--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:47:49 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2604/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1013.94         -1017.51
2      -1013.91         -1016.98
--------------------------------------
TOTAL    -1013.93         -1017.28
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.894533    0.088077    0.380438    1.485567    0.862434   1427.60   1455.70    1.000
r(A<->C){all}   0.168308    0.020530    0.000163    0.468959    0.134348    223.51    314.42    1.002
r(A<->G){all}   0.163213    0.019852    0.000116    0.443303    0.123767     90.13    227.60    1.002
r(A<->T){all}   0.158229    0.018722    0.000015    0.426112    0.122208    115.65    205.24    1.005
r(C<->G){all}   0.171803    0.019783    0.000094    0.457705    0.138501    195.54    204.68    1.005
r(C<->T){all}   0.176929    0.021904    0.000126    0.469276    0.137723    197.35    249.44    1.000
r(G<->T){all}   0.161519    0.018401    0.000030    0.445547    0.124672    166.94    190.11    1.000
pi(A){all}      0.194434    0.000205    0.164416    0.220746    0.194244   1224.75   1292.69    1.000
pi(C){all}      0.305094    0.000285    0.272260    0.337951    0.305271   1073.75   1212.52    1.000
pi(G){all}      0.318106    0.000275    0.284874    0.348482    0.318069   1230.32   1267.09    1.000
pi(T){all}      0.182366    0.000198    0.155661    0.209723    0.182517   1277.92   1352.30    1.000
alpha{1,2}      0.423614    0.234739    0.000146    1.388243    0.264944   1293.17   1327.20    1.000
alpha{3}        0.458522    0.253838    0.000249    1.409712    0.301136   1265.90   1334.85    1.000
pinvar{all}     0.997898    0.000007    0.993232    0.999998    0.998722   1401.36   1410.05    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-986.705355
Model 2: PositiveSelection	-986.705256
Model 0: one-ratio	-986.705266
Model 7: beta	-986.705355
Model 8: beta&w>1	-986.705255


Model 0 vs 1	1.7800000000534055E-4

Model 2 vs 1	1.9800000018221908E-4

Model 8 vs 7	2.0000000017716957E-4
>C1
MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
>C2
MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
>C3
MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
>C4
MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
>C5
MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
>C6
MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=249 

C1              MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
C2              MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
C3              MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
C4              MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
C5              MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
C6              MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
                **************************************************

C1              VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
C2              VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
C3              VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
C4              VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
C5              VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
C6              VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
                **************************************************

C1              FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
C2              FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
C3              FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
C4              FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
C5              FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
C6              FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
                **************************************************

C1              QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
C2              QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
C3              QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
C4              QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
C5              QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
C6              QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
                **************************************************

C1              ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
C2              ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
C3              ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
C4              ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
C5              ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
C6              ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
                *************************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  249 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  249 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7470]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [7470]--->[7470]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.493 Mb, Max= 30.801 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
C2              MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
C3              MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
C4              MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
C5              MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
C6              MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
                **************************************************

C1              VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
C2              VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
C3              VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
C4              VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
C5              VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
C6              VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
                **************************************************

C1              FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
C2              FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
C3              FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
C4              FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
C5              FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
C6              FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
                **************************************************

C1              QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
C2              QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
C3              QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
C4              QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
C5              QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
C6              QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
                **************************************************

C1              ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
C2              ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
C3              ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
C4              ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
C5              ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
C6              ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
                *************************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC
C2              ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC
C3              ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC
C4              ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC
C5              ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC
C6              ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC
                **************************************************

C1              TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC
C2              TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC
C3              TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC
C4              TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC
C5              TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC
C6              TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC
                **************************************************

C1              AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT
C2              AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT
C3              AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT
C4              AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT
C5              AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT
C6              AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT
                **************************************************

C1              GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT
C2              GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT
C3              GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT
C4              GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT
C5              GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT
C6              GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT
                **************************************************

C1              CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC
C2              CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC
C3              CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC
C4              CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC
C5              CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC
C6              CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC
                **************************************************

C1              TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG
C2              TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG
C3              TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG
C4              TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG
C5              TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG
C6              TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG
                **************************************************

C1              TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT
C2              TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT
C3              TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT
C4              TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT
C5              TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT
C6              TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT
                **************************************************

C1              GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG
C2              GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG
C3              GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG
C4              GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG
C5              GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG
C6              GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG
                **************************************************

C1              CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT
C2              CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT
C3              CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT
C4              CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT
C5              CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT
C6              CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT
                **************************************************

C1              CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA
C2              CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA
C3              CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA
C4              CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA
C5              CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA
C6              CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA
                **************************************************

C1              TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG
C2              TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG
C3              TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG
C4              TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG
C5              TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG
C6              TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG
                **************************************************

C1              CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC
C2              CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC
C3              CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC
C4              CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC
C5              CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC
C6              CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC
                **************************************************

C1              GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA
C2              GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA
C3              GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA
C4              GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA
C5              GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA
C6              GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA
                **************************************************

C1              TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA
C2              TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA
C3              TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA
C4              TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA
C5              TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA
C6              TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA
                **************************************************

C1              TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA
C2              TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA
C3              TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA
C4              TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA
C5              TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA
C6              TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA
                ***********************************************



>C1
ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC
TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC
AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT
GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT
CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC
TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG
TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT
GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG
CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT
CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA
TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG
CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC
GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA
TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA
TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA
>C2
ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC
TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC
AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT
GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT
CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC
TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG
TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT
GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG
CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT
CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA
TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG
CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC
GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA
TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA
TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA
>C3
ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC
TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC
AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT
GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT
CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC
TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG
TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT
GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG
CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT
CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA
TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG
CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC
GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA
TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA
TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA
>C4
ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC
TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC
AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT
GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT
CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC
TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG
TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT
GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG
CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT
CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA
TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG
CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC
GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA
TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA
TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA
>C5
ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC
TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC
AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT
GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT
CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC
TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG
TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT
GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG
CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT
CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA
TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG
CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC
GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA
TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA
TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA
>C6
ATGACCGACAACAAAATGCTGGCCCGCATTGCCGCGTTGCTGCGTCAGGC
TGAAGGCACTGACAATGCTCATGAAGCTGACGCGTTTATGGCCACCGCGC
AACGGTTGGCGACCGCGGCATCTATCGACTTGGCGGTGGCGCGGTCGCAT
GTGGCCAACCGTTCGACTGCACAGGCCCCTACTCAGCGCACTATCACCAT
CGGTACAGCAGGCACCCGCGGGCTGCGGACGTATGTACAGCTCTTTGTGC
TGATCGCGGCAGCAAACGACGTCCGCTGTGATGTGGCGTCGAATTCGACG
TTCCTTTACGCTTACGGGTTCGCCGAGGACATCGACGCCACGCACGCCCT
GTATGCCAGCCTGGTTGTCCAGATGGTGCGGGAGTCGGACGCCTATCTCG
CATCGGGCGCGTATCGACCCACGCCGACAATCACCGCTAGACTCAACTTT
CAGCTGGGGTTCGGAATGCGTGTAGGTCAGCGTCTGACCGAGGCTCGCGA
TCATATCCGGAGTGCTGTGACCGAAGCCTGGGATCGTCCGACTGCAACAG
CTATAGCGTTGCGAGACAAGGAGATTGAGCTGATCGACTACTACCGCAGC
GCGTCTAAGGCGCGCGGAACCTGGCAAGCCGCCAGAGCTTCGGCAGGCTA
TTCGTCGGCGGCGCGGAACGCGGGCGATCAGGCCGGCCGACGAGCCTGGA
TAGACAACAGCACTGAGCTGCCCGGAGCGCGGGCCGCGCTGGGTCGA
>C1
MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
>C2
MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
>C3
MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
>C4
MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
>C5
MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR
>C6
MTDNKMLARIAALLRQAEGTDNAHEADAFMATAQRLATAASIDLAVARSH
VANRSTAQAPTQRTITIGTAGTRGLRTYVQLFVLIAAANDVRCDVASNST
FLYAYGFAEDIDATHALYASLVVQMVRESDAYLASGAYRPTPTITARLNF
QLGFGMRVGQRLTEARDHIRSAVTEAWDRPTATAIALRDKEIELIDYYRS
ASKARGTWQAARASAGYSSAARNAGDQAGRRAWIDNSTELPGARAALGR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 747 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579859181
      Setting output file names to "/data/9res/ML2604/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1145055631
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5247378630
      Seed = 1496053548
      Swapseed = 1579859181
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1671.821813 -- -24.965149
         Chain 2 -- -1671.821717 -- -24.965149
         Chain 3 -- -1671.821813 -- -24.965149
         Chain 4 -- -1671.821813 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1671.821558 -- -24.965149
         Chain 2 -- -1671.821813 -- -24.965149
         Chain 3 -- -1671.821717 -- -24.965149
         Chain 4 -- -1671.821813 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1671.822] (-1671.822) (-1671.822) (-1671.822) * [-1671.822] (-1671.822) (-1671.822) (-1671.822) 
        500 -- (-1030.775) [-1024.763] (-1049.860) (-1030.407) * [-1040.443] (-1038.218) (-1023.938) (-1035.746) -- 0:33:19
       1000 -- (-1025.229) (-1022.453) [-1021.468] (-1025.769) * (-1030.012) (-1033.233) [-1024.705] (-1023.949) -- 0:16:39
       1500 -- (-1019.874) (-1024.686) [-1023.045] (-1021.346) * (-1035.425) [-1021.547] (-1028.195) (-1024.844) -- 0:11:05
       2000 -- (-1025.576) (-1026.317) [-1021.232] (-1027.739) * [-1024.605] (-1026.493) (-1027.146) (-1025.907) -- 0:08:19
       2500 -- (-1030.793) [-1017.605] (-1030.636) (-1034.633) * [-1027.167] (-1026.644) (-1019.727) (-1026.799) -- 0:06:39
       3000 -- [-1020.493] (-1028.382) (-1021.251) (-1022.601) * [-1020.345] (-1028.087) (-1026.655) (-1025.161) -- 0:05:32
       3500 -- (-1021.815) [-1026.121] (-1018.811) (-1023.262) * [-1021.600] (-1025.263) (-1029.489) (-1024.375) -- 0:04:44
       4000 -- (-1018.953) (-1023.743) [-1020.836] (-1023.952) * (-1025.834) (-1024.069) [-1031.387] (-1031.568) -- 0:04:09
       4500 -- (-1034.298) (-1023.456) [-1020.367] (-1019.112) * (-1024.105) (-1033.788) (-1023.895) [-1023.687] -- 0:03:41
       5000 -- (-1027.907) (-1024.522) [-1021.503] (-1022.551) * (-1027.456) [-1020.561] (-1022.480) (-1021.861) -- 0:03:19

      Average standard deviation of split frequencies: 0.088815

       5500 -- [-1022.247] (-1022.847) (-1032.300) (-1022.925) * (-1028.722) [-1018.151] (-1022.442) (-1032.151) -- 0:03:00
       6000 -- [-1022.440] (-1023.726) (-1025.493) (-1024.303) * (-1021.491) [-1026.038] (-1031.384) (-1023.228) -- 0:02:45
       6500 -- (-1028.771) [-1020.837] (-1034.521) (-1019.789) * [-1021.688] (-1029.398) (-1027.007) (-1021.854) -- 0:02:32
       7000 -- [-1016.754] (-1023.509) (-1025.791) (-1027.243) * (-1031.955) (-1022.155) [-1027.988] (-1022.568) -- 0:02:21
       7500 -- (-1020.968) [-1017.588] (-1026.210) (-1036.104) * (-1027.264) (-1020.305) [-1024.084] (-1025.321) -- 0:02:12
       8000 -- (-1023.135) (-1024.415) (-1042.005) [-1023.274] * [-1026.310] (-1029.163) (-1022.546) (-1022.174) -- 0:02:04
       8500 -- (-1043.130) (-1023.398) [-1030.103] (-1021.329) * [-1029.163] (-1020.707) (-1019.398) (-1025.909) -- 0:01:56
       9000 -- (-1021.040) [-1022.557] (-1033.295) (-1025.723) * (-1027.114) (-1033.859) [-1018.598] (-1019.418) -- 0:01:50
       9500 -- (-1025.912) (-1022.076) (-1021.854) [-1021.117] * (-1021.644) (-1022.131) [-1024.377] (-1027.054) -- 0:01:44
      10000 -- (-1021.902) (-1024.746) (-1032.411) [-1019.868] * (-1023.976) (-1023.152) [-1025.697] (-1022.349) -- 0:01:39

      Average standard deviation of split frequencies: 0.081410

      10500 -- (-1030.491) (-1028.441) (-1025.316) [-1021.848] * (-1016.904) (-1025.575) [-1021.665] (-1029.342) -- 0:01:34
      11000 -- (-1022.685) (-1022.432) (-1022.444) [-1022.140] * [-1017.352] (-1027.262) (-1023.968) (-1031.102) -- 0:01:29
      11500 -- (-1022.796) (-1020.064) [-1021.955] (-1023.961) * (-1035.712) (-1023.866) (-1017.821) [-1026.424] -- 0:01:25
      12000 -- (-1018.970) [-1024.680] (-1022.748) (-1028.705) * [-1024.794] (-1027.140) (-1026.732) (-1023.320) -- 0:01:22
      12500 -- (-1024.818) [-1025.068] (-1023.042) (-1022.572) * (-1026.926) (-1021.070) [-1021.264] (-1027.812) -- 0:01:19
      13000 -- [-1028.454] (-1024.766) (-1021.825) (-1016.945) * (-1027.629) [-1019.732] (-1026.277) (-1020.150) -- 0:01:15
      13500 -- [-1022.324] (-1026.317) (-1017.304) (-1023.751) * (-1020.405) (-1039.708) [-1020.531] (-1021.778) -- 0:01:13
      14000 -- [-1023.881] (-1022.612) (-1025.080) (-1026.213) * (-1029.452) (-1017.751) (-1030.195) [-1020.880] -- 0:01:10
      14500 -- (-1019.731) (-1032.505) [-1023.316] (-1023.724) * [-1020.262] (-1023.899) (-1031.795) (-1023.360) -- 0:01:07
      15000 -- (-1019.686) [-1018.217] (-1027.127) (-1021.853) * [-1026.159] (-1023.649) (-1028.092) (-1023.677) -- 0:01:05

      Average standard deviation of split frequencies: 0.081841

      15500 -- [-1019.432] (-1015.856) (-1024.925) (-1020.576) * (-1027.103) (-1022.293) [-1019.840] (-1027.511) -- 0:02:07
      16000 -- (-1020.028) (-1022.698) [-1028.237] (-1027.085) * (-1026.076) (-1023.250) [-1024.497] (-1023.972) -- 0:02:03
      16500 -- (-1025.662) (-1021.593) [-1024.907] (-1021.985) * (-1021.196) (-1023.024) (-1027.437) [-1021.466] -- 0:01:59
      17000 -- [-1024.596] (-1031.974) (-1028.849) (-1020.931) * (-1019.158) [-1024.094] (-1036.270) (-1025.458) -- 0:01:55
      17500 -- (-1034.469) (-1026.463) (-1020.076) [-1021.781] * (-1028.597) (-1026.761) [-1026.471] (-1022.676) -- 0:01:52
      18000 -- (-1032.116) (-1024.394) [-1020.800] (-1021.651) * (-1025.473) (-1029.404) [-1027.906] (-1024.786) -- 0:01:49
      18500 -- (-1023.067) (-1023.760) [-1016.653] (-1022.748) * (-1022.302) (-1033.279) (-1031.234) [-1017.765] -- 0:01:46
      19000 -- (-1019.638) (-1025.132) [-1020.349] (-1029.683) * (-1024.187) [-1024.124] (-1024.265) (-1021.447) -- 0:01:43
      19500 -- (-1021.521) (-1021.379) (-1025.036) [-1026.718] * (-1035.594) (-1015.520) [-1023.555] (-1020.400) -- 0:01:40
      20000 -- (-1027.649) (-1021.143) (-1020.492) [-1024.927] * (-1032.235) (-1014.962) [-1018.985] (-1029.976) -- 0:01:38

