 G 1.000** 998.990
226 D 1.000** 998.990
227 Q 1.000** 998.990
228 A 1.000** 998.990
229 G 1.000** 998.990
230 R 1.000** 998.990
231 R 1.000** 998.990
232 A 1.000** 998.990
233 W 1.000** 998.990
234 I 1.000** 998.990
235 D 1.000** 998.990
236 N 1.000** 998.990
237 S 1.000** 998.990
238 T 1.000** 998.990
239 E 1.000** 998.990
240 L 1.000** 998.990
241 P 1.000** 998.990
242 G 1.000** 998.990
243 A 1.000** 998.990
244 R 1.000** 998.990
245 A 1.000** 998.990
246 A 1.000** 998.990
247 L 1.000** 998.990
248 G 1.000** 998.990
249 R 1.000** 998.990
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908987_1_2784_MLBR_RS13250)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:19
Model 1: NearlyNeutral -986.705355 Model 2: PositiveSelection -986.705256 Model 0: one-ratio -986.705266 Model 7: beta -986.705355 Model 8: beta&w>1 -986.705255 Model 0 vs 1 1.7800000000534055E-4 Model 2 vs 1 1.9800000018221908E-4 Model 8 vs 7 2.0000000017716957E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