      Average standard deviation of split frequencies: 0.057025

      20500 -- (-1022.881) (-1022.722) (-1025.458) [-1018.986] * (-1023.562) (-1021.132) (-1021.486) [-1025.848] -- 0:01:35
      21000 -- (-1027.802) [-1018.317] (-1028.819) (-1023.722) * [-1024.076] (-1022.703) (-1024.113) (-1024.719) -- 0:01:33
      21500 -- (-1022.555) (-1029.644) (-1024.888) [-1019.449] * (-1027.367) (-1013.786) [-1022.930] (-1028.340) -- 0:01:31
      22000 -- [-1023.360] (-1024.526) (-1027.545) (-1025.308) * (-1026.327) (-1015.328) (-1022.763) [-1022.172] -- 0:01:28
      22500 -- (-1021.161) (-1020.645) [-1018.477] (-1021.335) * [-1022.608] (-1019.904) (-1023.563) (-1020.804) -- 0:01:26
      23000 -- (-1021.225) [-1021.409] (-1020.507) (-1024.334) * (-1025.222) (-1017.150) [-1020.753] (-1028.606) -- 0:01:24
      23500 -- (-1027.769) (-1027.929) (-1025.769) [-1021.300] * (-1028.942) (-1012.803) [-1026.445] (-1023.590) -- 0:01:23
      24000 -- (-1027.712) (-1021.192) [-1021.872] (-1025.902) * (-1025.729) (-1015.416) (-1024.497) [-1024.140] -- 0:01:21
      24500 -- (-1018.612) (-1022.780) (-1029.691) [-1024.424] * (-1022.521) (-1014.102) (-1023.948) [-1022.095] -- 0:01:19
      25000 -- (-1017.264) (-1035.133) [-1021.487] (-1025.343) * (-1019.177) (-1013.585) (-1021.895) [-1023.692] -- 0:01:18

      Average standard deviation of split frequencies: 0.051240

      25500 -- (-1014.980) (-1035.915) [-1022.824] (-1022.150) * (-1028.093) [-1013.476] (-1017.359) (-1029.431) -- 0:01:16
      26000 -- [-1012.800] (-1014.796) (-1023.160) (-1028.228) * [-1022.532] (-1013.398) (-1021.707) (-1025.226) -- 0:01:14
      26500 -- (-1013.585) [-1014.403] (-1023.414) (-1036.249) * (-1026.851) (-1013.630) [-1020.952] (-1025.079) -- 0:01:13
      27000 -- [-1015.300] (-1014.305) (-1025.840) (-1022.069) * (-1034.817) (-1014.190) (-1022.935) [-1021.077] -- 0:01:12
      27500 -- (-1013.374) [-1015.663] (-1021.660) (-1023.556) * (-1024.691) [-1013.911] (-1023.303) (-1023.133) -- 0:01:10
      28000 -- (-1013.421) (-1014.696) (-1020.135) [-1023.418] * [-1022.369] (-1014.372) (-1021.166) (-1035.028) -- 0:01:09
      28500 -- (-1016.534) (-1014.339) (-1019.823) [-1020.508] * (-1025.215) [-1014.524] (-1020.843) (-1017.655) -- 0:01:08
      29000 -- [-1015.768] (-1015.438) (-1019.872) (-1019.687) * (-1023.107) (-1013.652) [-1020.602] (-1024.552) -- 0:01:06
      29500 -- (-1014.806) (-1015.220) (-1022.380) [-1018.088] * (-1018.812) (-1017.111) [-1027.154] (-1028.023) -- 0:01:05
      30000 -- [-1015.863] (-1014.848) (-1022.602) (-1023.125) * (-1025.884) (-1013.886) (-1023.508) [-1024.560] -- 0:01:04

      Average standard deviation of split frequencies: 0.046884

      30500 -- [-1015.820] (-1015.490) (-1021.636) (-1023.673) * (-1023.811) (-1013.617) (-1020.761) [-1012.622] -- 0:01:03
      31000 -- (-1012.778) (-1015.853) (-1021.518) [-1023.250] * (-1030.963) (-1014.167) (-1026.002) [-1012.427] -- 0:01:02
      31500 -- [-1015.079] (-1018.586) (-1033.271) (-1021.377) * (-1019.063) (-1016.386) [-1020.120] (-1013.068) -- 0:01:32
      32000 -- [-1012.948] (-1014.272) (-1020.264) (-1025.619) * (-1016.632) (-1016.059) (-1025.014) [-1018.417] -- 0:01:30
      32500 -- [-1016.155] (-1015.894) (-1026.217) (-1023.534) * (-1018.254) [-1013.332] (-1031.374) (-1013.980) -- 0:01:29
      33000 -- (-1014.015) [-1014.928] (-1022.483) (-1022.858) * [-1017.925] (-1013.718) (-1020.562) (-1018.019) -- 0:01:27
      33500 -- (-1016.348) (-1014.304) [-1023.767] (-1023.181) * (-1013.239) [-1014.423] (-1025.011) (-1015.039) -- 0:01:26
      34000 -- (-1013.796) [-1018.459] (-1025.070) (-1028.869) * (-1013.169) (-1014.639) [-1022.834] (-1013.518) -- 0:01:25
      34500 -- [-1013.152] (-1018.127) (-1030.561) (-1027.379) * [-1013.514] (-1014.395) (-1027.864) (-1016.446) -- 0:01:23
      35000 -- [-1012.339] (-1015.135) (-1019.915) (-1026.610) * [-1013.077] (-1018.675) (-1022.662) (-1014.278) -- 0:01:22

      Average standard deviation of split frequencies: 0.043419

      35500 -- (-1013.792) [-1013.352] (-1023.136) (-1016.459) * (-1015.570) [-1021.996] (-1022.540) (-1014.594) -- 0:01:21
      36000 -- (-1014.975) (-1013.163) (-1023.631) [-1013.640] * (-1013.676) [-1014.600] (-1025.818) (-1015.300) -- 0:01:20
      36500 -- (-1014.276) (-1014.870) (-1028.597) [-1014.370] * (-1015.555) (-1015.967) (-1029.046) [-1012.415] -- 0:01:19
      37000 -- [-1013.140] (-1018.936) (-1030.994) (-1012.911) * (-1014.019) (-1014.466) [-1021.711] (-1015.187) -- 0:01:18
      37500 -- (-1013.294) [-1015.719] (-1022.215) (-1012.990) * [-1013.871] (-1013.957) (-1032.530) (-1017.671) -- 0:01:17
      38000 -- [-1013.669] (-1015.491) (-1026.732) (-1014.226) * (-1016.457) [-1013.152] (-1019.005) (-1018.739) -- 0:01:15
      38500 -- [-1014.435] (-1019.663) (-1027.327) (-1013.115) * (-1016.641) [-1015.715] (-1021.763) (-1016.736) -- 0:01:14
      39000 -- (-1013.831) [-1017.359] (-1019.710) (-1015.627) * [-1016.621] (-1015.510) (-1027.833) (-1016.356) -- 0:01:13
      39500 -- [-1014.182] (-1020.904) (-1021.307) (-1018.577) * [-1016.345] (-1013.457) (-1020.081) (-1014.434) -- 0:01:12
      40000 -- (-1014.703) [-1015.574] (-1019.784) (-1013.602) * (-1017.088) (-1016.389) [-1023.827] (-1013.336) -- 0:01:12

      Average standard deviation of split frequencies: 0.045147

      40500 -- (-1016.383) (-1015.372) (-1019.529) [-1013.825] * (-1013.001) [-1014.929] (-1038.192) (-1014.314) -- 0:01:11
      41000 -- (-1013.302) (-1013.969) (-1015.334) [-1013.352] * (-1013.434) (-1015.575) (-1027.645) [-1015.308] -- 0:01:10
      41500 -- (-1013.830) [-1014.055] (-1014.871) (-1015.231) * (-1014.867) (-1018.173) (-1020.194) [-1017.704] -- 0:01:09
      42000 -- (-1015.386) (-1014.781) [-1016.124] (-1017.097) * [-1013.811] (-1013.833) (-1015.330) (-1014.019) -- 0:01:08
      42500 -- (-1017.054) [-1013.327] (-1014.792) (-1018.532) * [-1014.962] (-1013.239) (-1014.644) (-1013.153) -- 0:01:07
      43000 -- (-1016.654) (-1014.128) [-1015.495] (-1020.127) * [-1012.720] (-1017.852) (-1014.321) (-1013.255) -- 0:01:06
      43500 -- (-1014.451) (-1016.519) (-1015.810) [-1017.206] * (-1014.985) (-1018.742) [-1014.670] (-1013.224) -- 0:01:05
      44000 -- (-1013.071) [-1013.432] (-1015.331) (-1014.243) * [-1013.493] (-1017.461) (-1015.323) (-1013.773) -- 0:01:05
      44500 -- [-1012.833] (-1014.449) (-1015.801) (-1016.144) * [-1015.075] (-1015.892) (-1015.230) (-1015.742) -- 0:01:04
      45000 -- [-1016.539] (-1013.511) (-1019.676) (-1014.954) * (-1017.181) [-1016.447] (-1020.461) (-1013.956) -- 0:01:03

      Average standard deviation of split frequencies: 0.040526

      45500 -- [-1012.902] (-1012.758) (-1015.759) (-1017.568) * (-1014.662) (-1012.306) (-1017.894) [-1013.226] -- 0:01:02
      46000 -- (-1013.112) (-1014.231) [-1014.526] (-1017.254) * (-1015.582) (-1013.157) (-1016.234) [-1013.765] -- 0:01:02
      46500 -- [-1019.001] (-1014.052) (-1014.526) (-1014.118) * (-1018.287) (-1013.894) (-1013.675) [-1015.233] -- 0:01:01
      47000 -- (-1016.685) [-1013.452] (-1014.341) (-1013.379) * (-1015.266) (-1014.808) (-1013.321) [-1014.681] -- 0:01:00
      47500 -- (-1017.776) (-1014.251) [-1015.777] (-1014.206) * (-1013.823) (-1014.062) [-1013.718] (-1013.856) -- 0:01:20
      48000 -- [-1014.895] (-1017.446) (-1015.672) (-1013.329) * (-1014.390) (-1015.824) [-1014.098] (-1016.809) -- 0:01:19
      48500 -- (-1013.860) (-1015.940) [-1015.119] (-1015.231) * (-1013.874) (-1013.030) [-1013.003] (-1013.635) -- 0:01:18
      49000 -- (-1013.875) [-1013.733] (-1012.396) (-1013.945) * (-1014.121) [-1013.068] (-1018.738) (-1014.277) -- 0:01:17
      49500 -- (-1015.848) [-1013.738] (-1018.592) (-1013.698) * (-1013.535) (-1013.174) [-1015.927] (-1013.213) -- 0:01:16
      50000 -- (-1018.758) (-1012.941) [-1016.951] (-1016.835) * (-1015.811) (-1013.069) (-1017.259) [-1013.407] -- 0:01:16

      Average standard deviation of split frequencies: 0.041868

      50500 -- [-1020.419] (-1013.119) (-1016.921) (-1018.323) * (-1014.297) [-1012.721] (-1016.852) (-1014.375) -- 0:01:15
      51000 -- [-1019.045] (-1012.520) (-1015.609) (-1013.990) * (-1013.458) [-1012.898] (-1015.842) (-1013.255) -- 0:01:14
      51500 -- (-1019.149) (-1013.840) [-1014.490] (-1014.722) * (-1012.536) [-1013.755] (-1016.277) (-1013.916) -- 0:01:13
      52000 -- [-1015.754] (-1012.545) (-1014.567) (-1013.462) * (-1012.740) [-1013.570] (-1015.513) (-1014.701) -- 0:01:12
      52500 -- (-1013.907) (-1013.031) (-1013.404) [-1015.716] * (-1013.099) (-1014.864) (-1016.311) [-1014.415] -- 0:01:12
      53000 -- (-1012.836) (-1014.409) (-1014.879) [-1013.122] * (-1015.848) (-1014.826) (-1014.572) [-1017.129] -- 0:01:11
      53500 -- (-1014.028) (-1012.489) [-1013.304] (-1015.556) * (-1014.162) [-1013.898] (-1013.491) (-1014.721) -- 0:01:10
      54000 -- (-1014.678) (-1016.659) [-1013.826] (-1013.186) * (-1019.060) (-1013.360) [-1013.665] (-1014.004) -- 0:01:10
      54500 -- (-1014.505) (-1012.400) (-1014.283) [-1013.533] * [-1015.842] (-1014.135) (-1014.049) (-1013.266) -- 0:01:09
      55000 -- (-1015.057) (-1012.844) [-1014.840] (-1019.644) * (-1013.090) (-1015.671) [-1015.102] (-1014.291) -- 0:01:08

      Average standard deviation of split frequencies: 0.038081

      55500 -- (-1015.182) [-1014.017] (-1014.062) (-1016.615) * (-1017.323) (-1016.877) (-1014.090) [-1016.546] -- 0:01:08
      56000 -- [-1014.246] (-1014.140) (-1014.008) (-1013.928) * (-1014.055) (-1014.057) [-1013.788] (-1013.055) -- 0:01:07
      56500 -- (-1013.445) (-1015.274) (-1015.563) [-1014.701] * (-1014.761) (-1016.371) [-1014.885] (-1013.846) -- 0:01:06
      57000 -- [-1013.677] (-1012.514) (-1017.484) (-1013.018) * (-1013.097) [-1017.832] (-1017.958) (-1014.146) -- 0:01:06
      57500 -- [-1013.744] (-1012.476) (-1016.992) (-1013.620) * (-1014.407) (-1014.603) [-1016.896] (-1013.898) -- 0:01:05
      58000 -- (-1013.738) (-1012.345) [-1014.542] (-1015.917) * [-1017.450] (-1018.702) (-1016.039) (-1013.214) -- 0:01:04
      58500 -- (-1016.678) [-1012.333] (-1015.214) (-1017.127) * (-1014.772) (-1017.893) [-1015.606] (-1013.135) -- 0:01:04
      59000 -- (-1015.611) (-1014.171) (-1014.187) [-1016.059] * (-1012.895) (-1014.775) (-1014.617) [-1016.123] -- 0:01:03
      59500 -- (-1015.863) (-1012.952) (-1014.324) [-1016.061] * (-1013.896) (-1013.830) (-1013.339) [-1015.889] -- 0:01:03
      60000 -- [-1015.364] (-1015.298) (-1012.714) (-1012.489) * (-1016.682) [-1013.312] (-1013.606) (-1013.798) -- 0:01:02

      Average standard deviation of split frequencies: 0.040018

      60500 -- (-1013.115) (-1015.810) (-1019.148) [-1012.473] * (-1018.088) (-1012.790) [-1016.720] (-1013.786) -- 0:01:02
      61000 -- (-1015.101) [-1015.190] (-1021.241) (-1013.252) * (-1012.876) (-1013.288) (-1014.095) [-1013.897] -- 0:01:01
      61500 -- (-1018.828) (-1013.079) (-1019.574) [-1012.693] * (-1014.531) (-1012.821) [-1014.131] (-1016.567) -- 0:01:01
      62000 -- (-1015.670) (-1017.316) [-1015.178] (-1014.260) * [-1015.438] (-1016.000) (-1022.936) (-1012.594) -- 0:01:15
      62500 -- (-1015.503) (-1013.976) (-1015.572) [-1012.995] * (-1016.188) [-1015.320] (-1016.442) (-1013.582) -- 0:01:15
      63000 -- (-1016.781) [-1013.893] (-1014.239) (-1013.194) * [-1014.562] (-1012.507) (-1014.135) (-1016.832) -- 0:01:14
      63500 -- [-1013.748] (-1014.176) (-1014.929) (-1012.738) * [-1016.463] (-1016.246) (-1013.746) (-1013.135) -- 0:01:13
      64000 -- (-1014.285) (-1013.548) [-1014.832] (-1014.388) * (-1018.766) [-1014.494] (-1013.756) (-1013.789) -- 0:01:13
      64500 -- (-1015.802) (-1015.111) (-1014.096) [-1016.950] * (-1013.799) [-1013.742] (-1015.495) (-1013.780) -- 0:01:12
      65000 -- [-1014.317] (-1015.817) (-1012.993) (-1017.144) * (-1012.640) (-1012.944) [-1014.182] (-1013.239) -- 0:01:11

      Average standard deviation of split frequencies: 0.034284

      65500 -- [-1013.156] (-1014.469) (-1013.442) (-1014.391) * (-1013.962) [-1013.197] (-1014.328) (-1014.202) -- 0:01:11
      66000 -- (-1014.838) (-1015.878) [-1014.620] (-1013.067) * (-1014.998) (-1015.251) (-1014.440) [-1013.427] -- 0:01:10
      66500 -- (-1014.354) (-1015.925) (-1014.180) [-1013.550] * (-1014.214) [-1014.771] (-1013.609) (-1014.940) -- 0:01:10
      67000 -- (-1015.698) (-1015.046) [-1015.889] (-1017.898) * (-1016.727) (-1015.335) [-1013.331] (-1015.047) -- 0:01:09
      67500 -- (-1014.683) (-1014.454) [-1016.442] (-1012.775) * (-1020.479) (-1016.377) (-1015.257) [-1013.653] -- 0:01:09
      68000 -- (-1015.936) (-1012.972) [-1018.748] (-1017.589) * (-1015.119) [-1016.128] (-1017.664) (-1015.962) -- 0:01:08
      68500 -- (-1014.168) [-1016.072] (-1013.417) (-1013.245) * (-1018.102) (-1014.583) [-1014.798] (-1014.002) -- 0:01:07
      69000 -- (-1020.853) (-1016.191) (-1016.520) [-1015.626] * [-1015.725] (-1015.834) (-1015.179) (-1014.113) -- 0:01:07
      69500 -- (-1016.155) (-1014.589) [-1013.746] (-1013.781) * (-1015.597) (-1019.720) [-1013.877] (-1013.965) -- 0:01:06
      70000 -- (-1016.203) [-1013.244] (-1016.101) (-1014.315) * (-1013.453) (-1013.774) (-1012.496) [-1013.301] -- 0:01:06

      Average standard deviation of split frequencies: 0.032719

      70500 -- [-1014.132] (-1013.461) (-1017.998) (-1014.780) * (-1019.619) (-1014.558) [-1015.102] (-1012.847) -- 0:01:05
      71000 -- (-1014.339) (-1012.818) (-1013.742) [-1015.615] * (-1015.321) (-1016.069) [-1017.166] (-1016.716) -- 0:01:05
      71500 -- (-1013.937) (-1013.485) (-1015.795) [-1013.402] * (-1015.291) (-1014.884) [-1017.164] (-1014.932) -- 0:01:04
      72000 -- [-1013.026] (-1013.840) (-1014.820) (-1014.969) * (-1013.508) [-1014.599] (-1018.181) (-1013.242) -- 0:01:04
      72500 -- [-1014.596] (-1015.816) (-1015.381) (-1014.071) * (-1014.628) (-1013.960) [-1013.808] (-1013.378) -- 0:01:03
      73000 -- (-1018.841) (-1015.431) (-1017.424) [-1014.398] * (-1014.265) [-1014.436] (-1019.349) (-1013.251) -- 0:01:03
      73500 -- (-1016.563) (-1018.212) (-1014.267) [-1016.854] * (-1016.323) [-1013.389] (-1014.607) (-1014.143) -- 0:01:03
      74000 -- (-1016.994) (-1014.289) [-1015.164] (-1014.064) * (-1014.337) [-1014.460] (-1014.628) (-1016.510) -- 0:01:02
      74500 -- (-1014.732) (-1015.656) (-1014.774) [-1014.153] * (-1013.986) (-1020.431) (-1022.846) [-1018.524] -- 0:01:02
      75000 -- (-1014.078) (-1017.440) [-1013.385] (-1012.866) * (-1012.892) (-1015.464) [-1016.264] (-1015.821) -- 0:01:01

      Average standard deviation of split frequencies: 0.030034

      75500 -- [-1013.626] (-1014.891) (-1015.959) (-1013.097) * [-1013.012] (-1015.658) (-1014.774) (-1013.739) -- 0:01:01
      76000 -- (-1013.751) (-1013.627) (-1014.961) [-1015.348] * [-1015.761] (-1013.839) (-1016.033) (-1013.949) -- 0:01:00
      76500 -- (-1017.062) (-1013.358) [-1013.990] (-1015.485) * (-1014.699) (-1012.589) [-1016.007] (-1015.641) -- 0:01:00
      77000 -- (-1016.749) [-1013.394] (-1015.769) (-1016.256) * (-1015.757) (-1012.555) [-1015.682] (-1015.133) -- 0:00:59
      77500 -- (-1015.767) (-1012.811) (-1014.497) [-1014.511] * (-1014.495) (-1014.866) [-1013.503] (-1015.443) -- 0:00:59
      78000 -- [-1019.600] (-1013.923) (-1014.304) (-1014.231) * (-1013.204) [-1015.087] (-1012.926) (-1014.749) -- 0:00:59
      78500 -- (-1020.718) [-1013.272] (-1017.058) (-1016.271) * (-1012.301) [-1014.738] (-1013.471) (-1013.026) -- 0:01:10
      79000 -- (-1016.119) (-1013.842) [-1015.950] (-1015.824) * (-1013.738) [-1013.648] (-1014.117) (-1013.406) -- 0:01:09
      79500 -- (-1015.393) [-1013.934] (-1018.824) (-1014.728) * [-1013.768] (-1014.453) (-1013.801) (-1013.259) -- 0:01:09
      80000 -- (-1018.280) [-1013.755] (-1016.351) (-1015.806) * (-1014.479) [-1014.650] (-1014.437) (-1014.415) -- 0:01:09

      Average standard deviation of split frequencies: 0.027066

      80500 -- [-1025.521] (-1017.727) (-1016.044) (-1012.764) * (-1014.945) [-1012.810] (-1015.165) (-1016.099) -- 0:01:08
      81000 -- (-1018.518) (-1014.840) (-1015.155) [-1015.160] * (-1016.834) [-1012.438] (-1014.877) (-1014.187) -- 0:01:08
      81500 -- (-1019.937) (-1014.634) (-1018.496) [-1016.080] * (-1013.773) [-1013.765] (-1014.482) (-1019.048) -- 0:01:07
      82000 -- (-1013.840) [-1013.626] (-1017.397) (-1014.337) * (-1013.560) (-1015.062) (-1020.166) [-1014.400] -- 0:01:07
      82500 -- [-1013.708] (-1015.821) (-1017.990) (-1012.434) * (-1013.436) (-1013.310) [-1017.220] (-1014.199) -- 0:01:06
      83000 -- (-1013.452) (-1015.625) [-1016.578] (-1016.349) * [-1014.018] (-1013.649) (-1017.077) (-1015.379) -- 0:01:06
      83500 -- (-1017.406) (-1015.468) [-1022.584] (-1013.420) * (-1013.926) (-1014.160) (-1014.296) [-1013.680] -- 0:01:05
      84000 -- (-1013.256) [-1014.754] (-1019.067) (-1013.516) * (-1013.446) (-1014.803) (-1012.826) [-1013.465] -- 0:01:05
      84500 -- (-1014.693) (-1014.692) [-1018.559] (-1013.516) * (-1013.380) [-1014.768] (-1016.138) (-1017.811) -- 0:01:05
      85000 -- (-1013.681) (-1013.437) [-1018.444] (-1014.667) * [-1013.085] (-1013.264) (-1013.813) (-1013.743) -- 0:01:04

      Average standard deviation of split frequencies: 0.026885

      85500 -- (-1015.049) (-1013.478) [-1014.578] (-1013.731) * [-1012.946] (-1014.628) (-1015.831) (-1016.322) -- 0:01:04
      86000 -- (-1012.922) (-1020.559) [-1013.089] (-1013.744) * (-1016.627) (-1013.319) (-1016.043) [-1016.399] -- 0:01:03
      86500 -- (-1014.358) (-1015.374) (-1012.324) [-1014.929] * (-1018.018) [-1013.310] (-1014.055) (-1015.808) -- 0:01:03
      87000 -- (-1017.647) (-1016.208) (-1012.645) [-1015.794] * (-1018.657) (-1014.717) (-1013.811) [-1015.225] -- 0:01:02
      87500 -- (-1015.241) (-1016.376) [-1013.408] (-1014.108) * (-1017.454) [-1012.552] (-1014.175) (-1018.538) -- 0:01:02
      88000 -- (-1015.941) [-1014.927] (-1013.672) (-1015.403) * (-1013.746) (-1014.329) [-1016.200] (-1015.642) -- 0:01:02
      88500 -- [-1014.677] (-1014.743) (-1015.756) (-1012.681) * [-1013.123] (-1013.246) (-1016.006) (-1016.564) -- 0:01:01
      89000 -- (-1016.967) (-1015.521) (-1014.199) [-1012.696] * (-1013.394) (-1014.011) (-1014.388) [-1020.027] -- 0:01:01
      89500 -- (-1019.620) [-1018.611] (-1012.908) (-1013.307) * (-1015.448) (-1017.157) [-1014.377] (-1015.892) -- 0:01:01
      90000 -- (-1021.650) (-1017.949) [-1013.006] (-1015.218) * (-1015.651) (-1017.023) [-1013.972] (-1016.315) -- 0:01:00

      Average standard deviation of split frequencies: 0.023917

      90500 -- (-1013.479) (-1014.824) [-1014.577] (-1014.626) * (-1016.655) (-1014.652) (-1017.565) [-1013.431] -- 0:01:00
      91000 -- (-1019.351) (-1017.591) [-1016.513] (-1019.909) * (-1018.715) [-1014.559] (-1014.093) (-1014.433) -- 0:00:59
      91500 -- (-1016.012) (-1019.459) (-1013.594) [-1017.191] * (-1022.049) [-1014.562] (-1015.633) (-1014.628) -- 0:00:59
      92000 -- (-1014.059) (-1014.208) [-1013.845] (-1015.250) * [-1015.112] (-1016.445) (-1016.799) (-1014.651) -- 0:00:59
      92500 -- [-1013.105] (-1016.729) (-1013.407) (-1016.751) * (-1016.542) (-1013.947) [-1014.084] (-1013.099) -- 0:00:58
      93000 -- [-1014.402] (-1014.438) (-1014.061) (-1014.057) * [-1014.993] (-1014.528) (-1014.501) (-1015.506) -- 0:00:58
      93500 -- (-1021.859) (-1015.456) [-1013.453] (-1014.337) * (-1014.596) (-1014.908) (-1013.575) [-1014.193] -- 0:00:58
      94000 -- (-1019.603) (-1015.626) [-1016.755] (-1013.305) * (-1018.664) [-1015.482] (-1012.924) (-1014.146) -- 0:00:57
      94500 -- (-1014.035) [-1013.863] (-1017.916) (-1012.873) * (-1014.537) (-1012.907) [-1013.084] (-1013.088) -- 0:01:07
      95000 -- (-1013.462) (-1013.578) (-1015.087) [-1012.896] * (-1018.103) (-1018.511) (-1014.045) [-1013.067] -- 0:01:06

      Average standard deviation of split frequencies: 0.021006

      95500 -- (-1013.231) (-1015.799) (-1013.367) [-1013.418] * [-1013.619] (-1016.270) (-1014.952) (-1017.108) -- 0:01:06
      96000 -- (-1015.536) (-1013.975) [-1020.389] (-1012.980) * [-1014.611] (-1014.691) (-1017.731) (-1019.263) -- 0:01:05
      96500 -- (-1013.527) [-1014.063] (-1014.410) (-1014.064) * [-1014.252] (-1017.638) (-1017.123) (-1018.122) -- 0:01:05
      97000 -- (-1013.575) [-1013.895] (-1014.856) (-1013.416) * (-1021.599) [-1014.142] (-1019.470) (-1016.281) -- 0:01:05
      97500 -- (-1018.078) (-1014.378) [-1012.981] (-1013.515) * (-1014.490) [-1014.671] (-1014.978) (-1014.704) -- 0:01:04
      98000 -- (-1016.784) [-1014.506] (-1014.195) (-1015.150) * (-1015.192) (-1015.004) (-1016.642) [-1014.896] -- 0:01:04
      98500 -- (-1014.483) [-1016.747] (-1014.028) (-1015.581) * (-1012.995) (-1017.106) [-1018.737] (-1013.562) -- 0:01:04
      99000 -- [-1016.233] (-1014.933) (-1013.662) (-1013.040) * [-1013.366] (-1016.797) (-1014.033) (-1014.624) -- 0:01:03
      99500 -- (-1016.283) (-1016.191) (-1018.522) [-1013.237] * (-1013.879) (-1016.089) (-1013.994) [-1016.588] -- 0:01:03
      100000 -- [-1018.667] (-1016.573) (-1013.643) (-1012.982) * (-1013.423) [-1014.302] (-1015.555) (-1019.931) -- 0:01:02

      Average standard deviation of split frequencies: 0.020032

      100500 -- (-1013.270) (-1013.636) (-1013.994) [-1013.229] * (-1015.564) [-1014.063] (-1014.648) (-1015.095) -- 0:01:02
      101000 -- (-1014.795) (-1014.913) [-1013.738] (-1013.214) * (-1019.105) (-1014.113) [-1015.447] (-1015.442) -- 0:01:02
      101500 -- (-1012.775) (-1017.979) [-1013.706] (-1015.802) * (-1016.865) (-1018.717) [-1014.159] (-1014.769) -- 0:01:01
      102000 -- (-1012.775) (-1018.826) [-1015.423] (-1013.910) * (-1015.189) (-1013.700) (-1015.204) [-1018.098] -- 0:01:01
      102500 -- (-1013.693) (-1015.932) [-1014.260] (-1014.444) * (-1014.047) [-1018.060] (-1014.932) (-1016.949) -- 0:01:01
      103000 -- (-1016.370) (-1015.865) [-1012.621] (-1014.983) * (-1013.971) [-1014.911] (-1014.300) (-1015.240) -- 0:01:00
      103500 -- [-1015.421] (-1015.974) (-1012.693) (-1016.510) * (-1017.516) [-1014.375] (-1014.950) (-1016.194) -- 0:01:00
      104000 -- (-1014.179) (-1014.932) [-1014.294] (-1013.103) * (-1014.854) (-1016.295) (-1013.512) [-1014.454] -- 0:01:00
      104500 -- (-1015.000) (-1014.952) [-1015.684] (-1015.124) * (-1015.959) (-1013.752) (-1014.597) [-1014.793] -- 0:00:59
      105000 -- (-1014.868) (-1012.883) (-1015.618) [-1014.996] * (-1013.869) (-1012.910) [-1013.496] (-1013.898) -- 0:00:59

      Average standard deviation of split frequencies: 0.019271

      105500 -- (-1017.223) (-1013.713) (-1014.888) [-1013.797] * (-1013.348) (-1013.124) (-1013.137) [-1018.770] -- 0:00:59
      106000 -- (-1015.287) (-1019.744) (-1016.396) [-1013.657] * (-1016.868) (-1014.003) [-1018.551] (-1012.848) -- 0:00:59
      106500 -- (-1015.393) [-1014.758] (-1013.320) (-1014.162) * [-1012.602] (-1014.069) (-1015.132) (-1012.767) -- 0:00:58
      107000 -- [-1015.608] (-1013.762) (-1014.123) (-1013.609) * [-1017.193] (-1013.236) (-1014.073) (-1012.998) -- 0:00:58
      107500 -- (-1015.267) [-1014.434] (-1015.622) (-1014.118) * (-1015.764) (-1015.348) [-1013.195] (-1015.189) -- 0:00:58
      108000 -- [-1014.434] (-1014.004) (-1016.053) (-1014.509) * (-1016.898) (-1017.035) [-1013.195] (-1018.457) -- 0:00:57
      108500 -- (-1014.098) (-1014.858) (-1013.560) [-1015.065] * (-1013.198) (-1012.722) [-1012.686] (-1015.110) -- 0:00:57
      109000 -- (-1015.532) (-1013.915) (-1015.164) [-1016.845] * (-1013.387) (-1013.640) [-1013.042] (-1017.041) -- 0:00:57
      109500 -- (-1013.479) [-1013.573] (-1013.607) (-1020.130) * (-1013.260) (-1012.373) (-1012.491) [-1013.255] -- 0:00:56
      110000 -- (-1016.780) (-1015.136) (-1016.677) [-1023.927] * (-1013.778) (-1015.544) [-1012.352] (-1012.695) -- 0:00:56

      Average standard deviation of split frequencies: 0.018459

      110500 -- (-1018.164) (-1014.901) [-1015.972] (-1013.544) * (-1013.732) [-1015.272] (-1012.836) (-1016.134) -- 0:01:04
      111000 -- (-1021.551) (-1016.283) (-1017.710) [-1013.224] * (-1014.012) (-1016.509) [-1013.992] (-1014.193) -- 0:01:04
      111500 -- (-1013.930) (-1015.088) (-1014.643) [-1013.733] * [-1015.377] (-1014.683) (-1014.568) (-1016.372) -- 0:01:03
      112000 -- (-1014.153) (-1014.926) [-1012.748] (-1014.393) * (-1014.819) [-1013.762] (-1013.900) (-1013.564) -- 0:01:03
      112500 -- (-1014.306) (-1017.208) [-1012.719] (-1014.406) * [-1015.208] (-1014.362) (-1019.267) (-1016.621) -- 0:01:03
      113000 -- (-1016.158) (-1014.165) (-1014.011) [-1013.672] * (-1013.997) [-1014.544] (-1018.150) (-1018.776) -- 0:01:02
      113500 -- (-1016.092) (-1013.885) [-1015.488] (-1016.677) * [-1013.458] (-1013.555) (-1017.109) (-1013.840) -- 0:01:02
      114000 -- (-1013.854) (-1019.544) (-1015.547) [-1013.955] * (-1013.277) [-1015.577] (-1014.302) (-1013.574) -- 0:01:02
      114500 -- (-1013.556) (-1017.769) (-1015.202) [-1015.870] * [-1014.367] (-1013.287) (-1013.965) (-1014.421) -- 0:01:01
      115000 -- (-1016.740) [-1012.835] (-1014.178) (-1014.353) * (-1014.597) (-1014.143) [-1015.640] (-1015.426) -- 0:01:01

      Average standard deviation of split frequencies: 0.018646

      115500 -- (-1015.764) (-1015.000) (-1014.982) [-1013.565] * (-1014.743) (-1014.019) (-1020.041) [-1016.905] -- 0:01:01
      116000 -- (-1016.837) [-1014.150] (-1015.815) (-1015.345) * (-1014.778) (-1017.440) [-1014.821] (-1021.270) -- 0:01:00
      116500 -- (-1016.683) (-1016.190) [-1014.901] (-1015.790) * (-1013.300) [-1014.326] (-1014.533) (-1016.208) -- 0:01:00
      117000 -- (-1013.866) (-1017.460) (-1014.428) [-1015.397] * (-1014.120) [-1013.561] (-1014.433) (-1017.241) -- 0:01:00
      117500 -- (-1013.521) (-1015.483) [-1015.789] (-1017.082) * (-1013.996) (-1013.948) [-1013.920] (-1019.495) -- 0:01:00
      118000 -- (-1012.932) (-1013.774) [-1015.813] (-1013.907) * [-1013.298] (-1013.861) (-1016.130) (-1017.321) -- 0:00:59
      118500 -- (-1015.260) [-1013.218] (-1015.840) (-1013.841) * (-1013.857) (-1015.722) [-1015.280] (-1016.165) -- 0:00:59
      119000 -- (-1015.864) (-1014.957) (-1013.959) [-1014.657] * (-1021.746) (-1015.073) (-1016.290) [-1017.033] -- 0:00:59
      119500 -- (-1015.675) (-1013.121) [-1015.945] (-1014.070) * [-1021.167] (-1013.587) (-1012.888) (-1018.074) -- 0:00:58
      120000 -- [-1013.740] (-1016.282) (-1015.945) (-1013.558) * (-1024.468) (-1013.626) [-1013.562] (-1015.484) -- 0:00:58

      Average standard deviation of split frequencies: 0.017336

      120500 -- (-1015.125) (-1015.575) (-1014.334) [-1017.876] * (-1019.398) (-1016.567) (-1014.654) [-1015.145] -- 0:00:58
      121000 -- (-1015.476) (-1015.201) (-1014.557) [-1012.933] * [-1020.375] (-1014.304) (-1014.006) (-1015.061) -- 0:00:58
      121500 -- (-1014.390) [-1016.351] (-1014.126) (-1014.178) * (-1019.542) (-1013.020) [-1014.064] (-1014.588) -- 0:00:57
      122000 -- [-1013.033] (-1016.796) (-1013.364) (-1013.114) * (-1017.448) (-1014.883) (-1014.161) [-1017.098] -- 0:00:57
      122500 -- [-1015.065] (-1012.728) (-1014.943) (-1013.239) * (-1018.494) (-1013.925) (-1014.949) [-1013.234] -- 0:00:57
      123000 -- (-1015.501) [-1012.898] (-1015.568) (-1013.947) * (-1016.765) (-1013.519) [-1017.281] (-1014.777) -- 0:00:57
      123500 -- (-1018.771) (-1014.001) (-1013.889) [-1012.502] * (-1013.418) [-1014.381] (-1016.531) (-1013.331) -- 0:00:56
      124000 -- (-1018.829) [-1013.334] (-1016.146) (-1013.861) * (-1013.424) (-1016.382) [-1012.881] (-1013.615) -- 0:00:56
      124500 -- (-1012.912) (-1013.098) (-1013.256) [-1012.541] * (-1013.103) [-1013.294] (-1013.569) (-1014.739) -- 0:00:56
      125000 -- (-1014.106) (-1012.647) (-1013.002) [-1013.145] * (-1017.114) (-1014.278) (-1013.729) [-1016.579] -- 0:00:56

      Average standard deviation of split frequencies: 0.018116

      125500 -- (-1018.118) (-1015.766) [-1013.074] (-1012.455) * (-1013.807) (-1015.698) (-1014.946) [-1017.233] -- 0:00:55
      126000 -- (-1015.065) (-1014.609) (-1015.297) [-1018.630] * (-1015.319) (-1017.173) (-1013.179) [-1013.444] -- 0:00:55
      126500 -- (-1017.126) (-1014.102) (-1014.364) [-1015.026] * (-1013.300) (-1015.255) [-1013.568] (-1023.891) -- 0:00:55
      127000 -- [-1017.288] (-1014.785) (-1015.872) (-1014.149) * (-1017.177) (-1014.895) [-1012.290] (-1020.213) -- 0:01:01
      127500 -- (-1014.308) (-1015.514) (-1014.055) [-1013.846] * [-1018.583] (-1014.713) (-1013.828) (-1014.896) -- 0:01:01
      128000 -- (-1016.959) (-1015.564) (-1016.694) [-1014.757] * (-1014.579) [-1014.997] (-1015.267) (-1014.652) -- 0:01:01
      128500 -- (-1017.497) [-1014.199] (-1020.713) (-1015.362) * (-1015.907) [-1015.748] (-1017.502) (-1014.548) -- 0:01:01
      129000 -- (-1013.928) [-1015.005] (-1013.820) (-1014.341) * (-1023.263) (-1025.487) (-1013.197) [-1014.725] -- 0:01:00
      129500 -- (-1015.294) [-1013.438] (-1015.071) (-1015.354) * (-1019.249) (-1017.548) [-1013.232] (-1015.449) -- 0:01:00
      130000 -- (-1015.098) [-1012.893] (-1012.646) (-1013.972) * (-1019.178) (-1017.386) (-1014.269) [-1013.607] -- 0:01:00

      Average standard deviation of split frequencies: 0.019368

      130500 -- [-1013.425] (-1012.893) (-1017.885) (-1014.354) * (-1017.068) [-1017.231] (-1016.243) (-1022.265) -- 0:00:59
      131000 -- [-1014.956] (-1014.061) (-1017.154) (-1015.408) * (-1016.109) (-1012.745) [-1014.425] (-1013.181) -- 0:00:59
      131500 -- (-1015.952) [-1014.080] (-1012.364) (-1020.887) * (-1015.508) (-1012.783) (-1018.667) [-1014.836] -- 0:00:59
      132000 -- [-1016.101] (-1015.950) (-1012.630) (-1017.094) * (-1013.519) (-1017.478) (-1015.012) [-1013.915] -- 0:00:59
      132500 -- (-1017.350) (-1015.953) [-1013.067] (-1015.684) * [-1014.224] (-1016.931) (-1013.715) (-1017.616) -- 0:00:58
      133000 -- (-1021.943) (-1015.690) (-1013.416) [-1015.379] * [-1013.061] (-1016.788) (-1013.684) (-1016.477) -- 0:00:58
      133500 -- [-1014.476] (-1015.670) (-1013.280) (-1015.198) * (-1016.755) (-1017.841) (-1013.210) [-1021.467] -- 0:00:58
      134000 -- (-1014.389) (-1014.708) (-1014.182) [-1016.193] * [-1018.581] (-1017.564) (-1014.657) (-1016.895) -- 0:00:58
      134500 -- (-1013.277) (-1015.295) (-1016.634) [-1018.438] * (-1018.218) (-1013.633) [-1013.225] (-1013.022) -- 0:00:57
      135000 -- (-1014.012) (-1015.959) [-1012.847] (-1015.330) * [-1014.077] (-1021.607) (-1015.668) (-1013.033) -- 0:00:57

      Average standard deviation of split frequencies: 0.017943

      135500 -- [-1012.718] (-1014.715) (-1013.095) (-1015.288) * [-1014.008] (-1014.516) (-1014.114) (-1013.294) -- 0:00:57
      136000 -- (-1013.152) [-1013.651] (-1014.315) (-1013.422) * (-1014.183) [-1014.621] (-1020.885) (-1013.760) -- 0:00:57
      136500 -- (-1013.301) (-1012.755) [-1013.321] (-1013.191) * (-1013.301) (-1014.355) (-1023.375) [-1018.319] -- 0:00:56
      137000 -- (-1015.476) (-1013.236) (-1016.414) [-1016.100] * [-1013.222] (-1013.781) (-1017.562) (-1014.587) -- 0:00:56
      137500 -- (-1016.988) (-1014.375) [-1016.131] (-1016.618) * [-1014.858] (-1016.404) (-1018.918) (-1013.311) -- 0:00:56
      138000 -- (-1015.321) [-1016.086] (-1014.488) (-1015.495) * (-1017.730) (-1015.476) (-1015.178) [-1014.063] -- 0:00:56
      138500 -- [-1012.897] (-1014.254) (-1013.717) (-1016.782) * [-1015.643] (-1015.091) (-1020.076) (-1012.772) -- 0:00:55
      139000 -- [-1012.959] (-1014.340) (-1013.726) (-1013.698) * (-1013.693) [-1015.741] (-1016.270) (-1012.793) -- 0:00:55
      139500 -- (-1013.411) (-1012.692) [-1013.001] (-1013.493) * (-1017.274) [-1015.768] (-1013.668) (-1013.671) -- 0:00:55
      140000 -- (-1013.750) [-1014.007] (-1014.653) (-1014.627) * (-1015.131) (-1016.300) [-1013.446] (-1014.111) -- 0:00:55

      Average standard deviation of split frequencies: 0.019269

      140500 -- [-1014.459] (-1013.670) (-1016.163) (-1017.843) * (-1014.452) (-1016.994) [-1013.857] (-1015.702) -- 0:00:55
      141000 -- [-1014.044] (-1017.185) (-1014.328) (-1015.010) * (-1015.134) [-1013.933] (-1013.038) (-1014.559) -- 0:00:54
      141500 -- [-1013.684] (-1016.324) (-1014.572) (-1016.134) * (-1016.560) (-1013.332) (-1014.585) [-1015.587] -- 0:00:54
      142000 -- (-1014.731) (-1016.252) (-1013.579) [-1014.863] * (-1015.335) [-1013.007] (-1013.116) (-1014.999) -- 0:00:54
      142500 -- (-1014.045) [-1013.258] (-1015.550) (-1015.201) * (-1024.359) (-1015.145) [-1012.786] (-1014.054) -- 0:00:54
      143000 -- [-1013.486] (-1013.770) (-1016.692) (-1012.988) * (-1013.552) (-1013.622) [-1015.854] (-1013.498) -- 0:00:53
      143500 -- (-1014.415) (-1013.847) [-1014.058] (-1012.815) * (-1018.824) [-1014.096] (-1013.054) (-1016.770) -- 0:00:59
      144000 -- (-1015.012) (-1015.317) [-1014.171] (-1013.921) * [-1018.345] (-1012.499) (-1015.808) (-1017.181) -- 0:00:59
      144500 -- (-1014.754) (-1016.232) (-1014.912) [-1014.499] * (-1019.531) (-1012.509) (-1015.702) [-1017.422] -- 0:00:59
      145000 -- (-1012.684) (-1016.094) [-1014.524] (-1013.677) * (-1021.105) (-1015.014) [-1013.651] (-1013.958) -- 0:00:58

      Average standard deviation of split frequencies: 0.018297

      145500 -- [-1017.124] (-1015.355) (-1014.569) (-1013.600) * [-1016.222] (-1014.504) (-1015.055) (-1014.146) -- 0:00:58
      146000 -- [-1022.528] (-1012.856) (-1014.581) (-1014.177) * (-1014.261) (-1013.800) (-1015.371) [-1014.331] -- 0:00:58
      146500 -- [-1015.401] (-1017.945) (-1014.506) (-1014.029) * [-1013.873] (-1014.896) (-1013.758) (-1014.691) -- 0:00:58
      147000 -- (-1012.802) (-1016.728) [-1013.456] (-1013.431) * [-1013.071] (-1013.506) (-1015.410) (-1016.256) -- 0:00:58
      147500 -- (-1013.777) (-1016.137) (-1017.207) [-1017.553] * (-1014.318) (-1013.616) (-1016.461) [-1013.485] -- 0:00:57
      148000 -- (-1019.378) (-1016.760) (-1017.240) [-1013.184] * (-1015.959) [-1013.034] (-1013.733) (-1014.872) -- 0:00:57
      148500 -- [-1015.486] (-1014.748) (-1015.404) (-1015.490) * (-1014.223) (-1012.905) [-1013.806] (-1016.624) -- 0:00:57
      149000 -- (-1016.684) [-1013.320] (-1015.710) (-1015.294) * (-1020.503) [-1015.254] (-1019.725) (-1013.989) -- 0:00:57
      149500 -- (-1016.389) (-1012.336) (-1019.880) [-1014.085] * [-1015.481] (-1013.122) (-1015.644) (-1016.754) -- 0:00:56
      150000 -- (-1015.945) (-1019.141) (-1014.281) [-1015.523] * (-1016.056) (-1014.097) (-1012.935) [-1019.092] -- 0:00:56

      Average standard deviation of split frequencies: 0.017382

      150500 -- (-1016.779) (-1015.091) [-1013.326] (-1015.047) * (-1014.216) [-1014.684] (-1014.742) (-1017.390) -- 0:00:56
      151000 -- (-1015.126) [-1016.047] (-1013.539) (-1016.672) * (-1012.961) [-1014.459] (-1015.280) (-1014.481) -- 0:00:56
      151500 -- (-1013.296) (-1016.273) [-1012.355] (-1016.844) * [-1014.876] (-1018.333) (-1015.836) (-1015.502) -- 0:00:56
      152000 -- (-1013.440) [-1017.717] (-1012.351) (-1014.956) * (-1014.230) [-1013.998] (-1014.835) (-1016.044) -- 0:00:55
      152500 -- (-1015.308) (-1015.131) (-1014.235) [-1015.202] * [-1016.397] (-1016.150) (-1014.361) (-1015.225) -- 0:00:55
      153000 -- (-1014.237) (-1014.190) [-1013.321] (-1014.770) * [-1015.853] (-1014.529) (-1014.130) (-1013.360) -- 0:00:55
      153500 -- (-1014.459) (-1013.867) (-1014.410) [-1013.045] * (-1015.270) [-1013.041] (-1015.324) (-1015.463) -- 0:00:55
      154000 -- [-1015.491] (-1013.947) (-1013.495) (-1013.743) * (-1016.565) [-1014.465] (-1019.084) (-1012.555) -- 0:00:54
      154500 -- (-1018.004) (-1017.421) (-1015.362) [-1014.010] * (-1014.747) (-1013.156) (-1018.034) [-1012.674] -- 0:00:54
      155000 -- (-1014.983) (-1016.090) (-1015.137) [-1013.948] * [-1018.066] (-1013.156) (-1016.755) (-1016.179) -- 0:00:54

      Average standard deviation of split frequencies: 0.017124

      155500 -- (-1015.883) (-1014.683) (-1013.838) [-1013.146] * [-1013.899] (-1015.633) (-1013.824) (-1017.359) -- 0:00:54
      156000 -- (-1017.475) [-1015.350] (-1013.209) (-1014.671) * [-1013.911] (-1013.639) (-1016.399) (-1016.309) -- 0:00:54
      156500 -- (-1014.149) (-1013.858) (-1013.695) [-1014.509] * (-1013.802) (-1014.240) (-1016.345) [-1014.993] -- 0:00:53
      157000 -- [-1014.350] (-1014.940) (-1014.896) (-1013.311) * [-1015.233] (-1014.063) (-1013.285) (-1021.323) -- 0:00:53
      157500 -- (-1013.173) (-1014.126) (-1019.902) [-1013.884] * (-1013.573) [-1014.256] (-1014.751) (-1014.068) -- 0:00:53
      158000 -- [-1013.202] (-1017.120) (-1016.102) (-1015.547) * (-1015.161) (-1015.311) (-1013.556) [-1015.788] -- 0:00:53
      158500 -- (-1013.129) (-1014.984) (-1017.006) [-1015.039] * (-1016.396) (-1014.984) [-1013.353] (-1016.543) -- 0:00:53
      159000 -- (-1018.709) (-1014.152) (-1014.516) [-1013.916] * (-1012.702) (-1014.383) (-1014.456) [-1016.230] -- 0:00:52
      159500 -- (-1016.945) (-1013.148) [-1013.736] (-1020.593) * (-1013.471) [-1013.156] (-1018.971) (-1014.262) -- 0:00:57
      160000 -- (-1015.307) (-1016.759) [-1017.250] (-1019.942) * (-1015.015) (-1014.107) [-1019.247] (-1014.970) -- 0:00:57

      Average standard deviation of split frequencies: 0.018467

      160500 -- (-1018.346) (-1014.044) [-1015.622] (-1015.431) * (-1012.951) [-1013.753] (-1017.698) (-1015.162) -- 0:00:57
      161000 -- (-1013.859) (-1015.421) [-1014.806] (-1015.449) * (-1013.091) (-1015.509) (-1014.724) [-1015.865] -- 0:00:57
      161500 -- (-1016.962) (-1018.091) (-1015.507) [-1014.033] * (-1013.807) (-1015.639) (-1013.247) [-1015.009] -- 0:00:57
      162000 -- [-1014.840] (-1014.544) (-1015.324) (-1015.347) * [-1014.387] (-1014.258) (-1015.756) (-1014.226) -- 0:00:56
      162500 -- (-1016.201) (-1014.190) [-1013.297] (-1013.617) * (-1014.895) (-1013.770) [-1017.680] (-1014.666) -- 0:00:56
      163000 -- (-1016.210) (-1016.801) [-1013.670] (-1014.592) * (-1014.898) [-1014.428] (-1013.876) (-1015.636) -- 0:00:56
      163500 -- (-1013.063) (-1015.943) [-1014.759] (-1014.129) * (-1017.731) [-1014.182] (-1017.377) (-1014.313) -- 0:00:56
      164000 -- (-1016.592) (-1023.154) (-1013.914) [-1013.778] * (-1014.976) [-1014.054] (-1015.639) (-1013.215) -- 0:00:56
      164500 -- (-1014.418) (-1015.163) [-1012.844] (-1013.369) * (-1014.088) [-1012.894] (-1017.506) (-1015.057) -- 0:00:55
      165000 -- [-1015.415] (-1019.370) (-1014.166) (-1019.154) * (-1015.555) [-1013.662] (-1013.718) (-1014.063) -- 0:00:55

      Average standard deviation of split frequencies: 0.019043

      165500 -- [-1013.525] (-1016.848) (-1013.814) (-1014.739) * (-1014.522) (-1013.548) [-1019.536] (-1015.148) -- 0:00:55
      166000 -- [-1013.926] (-1014.806) (-1013.714) (-1016.036) * (-1016.924) [-1012.979] (-1019.443) (-1019.629) -- 0:00:55
      166500 -- (-1021.192) (-1016.191) (-1013.614) [-1014.559] * (-1015.913) (-1012.425) [-1016.499] (-1017.326) -- 0:00:55
      167000 -- (-1016.377) (-1016.564) (-1014.491) [-1019.254] * (-1014.276) [-1012.390] (-1014.361) (-1018.030) -- 0:00:54
      167500 -- (-1017.502) [-1014.412] (-1014.241) (-1017.285) * [-1013.317] (-1012.682) (-1013.405) (-1016.563) -- 0:00:54
      168000 -- (-1018.714) (-1014.989) [-1016.151] (-1014.114) * (-1014.235) (-1018.015) [-1015.215] (-1015.172) -- 0:00:54
      168500 -- [-1020.923] (-1014.707) (-1013.762) (-1012.607) * (-1015.004) (-1015.918) [-1016.304] (-1013.866) -- 0:00:54
      169000 -- (-1014.040) (-1015.981) (-1015.642) [-1014.900] * (-1013.564) (-1017.307) (-1014.202) [-1013.343] -- 0:00:54
      169500 -- [-1015.155] (-1013.165) (-1015.661) (-1013.333) * (-1014.432) (-1018.141) [-1014.489] (-1019.414) -- 0:00:53
      170000 -- (-1013.101) (-1016.898) [-1012.584] (-1015.255) * (-1013.137) (-1016.351) (-1014.557) [-1014.313] -- 0:00:53

      Average standard deviation of split frequencies: 0.020310

      170500 -- (-1016.303) (-1014.099) [-1012.954] (-1017.821) * [-1014.442] (-1012.658) (-1016.414) (-1016.266) -- 0:00:53
      171000 -- [-1016.996] (-1014.507) (-1013.682) (-1013.302) * [-1014.787] (-1015.340) (-1016.565) (-1015.217) -- 0:00:53
      171500 -- (-1014.971) (-1015.012) [-1014.318] (-1015.834) * [-1015.426] (-1014.538) (-1016.255) (-1015.084) -- 0:00:53
      172000 -- (-1013.483) [-1016.203] (-1015.421) (-1019.270) * (-1019.125) (-1016.205) [-1015.038] (-1015.337) -- 0:00:52
      172500 -- (-1015.510) (-1016.302) [-1015.635] (-1015.323) * (-1016.360) [-1015.559] (-1013.016) (-1015.724) -- 0:00:52
      173000 -- [-1014.085] (-1013.708) (-1015.456) (-1014.408) * (-1018.294) (-1016.115) [-1014.272] (-1017.662) -- 0:00:52
      173500 -- (-1017.226) (-1017.956) (-1013.660) [-1016.950] * (-1015.904) (-1018.336) [-1013.092] (-1014.387) -- 0:00:52
      174000 -- (-1015.006) (-1017.379) [-1013.432] (-1014.291) * (-1014.371) (-1014.915) (-1012.697) [-1015.000] -- 0:00:52
      174500 -- (-1014.196) (-1013.025) [-1014.642] (-1014.611) * (-1013.719) (-1014.113) (-1016.378) [-1014.385] -- 0:00:52
      175000 -- (-1014.829) [-1013.400] (-1013.384) (-1018.152) * (-1013.274) (-1012.688) [-1016.199] (-1016.115) -- 0:00:51

      Average standard deviation of split frequencies: 0.020009

      175500 -- [-1014.867] (-1015.091) (-1014.303) (-1014.526) * (-1016.813) (-1012.757) (-1017.622) [-1013.936] -- 0:00:51
      176000 -- (-1015.257) [-1013.256] (-1017.065) (-1012.707) * (-1013.203) [-1012.575] (-1015.879) (-1014.765) -- 0:00:56
      176500 -- (-1016.101) (-1014.072) (-1014.803) [-1013.171] * (-1017.276) (-1013.604) (-1015.612) [-1015.471] -- 0:00:55
      177000 -- (-1014.379) [-1015.517] (-1013.150) (-1020.415) * (-1026.219) (-1012.830) (-1014.345) [-1013.285] -- 0:00:55
      177500 -- (-1017.063) (-1014.309) (-1015.060) [-1017.207] * (-1018.804) (-1012.597) [-1014.781] (-1015.037) -- 0:00:55
      178000 -- [-1013.129] (-1014.716) (-1013.936) (-1013.760) * (-1012.908) [-1013.007] (-1016.521) (-1015.264) -- 0:00:55
      178500 -- [-1013.601] (-1014.204) (-1013.771) (-1014.828) * (-1013.554) (-1013.009) [-1015.951] (-1016.434) -- 0:00:55
      179000 -- (-1014.210) (-1014.611) [-1014.306] (-1017.870) * [-1017.026] (-1015.054) (-1016.441) (-1013.433) -- 0:00:55
      179500 -- (-1014.071) (-1012.791) [-1014.582] (-1020.207) * (-1015.833) [-1014.946] (-1015.026) (-1016.018) -- 0:00:54
      180000 -- (-1018.570) [-1015.022] (-1015.480) (-1023.579) * (-1014.559) (-1015.565) (-1013.391) [-1014.749] -- 0:00:54

      Average standard deviation of split frequencies: 0.019953

      180500 -- (-1016.158) (-1015.550) (-1016.961) [-1016.746] * [-1016.442] (-1017.149) (-1015.538) (-1014.052) -- 0:00:54
      181000 -- [-1016.071] (-1016.247) (-1018.022) (-1013.262) * (-1016.887) (-1019.917) [-1014.766] (-1014.209) -- 0:00:54
      181500 -- (-1014.684) (-1013.052) (-1017.116) [-1012.785] * (-1018.743) [-1015.516] (-1018.156) (-1013.197) -- 0:00:54
      182000 -- (-1014.521) (-1017.506) [-1016.925] (-1012.853) * (-1015.428) (-1016.005) [-1016.919] (-1016.630) -- 0:00:53
      182500 -- (-1013.326) (-1015.274) (-1020.859) [-1013.750] * [-1013.224] (-1013.330) (-1019.044) (-1013.697) -- 0:00:53
      183000 -- (-1015.800) (-1014.845) [-1015.668] (-1013.742) * (-1015.353) (-1015.671) [-1017.696] (-1013.194) -- 0:00:53
      183500 -- [-1016.180] (-1017.791) (-1017.160) (-1014.505) * (-1015.041) [-1014.719] (-1019.065) (-1013.617) -- 0:00:53
      184000 -- (-1015.845) [-1013.367] (-1016.734) (-1023.766) * (-1013.620) (-1016.787) (-1018.334) [-1015.068] -- 0:00:53
      184500 -- (-1014.618) (-1014.430) (-1017.225) [-1017.488] * (-1013.774) (-1015.418) [-1016.380] (-1016.138) -- 0:00:53
      185000 -- (-1018.303) (-1013.312) (-1017.115) [-1015.246] * (-1017.522) (-1012.447) (-1013.297) [-1015.918] -- 0:00:52

      Average standard deviation of split frequencies: 0.018337

      185500 -- (-1012.819) (-1013.799) (-1015.548) [-1014.471] * (-1013.494) (-1012.920) (-1013.883) [-1014.461] -- 0:00:52
      186000 -- (-1013.001) (-1014.328) [-1014.144] (-1013.333) * (-1014.527) (-1013.058) (-1013.226) [-1014.175] -- 0:00:52
      186500 -- (-1015.987) [-1015.688] (-1015.500) (-1015.327) * (-1017.082) (-1015.317) (-1017.236) [-1014.909] -- 0:00:52
      187000 -- (-1013.689) (-1016.899) (-1015.153) [-1013.893] * [-1015.952] (-1014.595) (-1016.593) (-1013.645) -- 0:00:52
      187500 -- (-1014.467) [-1016.383] (-1013.313) (-1014.105) * (-1015.393) (-1015.218) [-1012.924] (-1012.727) -- 0:00:52
      188000 -- (-1013.509) (-1014.122) (-1013.339) [-1013.399] * (-1015.067) (-1014.501) [-1012.901] (-1012.263) -- 0:00:51
      188500 -- (-1013.968) (-1013.060) [-1016.497] (-1014.035) * (-1014.303) [-1016.502] (-1015.837) (-1015.633) -- 0:00:51
      189000 -- (-1012.692) [-1013.497] (-1016.043) (-1015.919) * (-1014.007) [-1017.144] (-1015.341) (-1019.837) -- 0:00:51
      189500 -- [-1013.699] (-1012.557) (-1015.798) (-1014.180) * (-1013.899) [-1015.140] (-1018.078) (-1013.615) -- 0:00:51
      190000 -- (-1015.576) [-1012.724] (-1014.900) (-1017.959) * (-1014.104) (-1013.496) [-1013.698] (-1013.001) -- 0:00:51

      Average standard deviation of split frequencies: 0.018325

      190500 -- (-1013.504) [-1012.707] (-1015.225) (-1015.241) * [-1013.942] (-1015.898) (-1015.727) (-1013.565) -- 0:00:50
      191000 -- (-1015.338) (-1015.490) (-1015.442) [-1014.074] * [-1015.946] (-1017.627) (-1014.239) (-1014.588) -- 0:00:50
      191500 -- (-1013.489) (-1015.650) (-1014.884) [-1017.324] * [-1014.237] (-1013.835) (-1016.112) (-1014.358) -- 0:00:50
      192000 -- (-1012.434) (-1016.203) [-1012.355] (-1016.866) * [-1014.364] (-1015.538) (-1014.617) (-1013.708) -- 0:00:54
      192500 -- (-1015.016) (-1017.927) (-1012.631) [-1012.654] * [-1016.487] (-1015.926) (-1015.007) (-1013.945) -- 0:00:54
      193000 -- (-1012.965) (-1019.185) [-1012.996] (-1012.743) * (-1016.787) (-1015.029) [-1018.677] (-1013.462) -- 0:00:54
      193500 -- (-1015.134) (-1013.925) [-1013.471] (-1015.176) * (-1013.160) (-1014.542) (-1016.418) [-1014.816] -- 0:00:54
      194000 -- (-1016.482) (-1012.636) [-1016.543] (-1014.181) * (-1015.392) (-1014.536) [-1013.460] (-1018.320) -- 0:00:54
      194500 -- (-1016.646) (-1015.006) (-1016.264) [-1014.393] * (-1016.579) (-1018.196) [-1013.934] (-1019.918) -- 0:00:53
      195000 -- (-1018.875) (-1014.854) [-1014.350] (-1013.594) * (-1013.763) [-1017.449] (-1015.895) (-1020.301) -- 0:00:53

      Average standard deviation of split frequencies: 0.018339

      195500 -- [-1012.562] (-1014.109) (-1013.236) (-1018.149) * (-1013.475) [-1014.458] (-1014.305) (-1017.060) -- 0:00:53
      196000 -- (-1014.902) (-1017.453) (-1014.678) [-1016.575] * (-1013.136) [-1013.700] (-1013.280) (-1013.315) -- 0:00:53
      196500 -- [-1016.626] (-1016.932) (-1013.869) (-1013.760) * [-1014.362] (-1016.329) (-1016.240) (-1012.708) -- 0:00:53
      197000 -- (-1014.980) (-1014.115) (-1013.959) [-1014.525] * [-1014.200] (-1013.705) (-1018.915) (-1012.770) -- 0:00:52
      197500 -- (-1016.222) (-1015.274) [-1013.528] (-1013.463) * (-1016.416) [-1013.880] (-1017.171) (-1013.679) -- 0:00:52
      198000 -- (-1021.908) [-1019.593] (-1015.072) (-1016.037) * (-1017.476) [-1016.864] (-1015.454) (-1013.588) -- 0:00:52
      198500 -- [-1013.501] (-1018.672) (-1013.256) (-1014.383) * (-1015.961) (-1018.166) [-1017.850] (-1013.596) -- 0:00:52
      199000 -- [-1013.337] (-1013.824) (-1015.789) (-1014.899) * (-1016.000) [-1013.774] (-1015.639) (-1014.792) -- 0:00:52
      199500 -- (-1013.894) [-1014.227] (-1018.177) (-1015.087) * (-1013.293) (-1018.725) [-1013.170] (-1013.842) -- 0:00:52
      200000 -- [-1013.415] (-1014.309) (-1016.925) (-1016.669) * (-1015.551) (-1016.782) [-1013.924] (-1015.207) -- 0:00:51

      Average standard deviation of split frequencies: 0.017412

      200500 -- (-1016.089) (-1015.442) [-1016.775] (-1013.276) * (-1016.588) (-1016.586) (-1015.696) [-1013.237] -- 0:00:51
      201000 -- (-1013.622) (-1013.847) [-1012.619] (-1013.980) * (-1017.544) [-1014.970] (-1015.516) (-1016.085) -- 0:00:51
      201500 -- (-1015.129) (-1017.090) [-1013.407] (-1014.132) * [-1015.152] (-1016.643) (-1016.398) (-1014.677) -- 0:00:51
      202000 -- [-1017.932] (-1018.469) (-1015.320) (-1012.952) * (-1013.843) (-1015.136) (-1016.345) [-1014.684] -- 0:00:51
      202500 -- (-1022.144) (-1020.627) [-1013.753] (-1014.572) * (-1020.410) [-1013.114] (-1014.484) (-1014.494) -- 0:00:51
      203000 -- (-1021.812) (-1013.453) (-1013.099) [-1015.673] * (-1016.759) (-1015.651) (-1016.588) [-1014.495] -- 0:00:51
      203500 -- (-1013.207) (-1014.131) [-1013.595] (-1014.469) * (-1013.493) [-1018.087] (-1015.205) (-1015.369) -- 0:00:50
      204000 -- (-1013.121) [-1015.376] (-1013.636) (-1015.689) * (-1014.064) (-1020.564) [-1013.727] (-1013.152) -- 0:00:50
      204500 -- [-1012.419] (-1014.411) (-1015.868) (-1019.293) * (-1014.222) (-1018.017) (-1014.755) [-1012.458] -- 0:00:50
      205000 -- [-1013.266] (-1013.684) (-1017.379) (-1013.132) * (-1016.794) (-1019.468) (-1016.472) [-1012.497] -- 0:00:50

      Average standard deviation of split frequencies: 0.017499

      205500 -- [-1013.309] (-1015.012) (-1015.228) (-1012.606) * [-1012.921] (-1020.604) (-1013.644) (-1012.972) -- 0:00:50
      206000 -- (-1017.270) [-1013.914] (-1015.971) (-1017.495) * (-1012.672) (-1013.542) [-1014.811] (-1013.454) -- 0:00:50
      206500 -- (-1024.329) (-1015.281) (-1013.783) [-1015.937] * (-1014.205) (-1015.276) [-1015.621] (-1015.954) -- 0:00:49
      207000 -- [-1017.409] (-1019.510) (-1012.958) (-1014.523) * (-1013.430) (-1014.641) (-1016.332) [-1015.820] -- 0:00:49
      207500 -- (-1013.754) (-1013.596) (-1013.569) [-1015.355] * [-1014.416] (-1013.396) (-1017.861) (-1014.263) -- 0:00:49
      208000 -- (-1013.776) (-1013.528) (-1016.372) [-1015.209] * (-1015.115) (-1012.556) (-1017.631) [-1015.814] -- 0:00:49
      208500 -- (-1014.329) [-1014.900] (-1012.856) (-1014.473) * [-1016.445] (-1013.603) (-1015.940) (-1014.443) -- 0:00:53
      209000 -- (-1015.768) [-1015.071] (-1013.342) (-1014.240) * (-1015.234) (-1014.797) (-1013.032) [-1014.611] -- 0:00:52
      209500 -- [-1017.249] (-1015.848) (-1017.712) (-1013.146) * (-1017.422) (-1015.258) (-1015.087) [-1014.835] -- 0:00:52
      210000 -- (-1014.462) (-1018.137) (-1012.464) [-1016.877] * (-1014.299) (-1016.464) (-1014.677) [-1013.430] -- 0:00:52

      Average standard deviation of split frequencies: 0.017156

      210500 -- (-1016.311) (-1016.129) (-1017.605) [-1012.908] * (-1015.750) (-1015.613) [-1014.216] (-1016.491) -- 0:00:52
      211000 -- (-1014.302) (-1016.834) (-1016.728) [-1013.454] * (-1014.233) (-1014.282) [-1012.765] (-1017.593) -- 0:00:52
      211500 -- (-1013.539) [-1016.440] (-1014.298) (-1014.735) * (-1016.375) [-1014.054] (-1013.613) (-1019.070) -- 0:00:52
      212000 -- (-1014.340) [-1014.141] (-1012.677) (-1013.877) * (-1013.501) (-1013.805) [-1013.957] (-1018.115) -- 0:00:52
      212500 -- (-1014.210) (-1016.874) [-1014.880] (-1015.440) * (-1013.871) (-1014.320) [-1013.509] (-1016.220) -- 0:00:51
      213000 -- [-1013.644] (-1017.292) (-1016.808) (-1013.351) * (-1016.349) (-1016.878) (-1014.561) [-1013.246] -- 0:00:51
      213500 -- (-1014.084) (-1017.702) [-1015.700] (-1016.793) * (-1021.578) [-1017.548] (-1017.105) (-1013.764) -- 0:00:51
      214000 -- (-1014.017) [-1016.768] (-1019.190) (-1014.086) * (-1016.277) (-1015.786) [-1013.658] (-1014.180) -- 0:00:51
      214500 -- (-1013.404) (-1016.975) [-1013.912] (-1016.615) * (-1013.802) [-1013.609] (-1016.275) (-1015.964) -- 0:00:51
      215000 -- [-1012.856] (-1016.906) (-1014.315) (-1014.857) * (-1017.314) (-1014.093) [-1016.582] (-1018.936) -- 0:00:51

      Average standard deviation of split frequencies: 0.016047

      215500 -- (-1012.395) [-1014.067] (-1014.577) (-1015.490) * (-1017.902) (-1017.569) (-1019.034) [-1018.222] -- 0:00:50
      216000 -- [-1013.779] (-1018.644) (-1013.507) (-1019.731) * (-1016.107) (-1014.277) (-1012.774) [-1016.550] -- 0:00:50
      216500 -- (-1016.401) [-1021.832] (-1016.911) (-1019.511) * (-1014.392) [-1015.432] (-1012.621) (-1016.411) -- 0:00:50
      217000 -- (-1015.640) [-1012.400] (-1015.695) (-1015.903) * (-1013.801) [-1016.437] (-1014.217) (-1015.904) -- 0:00:50
      217500 -- [-1012.319] (-1015.523) (-1016.348) (-1014.187) * (-1015.637) [-1019.413] (-1014.018) (-1017.352) -- 0:00:50
      218000 -- (-1012.509) (-1019.477) (-1023.644) [-1014.171] * (-1013.434) (-1013.785) (-1015.597) [-1014.656] -- 0:00:50
      218500 -- (-1015.658) (-1018.581) [-1020.758] (-1017.495) * (-1017.348) (-1014.419) (-1012.781) [-1014.286] -- 0:00:50
      219000 -- (-1013.679) [-1016.912] (-1015.189) (-1016.285) * [-1014.821] (-1013.638) (-1018.876) (-1014.287) -- 0:00:49
      219500 -- [-1016.100] (-1013.628) (-1014.957) (-1014.892) * (-1015.528) [-1013.364] (-1013.226) (-1014.628) -- 0:00:49
      220000 -- (-1015.559) (-1015.253) [-1014.665] (-1015.641) * (-1014.369) [-1014.342] (-1012.883) (-1017.648) -- 0:00:49

      Average standard deviation of split frequencies: 0.015488

      220500 -- [-1012.558] (-1014.847) (-1017.159) (-1014.496) * [-1015.064] (-1014.004) (-1012.883) (-1015.900) -- 0:00:49
      221000 -- (-1013.692) (-1015.111) (-1018.770) [-1015.023] * [-1014.662] (-1013.917) (-1013.847) (-1015.456) -- 0:00:49
      221500 -- (-1012.833) (-1014.830) [-1014.305] (-1014.003) * (-1015.333) [-1016.113] (-1016.499) (-1013.740) -- 0:00:49
      222000 -- (-1014.528) [-1016.005] (-1014.298) (-1013.832) * (-1017.445) (-1016.686) [-1016.066] (-1016.734) -- 0:00:52
      222500 -- (-1012.462) [-1014.478] (-1013.307) (-1017.860) * (-1013.600) [-1020.252] (-1018.102) (-1015.146) -- 0:00:52
      223000 -- (-1012.618) [-1017.375] (-1014.088) (-1018.409) * (-1016.516) [-1018.335] (-1017.874) (-1014.938) -- 0:00:52
      223500 -- (-1014.967) (-1013.114) [-1013.640] (-1013.135) * (-1015.362) [-1013.470] (-1015.672) (-1019.462) -- 0:00:52
      224000 -- (-1015.544) (-1013.880) (-1014.897) [-1013.046] * (-1015.833) [-1013.340] (-1019.958) (-1014.604) -- 0:00:51
      224500 -- [-1013.228] (-1014.420) (-1014.499) (-1014.389) * (-1012.961) (-1016.412) (-1020.490) [-1013.898] -- 0:00:51
      225000 -- (-1014.535) [-1014.125] (-1013.157) (-1014.774) * (-1013.226) (-1016.112) (-1019.212) [-1015.453] -- 0:00:51

      Average standard deviation of split frequencies: 0.015705

      225500 -- (-1016.460) (-1013.969) [-1013.142] (-1014.796) * (-1012.969) (-1014.685) (-1014.872) [-1015.311] -- 0:00:51
      226000 -- [-1016.595] (-1016.399) (-1013.644) (-1015.516) * (-1018.082) (-1013.555) [-1015.715] (-1016.048) -- 0:00:51
      226500 -- (-1013.957) [-1019.568] (-1014.338) (-1017.033) * [-1013.425] (-1014.571) (-1014.971) (-1016.551) -- 0:00:51
      227000 -- (-1014.074) (-1017.388) [-1023.437] (-1016.284) * [-1012.488] (-1018.396) (-1013.311) (-1014.158) -- 0:00:51
      227500 -- [-1013.583] (-1016.962) (-1016.310) (-1018.990) * (-1012.946) [-1013.926] (-1018.649) (-1013.633) -- 0:00:50
      228000 -- [-1019.323] (-1015.229) (-1014.289) (-1018.738) * (-1012.727) [-1013.479] (-1016.481) (-1014.583) -- 0:00:50
      228500 -- (-1021.008) [-1014.277] (-1014.649) (-1015.012) * (-1014.585) (-1014.911) (-1015.259) [-1014.012] -- 0:00:50
      229000 -- [-1016.381] (-1013.244) (-1013.920) (-1016.257) * (-1017.449) (-1014.448) (-1014.107) [-1015.461] -- 0:00:50
      229500 -- [-1018.220] (-1014.365) (-1012.475) (-1014.658) * (-1015.984) (-1014.920) (-1012.941) [-1017.637] -- 0:00:50
      230000 -- [-1017.003] (-1013.693) (-1014.785) (-1013.207) * [-1016.556] (-1014.024) (-1012.965) (-1015.382) -- 0:00:50

      Average standard deviation of split frequencies: 0.015555

      230500 -- (-1015.616) (-1014.480) [-1015.120] (-1013.107) * (-1018.290) [-1014.002] (-1012.929) (-1013.671) -- 0:00:50
      231000 -- (-1013.736) (-1014.062) (-1015.456) [-1013.512] * (-1014.800) [-1013.871] (-1013.351) (-1014.324) -- 0:00:49
      231500 -- (-1013.791) (-1015.339) [-1015.000] (-1015.260) * [-1014.753] (-1014.773) (-1013.547) (-1014.815) -- 0:00:49
      232000 -- [-1014.993] (-1015.244) (-1015.995) (-1017.272) * (-1017.375) (-1015.590) (-1014.648) [-1018.231] -- 0:00:49
      232500 -- (-1013.310) (-1013.553) [-1014.647] (-1017.783) * (-1018.854) [-1013.400] (-1015.708) (-1014.964) -- 0:00:49
      233000 -- (-1012.869) [-1013.660] (-1013.091) (-1014.899) * [-1015.687] (-1013.254) (-1013.702) (-1014.892) -- 0:00:49
      233500 -- [-1013.942] (-1012.961) (-1015.154) (-1013.639) * (-1015.469) [-1013.516] (-1013.063) (-1017.507) -- 0:00:49
      234000 -- (-1013.727) (-1015.703) [-1015.071] (-1012.732) * (-1015.028) (-1020.019) (-1015.521) [-1013.526] -- 0:00:49
      234500 -- (-1013.782) [-1014.637] (-1014.459) (-1013.145) * (-1016.277) (-1015.363) [-1014.663] (-1014.127) -- 0:00:48
      235000 -- [-1016.292] (-1015.968) (-1013.422) (-1015.154) * (-1013.866) (-1012.496) [-1013.992] (-1013.864) -- 0:00:48

      Average standard deviation of split frequencies: 0.016424

      235500 -- [-1014.683] (-1015.117) (-1013.460) (-1013.006) * (-1013.250) (-1016.863) (-1020.028) [-1015.683] -- 0:00:48
      236000 -- (-1013.235) (-1016.714) (-1014.648) [-1015.759] * (-1014.665) (-1015.169) [-1015.308] (-1014.066) -- 0:00:48
      236500 -- (-1013.675) (-1015.229) [-1014.283] (-1014.100) * (-1013.326) [-1013.943] (-1014.526) (-1015.924) -- 0:00:48
      237000 -- [-1013.075] (-1014.314) (-1013.886) (-1016.053) * (-1015.234) (-1015.127) [-1016.263] (-1017.031) -- 0:00:48
      237500 -- (-1012.960) (-1014.583) [-1013.510] (-1014.309) * (-1012.575) [-1017.335] (-1014.013) (-1015.929) -- 0:00:48
      238000 -- (-1015.170) [-1013.991] (-1012.865) (-1014.792) * (-1012.644) (-1014.838) (-1013.504) [-1014.525] -- 0:00:48
      238500 -- (-1016.904) (-1015.117) [-1014.650] (-1018.798) * [-1014.599] (-1014.258) (-1014.921) (-1016.256) -- 0:00:51
      239000 -- (-1015.781) (-1015.557) (-1017.905) [-1018.859] * (-1014.526) (-1014.351) [-1013.928] (-1014.355) -- 0:00:50
      239500 -- (-1012.963) (-1014.312) [-1015.538] (-1015.283) * (-1015.582) (-1014.493) [-1015.434] (-1014.252) -- 0:00:50
      240000 -- (-1014.943) [-1013.948] (-1013.913) (-1018.526) * (-1015.825) (-1015.773) (-1014.863) [-1014.084] -- 0:00:50

      Average standard deviation of split frequencies: 0.015670

      240500 -- (-1017.463) [-1013.500] (-1014.116) (-1016.488) * [-1017.551] (-1014.161) (-1012.919) (-1013.456) -- 0:00:50
      241000 -- (-1013.509) (-1015.086) [-1015.596] (-1014.022) * (-1016.969) [-1014.775] (-1013.861) (-1014.725) -- 0:00:50
      241500 -- (-1014.589) (-1013.862) [-1018.003] (-1012.860) * (-1015.178) [-1013.322] (-1013.762) (-1014.862) -- 0:00:50
      242000 -- (-1015.007) [-1014.486] (-1018.782) (-1015.073) * (-1015.558) (-1015.249) (-1016.892) [-1013.966] -- 0:00:50
      242500 -- [-1017.452] (-1014.539) (-1019.753) (-1016.901) * (-1013.171) [-1013.417] (-1013.372) (-1013.746) -- 0:00:49
      243000 -- (-1015.193) [-1015.056] (-1014.625) (-1016.280) * [-1014.852] (-1014.380) (-1013.187) (-1016.447) -- 0:00:49
      243500 -- (-1013.715) [-1015.290] (-1015.882) (-1015.481) * (-1016.821) [-1014.656] (-1012.910) (-1019.411) -- 0:00:49
      244000 -- (-1014.705) (-1014.578) (-1015.524) [-1019.258] * [-1013.592] (-1017.308) (-1014.035) (-1016.608) -- 0:00:49
      244500 -- (-1014.442) (-1016.915) [-1012.671] (-1014.319) * (-1013.959) (-1015.114) [-1013.206] (-1019.308) -- 0:00:49
      245000 -- (-1016.930) [-1015.132] (-1012.946) (-1014.151) * [-1015.620] (-1014.128) (-1014.072) (-1016.216) -- 0:00:49

      Average standard deviation of split frequencies: 0.016345

      245500 -- (-1016.049) [-1013.853] (-1015.031) (-1016.645) * [-1019.238] (-1013.944) (-1015.612) (-1018.348) -- 0:00:49
      246000 -- (-1013.800) [-1013.036] (-1016.149) (-1017.032) * (-1014.872) (-1014.577) (-1016.016) [-1014.832] -- 0:00:49
      246500 -- (-1013.933) [-1012.542] (-1013.627) (-1018.866) * [-1014.417] (-1014.594) (-1014.998) (-1014.575) -- 0:00:48
      247000 -- (-1015.096) (-1014.511) (-1014.678) [-1014.468] * (-1015.565) (-1013.590) [-1014.004] (-1016.351) -- 0:00:48
      247500 -- [-1016.880] (-1014.847) (-1017.306) (-1014.850) * (-1013.370) (-1013.809) (-1014.261) [-1014.815] -- 0:00:48
      248000 -- (-1016.594) (-1014.311) (-1017.309) [-1013.539] * (-1017.042) (-1013.653) (-1014.755) [-1013.916] -- 0:00:48
      248500 -- (-1014.922) (-1018.485) [-1012.785] (-1016.754) * (-1016.335) (-1013.581) [-1014.592] (-1016.011) -- 0:00:48
      249000 -- (-1013.753) (-1014.267) (-1013.289) [-1017.118] * [-1013.958] (-1017.181) (-1014.093) (-1018.150) -- 0:00:48
      249500 -- [-1015.400] (-1015.548) (-1014.998) (-1013.007) * (-1019.247) (-1017.752) [-1015.136] (-1015.173) -- 0:00:48
      250000 -- (-1017.953) (-1017.849) [-1014.618] (-1014.524) * (-1018.278) (-1012.949) [-1014.675] (-1013.255) -- 0:00:48

      Average standard deviation of split frequencies: 0.016925

      250500 -- (-1017.915) (-1016.511) [-1014.562] (-1017.452) * [-1015.391] (-1014.445) (-1013.928) (-1015.231) -- 0:00:47
      251000 -- (-1016.696) (-1012.850) (-1020.525) [-1014.562] * [-1014.359] (-1018.325) (-1017.068) (-1017.447) -- 0:00:47
      251500 -- (-1019.898) [-1016.831] (-1014.190) (-1014.964) * [-1012.936] (-1015.170) (-1014.543) (-1013.764) -- 0:00:47
      252000 -- (-1018.776) (-1013.238) (-1013.979) [-1013.770] * (-1013.795) (-1015.854) (-1018.755) [-1012.865] -- 0:00:47
      252500 -- [-1013.455] (-1015.778) (-1013.784) (-1013.142) * (-1013.314) (-1018.051) [-1015.844] (-1013.330) -- 0:00:47
      253000 -- (-1014.943) (-1014.262) [-1014.211] (-1015.867) * (-1015.275) [-1014.667] (-1013.999) (-1015.394) -- 0:00:47
      253500 -- (-1015.051) (-1016.689) [-1014.511] (-1013.866) * (-1015.116) (-1014.689) (-1014.059) [-1013.626] -- 0:00:47
      254000 -- (-1012.396) (-1019.766) (-1015.010) [-1015.051] * (-1013.580) (-1014.727) (-1013.517) [-1014.917] -- 0:00:46
      254500 -- [-1014.778] (-1015.070) (-1015.724) (-1017.323) * (-1016.590) (-1014.046) (-1016.129) [-1015.930] -- 0:00:46
      255000 -- (-1012.675) (-1016.062) [-1014.751] (-1015.102) * (-1016.566) (-1014.524) [-1013.942] (-1012.709) -- 0:00:49

      Average standard deviation of split frequencies: 0.015923

      255500 -- (-1014.046) (-1014.412) (-1014.876) [-1014.907] * (-1015.348) [-1012.594] (-1013.439) (-1012.365) -- 0:00:49
      256000 -- (-1017.229) (-1017.933) [-1012.481] (-1015.044) * (-1015.570) (-1013.937) (-1015.401) [-1013.694] -- 0:00:49
      256500 -- (-1016.184) (-1016.323) (-1013.280) [-1015.497] * (-1015.405) [-1015.217] (-1019.102) (-1013.865) -- 0:00:49
      257000 -- (-1015.288) (-1015.932) [-1013.100] (-1015.678) * (-1016.933) (-1016.034) (-1014.663) [-1017.743] -- 0:00:49
      257500 -- (-1013.328) [-1013.569] (-1013.846) (-1014.577) * [-1015.592] (-1014.513) (-1017.892) (-1013.761) -- 0:00:49
      258000 -- (-1013.656) (-1019.037) (-1013.783) [-1014.332] * [-1015.671] (-1015.536) (-1020.503) (-1014.804) -- 0:00:48
      258500 -- (-1013.158) (-1014.483) [-1014.175] (-1016.852) * (-1016.582) (-1014.727) [-1013.843] (-1015.239) -- 0:00:48
      259000 -- (-1013.647) (-1015.108) (-1015.907) [-1012.874] * (-1013.852) [-1013.745] (-1015.372) (-1015.444) -- 0:00:48
      259500 -- (-1013.107) [-1016.529] (-1013.456) (-1014.956) * [-1012.981] (-1014.379) (-1013.033) (-1016.762) -- 0:00:48
      260000 -- (-1017.516) [-1018.969] (-1012.502) (-1015.254) * (-1014.466) (-1014.652) (-1016.834) [-1015.741] -- 0:00:48

      Average standard deviation of split frequencies: 0.016477

      260500 -- (-1015.565) [-1015.926] (-1014.989) (-1013.902) * (-1014.054) (-1022.932) [-1013.232] (-1013.042) -- 0:00:48
      261000 -- (-1013.476) (-1014.538) (-1012.842) [-1014.724] * (-1015.727) (-1013.230) (-1014.915) [-1013.859] -- 0:00:48
      261500 -- (-1012.807) (-1020.295) (-1014.157) [-1014.513] * [-1015.589] (-1019.716) (-1013.751) (-1015.374) -- 0:00:48
      262000 -- (-1012.546) [-1017.318] (-1016.361) (-1012.947) * (-1015.273) (-1017.281) [-1014.002] (-1016.960) -- 0:00:47
      262500 -- (-1013.480) (-1017.066) (-1017.290) [-1015.426] * (-1012.840) (-1014.961) (-1014.177) [-1014.778] -- 0:00:47
      263000 -- (-1013.482) (-1014.057) [-1015.225] (-1017.473) * (-1014.924) (-1014.742) (-1014.996) [-1014.580] -- 0:00:47
      263500 -- [-1013.909] (-1013.627) (-1015.071) (-1015.599) * (-1016.488) [-1014.800] (-1015.277) (-1013.230) -- 0:00:47
      264000 -- (-1015.475) (-1014.348) (-1014.418) [-1016.749] * (-1013.322) (-1015.725) (-1018.483) [-1013.440] -- 0:00:47
      264500 -- [-1015.109] (-1015.972) (-1015.449) (-1019.860) * [-1014.900] (-1019.315) (-1016.583) (-1014.447) -- 0:00:47
      265000 -- [-1017.193] (-1017.658) (-1012.597) (-1012.891) * (-1015.274) (-1016.367) (-1014.121) [-1013.913] -- 0:00:47

      Average standard deviation of split frequencies: 0.015851

      265500 -- (-1013.056) (-1015.175) (-1013.275) [-1014.431] * (-1016.102) [-1013.267] (-1015.980) (-1015.520) -- 0:00:47
      266000 -- (-1013.284) (-1013.895) (-1015.634) [-1012.612] * (-1018.381) [-1014.031] (-1012.821) (-1015.008) -- 0:00:46
      266500 -- (-1015.613) [-1015.854] (-1016.779) (-1013.538) * (-1013.994) [-1016.033] (-1016.919) (-1016.263) -- 0:00:46
      267000 -- (-1014.326) (-1016.954) (-1014.373) [-1013.609] * [-1013.067] (-1013.090) (-1016.501) (-1017.121) -- 0:00:46
      267500 -- (-1014.787) (-1018.599) [-1014.397] (-1014.495) * (-1013.525) (-1014.301) [-1012.977] (-1015.420) -- 0:00:46
      268000 -- [-1015.424] (-1016.431) (-1018.463) (-1013.413) * (-1014.222) (-1015.646) (-1013.187) [-1012.861] -- 0:00:46
      268500 -- (-1015.326) (-1017.961) (-1014.867) [-1015.157] * (-1013.158) (-1016.825) [-1014.667] (-1016.503) -- 0:00:46
      269000 -- (-1017.283) (-1016.447) (-1014.421) [-1013.686] * [-1014.042] (-1014.612) (-1013.231) (-1023.522) -- 0:00:46
      269500 -- [-1015.855] (-1017.532) (-1015.011) (-1016.587) * (-1013.189) (-1014.517) [-1015.772] (-1014.033) -- 0:00:46
      270000 -- [-1020.715] (-1014.554) (-1017.075) (-1015.960) * (-1017.283) (-1015.354) [-1013.951] (-1017.390) -- 0:00:45

      Average standard deviation of split frequencies: 0.016159

      270500 -- (-1021.088) [-1014.911] (-1014.380) (-1014.370) * (-1016.075) (-1015.561) (-1013.547) [-1015.988] -- 0:00:45
      271000 -- (-1014.124) (-1015.436) (-1015.131) [-1013.753] * (-1016.057) (-1018.184) [-1016.057] (-1014.612) -- 0:00:45
      271500 -- (-1014.188) (-1014.576) [-1015.752] (-1014.385) * [-1015.616] (-1016.114) (-1016.286) (-1016.662) -- 0:00:48
      272000 -- (-1014.163) (-1014.247) [-1015.686] (-1014.417) * (-1015.397) (-1015.631) [-1014.511] (-1015.140) -- 0:00:48
      272500 -- (-1014.578) (-1014.153) [-1014.722] (-1013.871) * [-1021.423] (-1016.974) (-1013.052) (-1014.221) -- 0:00:48
      273000 -- (-1014.414) (-1016.224) [-1014.572] (-1022.781) * (-1014.368) (-1021.444) [-1013.294] (-1019.041) -- 0:00:47
      273500 -- (-1013.117) [-1017.538] (-1013.404) (-1021.790) * (-1015.899) (-1017.097) (-1015.201) [-1022.626] -- 0:00:47
      274000 -- (-1013.013) [-1016.518] (-1013.387) (-1018.352) * (-1017.809) [-1014.744] (-1015.714) (-1014.002) -- 0:00:47
      274500 -- [-1013.739] (-1014.403) (-1013.927) (-1016.178) * [-1014.130] (-1014.444) (-1013.702) (-1013.258) -- 0:00:47
      275000 -- (-1014.374) (-1016.871) [-1016.026] (-1013.735) * (-1016.928) (-1016.627) [-1013.849] (-1015.141) -- 0:00:47

      Average standard deviation of split frequencies: 0.015573

      275500 -- (-1013.642) [-1016.042] (-1014.701) (-1016.391) * (-1015.987) (-1020.297) [-1016.936] (-1016.458) -- 0:00:47
      276000 -- [-1016.411] (-1014.779) (-1013.637) (-1019.514) * (-1016.244) (-1017.161) [-1013.695] (-1016.165) -- 0:00:47
      276500 -- (-1017.566) [-1014.634] (-1013.084) (-1014.451) * (-1013.870) (-1017.631) [-1014.851] (-1014.212) -- 0:00:47
      277000 -- (-1018.416) [-1013.865] (-1012.732) (-1014.214) * [-1014.278] (-1016.293) (-1014.231) (-1014.130) -- 0:00:46
      277500 -- (-1015.947) (-1014.929) (-1012.701) [-1018.633] * (-1016.066) (-1014.313) (-1014.246) [-1013.457] -- 0:00:46
      278000 -- [-1012.732] (-1014.800) (-1015.481) (-1020.881) * (-1018.377) [-1013.221] (-1015.171) (-1015.808) -- 0:00:46
      278500 -- (-1012.660) [-1014.683] (-1017.524) (-1018.147) * (-1014.040) [-1012.873] (-1017.962) (-1017.868) -- 0:00:46
      279000 -- (-1013.476) (-1013.426) (-1016.927) [-1016.718] * (-1015.669) (-1014.566) [-1016.753] (-1019.188) -- 0:00:46
      279500 -- [-1013.868] (-1014.744) (-1015.451) (-1012.916) * [-1015.565] (-1013.311) (-1014.820) (-1016.103) -- 0:00:46
      280000 -- (-1016.115) (-1012.974) (-1015.589) [-1014.071] * (-1016.031) [-1013.930] (-1015.505) (-1014.214) -- 0:00:46

      Average standard deviation of split frequencies: 0.015610

      280500 -- [-1014.178] (-1013.059) (-1018.404) (-1014.842) * [-1017.418] (-1016.437) (-1013.608) (-1016.790) -- 0:00:46
      281000 -- [-1013.319] (-1014.561) (-1015.325) (-1013.536) * (-1014.535) (-1013.133) (-1013.387) [-1017.012] -- 0:00:46
      281500 -- (-1017.085) (-1015.678) [-1015.929] (-1014.100) * (-1014.971) (-1013.371) (-1012.640) [-1013.970] -- 0:00:45
      282000 -- (-1016.660) [-1013.876] (-1016.047) (-1014.749) * (-1015.420) (-1013.207) [-1015.438] (-1014.352) -- 0:00:45
      282500 -- [-1014.523] (-1015.206) (-1015.768) (-1013.455) * (-1014.689) (-1014.647) [-1014.558] (-1015.216) -- 0:00:45
      283000 -- (-1018.224) (-1015.293) (-1013.194) [-1015.049] * (-1013.094) [-1014.042] (-1015.429) (-1014.162) -- 0:00:45
      283500 -- (-1016.661) (-1015.554) (-1014.395) [-1014.932] * (-1016.053) (-1012.898) (-1014.584) [-1016.742] -- 0:00:45
      284000 -- (-1017.322) [-1013.951] (-1016.114) (-1015.656) * (-1015.638) (-1012.754) (-1019.981) [-1015.867] -- 0:00:45
      284500 -- (-1014.869) (-1014.534) (-1013.427) [-1013.965] * (-1019.302) [-1013.752] (-1017.152) (-1014.791) -- 0:00:47
      285000 -- (-1015.507) (-1014.350) [-1013.075] (-1013.950) * [-1015.838] (-1013.925) (-1014.110) (-1015.036) -- 0:00:47

      Average standard deviation of split frequencies: 0.015416

      285500 -- (-1013.831) (-1016.592) [-1013.808] (-1016.921) * (-1014.663) (-1016.606) (-1014.307) [-1014.694] -- 0:00:47
      286000 -- (-1013.901) (-1015.458) [-1012.813] (-1013.492) * (-1016.346) [-1014.371] (-1014.425) (-1015.504) -- 0:00:47
      286500 -- (-1016.322) (-1014.063) (-1013.534) [-1012.858] * [-1016.104] (-1020.957) (-1015.776) (-1017.651) -- 0:00:47
      287000 -- (-1013.742) (-1013.036) (-1013.791) [-1013.921] * (-1014.854) [-1015.907] (-1017.098) (-1013.439) -- 0:00:47
      287500 -- (-1015.538) (-1015.039) [-1013.134] (-1016.995) * (-1014.556) (-1015.270) (-1015.013) [-1013.872] -- 0:00:47
      288000 -- (-1014.418) (-1014.045) (-1017.066) [-1015.103] * (-1014.053) [-1013.377] (-1013.465) (-1014.061) -- 0:00:46
      288500 -- [-1016.263] (-1014.069) (-1014.970) (-1016.927) * (-1014.546) (-1013.468) [-1015.996] (-1013.775) -- 0:00:46
      289000 -- (-1015.443) [-1014.844] (-1013.514) (-1019.305) * [-1013.936] (-1017.276) (-1018.678) (-1016.087) -- 0:00:46
      289500 -- [-1013.518] (-1015.897) (-1015.889) (-1013.654) * (-1013.986) (-1016.724) (-1013.896) [-1016.996] -- 0:00:46
      290000 -- (-1014.176) [-1013.821] (-1015.094) (-1013.531) * [-1015.362] (-1017.878) (-1015.903) (-1015.607) -- 0:00:46

      Average standard deviation of split frequencies: 0.015407

      290500 -- [-1016.852] (-1014.186) (-1016.050) (-1016.426) * [-1015.784] (-1016.271) (-1015.997) (-1016.894) -- 0:00:46
      291000 -- (-1017.395) (-1013.670) (-1012.471) [-1016.255] * (-1017.055) (-1015.760) (-1015.195) [-1012.636] -- 0:00:46
      291500 -- [-1013.956] (-1013.992) (-1012.432) (-1017.515) * (-1015.192) (-1014.422) (-1012.674) [-1014.588] -- 0:00:46
      292000 -- [-1014.343] (-1013.662) (-1012.373) (-1016.405) * (-1017.993) (-1017.701) [-1014.204] (-1014.292) -- 0:00:46
      292500 -- (-1013.213) [-1013.240] (-1012.718) (-1016.447) * [-1014.621] (-1014.474) (-1020.771) (-1015.368) -- 0:00:45
      293000 -- [-1014.243] (-1018.290) (-1015.019) (-1013.910) * (-1013.850) (-1017.035) [-1012.924] (-1016.426) -- 0:00:45
      293500 -- (-1015.779) (-1014.693) [-1016.212] (-1013.933) * [-1014.377] (-1022.944) (-1014.171) (-1015.241) -- 0:00:45
      294000 -- (-1012.927) (-1013.484) [-1014.425] (-1016.419) * (-1012.871) (-1013.685) [-1017.118] (-1017.270) -- 0:00:45
      294500 -- (-1012.879) (-1012.812) (-1013.998) [-1016.662] * (-1015.055) [-1014.950] (-1013.816) (-1015.218) -- 0:00:45
      295000 -- (-1018.600) (-1013.492) [-1012.710] (-1013.744) * (-1013.434) (-1013.883) [-1013.914] (-1014.653) -- 0:00:45

      Average standard deviation of split frequencies: 0.014802

      295500 -- (-1023.153) (-1012.669) [-1013.497] (-1013.288) * (-1014.529) (-1013.779) (-1018.826) [-1014.748] -- 0:00:45
      296000 -- (-1017.027) (-1019.227) [-1015.207] (-1014.316) * (-1013.428) [-1013.440] (-1018.648) (-1016.013) -- 0:00:45
      296500 -- (-1015.769) (-1020.084) [-1014.877] (-1014.393) * (-1014.169) [-1012.918] (-1021.266) (-1016.903) -- 0:00:45
      297000 -- [-1013.050] (-1013.266) (-1015.963) (-1014.118) * (-1015.361) (-1021.869) [-1014.956] (-1017.340) -- 0:00:44
      297500 -- (-1014.687) (-1015.291) [-1014.020] (-1013.751) * [-1012.874] (-1020.244) (-1015.619) (-1019.686) -- 0:00:44
      298000 -- (-1015.188) [-1016.626] (-1014.150) (-1014.166) * [-1013.175] (-1012.888) (-1016.654) (-1015.838) -- 0:00:44
      298500 -- [-1013.713] (-1014.524) (-1013.578) (-1012.752) * (-1018.028) (-1016.882) [-1015.085] (-1013.998) -- 0:00:47
      299000 -- [-1014.535] (-1016.962) (-1014.223) (-1016.340) * (-1013.561) [-1012.878] (-1014.925) (-1013.926) -- 0:00:46
      299500 -- (-1018.402) (-1015.780) (-1019.630) [-1012.420] * [-1014.453] (-1014.647) (-1013.246) (-1016.774) -- 0:00:46
      300000 -- (-1019.563) [-1015.814] (-1012.704) (-1016.817) * (-1014.660) [-1014.961] (-1014.465) (-1012.919) -- 0:00:46

      Average standard deviation of split frequencies: 0.013742

      300500 -- (-1016.766) [-1016.282] (-1013.327) (-1014.466) * (-1014.193) [-1013.787] (-1014.431) (-1013.080) -- 0:00:46
      301000 -- (-1014.874) (-1016.323) [-1019.456] (-1018.073) * (-1013.501) (-1013.621) (-1013.866) [-1013.874] -- 0:00:46
      301500 -- [-1015.288] (-1013.311) (-1015.510) (-1015.780) * (-1016.065) [-1016.276] (-1015.781) (-1018.546) -- 0:00:46
      302000 -- (-1012.926) [-1012.802] (-1012.547) (-1013.122) * (-1016.091) (-1017.016) [-1018.873] (-1014.003) -- 0:00:46
      302500 -- (-1013.569) (-1013.847) (-1013.376) [-1012.645] * (-1016.126) [-1014.453] (-1020.756) (-1014.249) -- 0:00:46
      303000 -- (-1014.135) (-1012.906) [-1015.246] (-1017.083) * [-1015.204] (-1012.561) (-1017.680) (-1016.265) -- 0:00:46
      303500 -- [-1015.916] (-1014.771) (-1014.122) (-1016.552) * [-1015.096] (-1012.408) (-1014.086) (-1015.880) -- 0:00:45
      304000 -- (-1014.642) [-1016.331] (-1014.049) (-1017.751) * (-1014.185) [-1013.191] (-1014.643) (-1016.500) -- 0:00:45
      304500 -- (-1018.979) (-1016.931) (-1013.042) [-1013.770] * [-1014.384] (-1013.399) (-1013.662) (-1016.419) -- 0:00:45
      305000 -- [-1016.052] (-1018.886) (-1014.279) (-1014.610) * (-1013.855) [-1013.439] (-1016.761) (-1017.438) -- 0:00:45

      Average standard deviation of split frequencies: 0.013351

      305500 -- (-1015.466) (-1014.669) [-1013.474] (-1018.762) * (-1014.476) (-1014.261) (-1015.127) [-1018.393] -- 0:00:45
      306000 -- (-1017.514) [-1014.306] (-1017.680) (-1017.452) * [-1016.106] (-1013.427) (-1016.050) (-1014.310) -- 0:00:45
      306500 -- (-1019.253) (-1015.111) (-1016.571) [-1014.336] * [-1015.409] (-1014.254) (-1017.545) (-1014.035) -- 0:00:45
      307000 -- [-1013.969] (-1013.920) (-1014.409) (-1013.262) * [-1013.062] (-1014.003) (-1020.109) (-1013.465) -- 0:00:45
      307500 -- (-1017.134) [-1012.884] (-1017.628) (-1015.415) * (-1015.943) (-1015.229) [-1014.860] (-1014.097) -- 0:00:45
      308000 -- (-1021.315) (-1012.300) [-1013.379] (-1014.822) * [-1015.595] (-1018.078) (-1019.055) (-1016.330) -- 0:00:44
      308500 -- (-1014.515) (-1012.377) (-1013.881) [-1014.119] * (-1017.504) [-1015.278] (-1015.256) (-1016.675) -- 0:00:44
      309000 -- [-1019.451] (-1013.822) (-1017.388) (-1014.693) * (-1017.826) (-1014.566) (-1014.249) [-1013.888] -- 0:00:44
      309500 -- (-1014.542) (-1014.606) (-1017.143) [-1014.099] * (-1016.963) (-1013.591) (-1013.548) [-1013.071] -- 0:00:44
      310000 -- [-1015.361] (-1014.302) (-1019.335) (-1015.085) * (-1015.837) (-1015.727) (-1012.875) [-1013.146] -- 0:00:44

      Average standard deviation of split frequencies: 0.014500

      310500 -- (-1012.843) (-1012.732) [-1013.782] (-1013.886) * (-1014.315) (-1014.178) [-1017.002] (-1017.778) -- 0:00:44
      311000 -- [-1012.655] (-1014.964) (-1015.438) (-1019.493) * (-1013.017) (-1013.456) [-1014.127] (-1017.140) -- 0:00:46
      311500 -- (-1013.221) (-1017.439) (-1016.589) [-1017.556] * [-1014.721] (-1013.441) (-1016.025) (-1018.423) -- 0:00:46
      312000 -- (-1012.434) [-1013.851] (-1015.557) (-1014.179) * [-1015.161] (-1014.049) (-1013.907) (-1015.443) -- 0:00:46
      312500 -- (-1014.249) (-1013.610) (-1020.600) [-1014.788] * [-1015.227] (-1012.514) (-1013.536) (-1013.196) -- 0:00:46
      313000 -- (-1014.081) (-1016.915) (-1017.094) [-1015.907] * (-1019.758) (-1012.947) (-1017.736) [-1013.756] -- 0:00:46
      313500 -- [-1012.988] (-1014.463) (-1013.609) (-1017.799) * [-1014.245] (-1017.337) (-1013.955) (-1013.262) -- 0:00:45
      314000 -- (-1014.254) (-1015.112) [-1014.717] (-1012.757) * (-1013.146) [-1016.743] (-1015.998) (-1015.116) -- 0:00:45
      314500 -- (-1016.032) (-1014.539) (-1019.478) [-1014.920] * [-1013.797] (-1013.803) (-1014.381) (-1016.275) -- 0:00:45
      315000 -- (-1013.323) [-1012.915] (-1018.658) (-1014.120) * (-1014.165) [-1012.997] (-1017.346) (-1019.350) -- 0:00:45

      Average standard deviation of split frequencies: 0.013675

      315500 -- (-1013.281) (-1012.992) [-1014.967] (-1013.093) * (-1013.425) [-1013.321] (-1012.786) (-1016.118) -- 0:00:45
      316000 -- (-1013.308) (-1013.054) [-1014.254] (-1013.443) * [-1013.293] (-1014.894) (-1017.615) (-1016.918) -- 0:00:45
      316500 -- (-1013.024) (-1013.770) [-1014.635] (-1014.286) * (-1013.734) (-1016.029) [-1020.303] (-1015.921) -- 0:00:45
      317000 -- (-1012.977) (-1015.620) [-1012.749] (-1015.546) * (-1015.043) (-1014.867) (-1018.176) [-1014.563] -- 0:00:45
      317500 -- [-1013.586] (-1014.678) (-1015.446) (-1015.337) * [-1014.240] (-1013.870) (-1022.681) (-1014.634) -- 0:00:45
      318000 -- [-1012.835] (-1013.155) (-1015.772) (-1021.312) * (-1019.944) [-1016.168] (-1014.613) (-1013.781) -- 0:00:45
      318500 -- (-1013.024) (-1015.887) (-1014.233) [-1017.653] * (-1017.786) [-1014.823] (-1014.232) (-1014.811) -- 0:00:44
      319000 -- (-1012.742) (-1014.775) [-1013.877] (-1014.785) * (-1013.270) [-1012.678] (-1016.095) (-1015.175) -- 0:00:44
      319500 -- (-1015.540) (-1017.778) [-1013.409] (-1018.049) * (-1014.369) [-1012.932] (-1016.092) (-1017.067) -- 0:00:44
      320000 -- (-1015.183) [-1015.649] (-1014.054) (-1015.209) * [-1018.662] (-1013.010) (-1014.515) (-1015.241) -- 0:00:44

      Average standard deviation of split frequencies: 0.013884

      320500 -- (-1013.212) (-1014.022) (-1017.036) [-1015.804] * (-1015.209) (-1012.743) (-1014.639) [-1013.488] -- 0:00:44
      321000 -- (-1017.461) [-1015.147] (-1015.209) (-1015.696) * (-1019.678) (-1014.235) (-1013.719) [-1013.642] -- 0:00:44
      321500 -- (-1012.546) (-1013.702) (-1015.159) [-1013.737] * (-1016.913) (-1013.405) (-1012.952) [-1014.103] -- 0:00:44
      322000 -- (-1017.704) [-1015.912] (-1014.927) (-1013.729) * (-1015.138) (-1014.240) [-1012.988] (-1015.014) -- 0:00:44
      322500 -- (-1017.782) [-1018.399] (-1016.091) (-1016.338) * (-1014.977) [-1013.720] (-1014.481) (-1017.712) -- 0:00:44
      323000 -- (-1015.855) [-1018.914] (-1014.937) (-1015.689) * [-1015.428] (-1012.854) (-1013.057) (-1018.830) -- 0:00:44
      323500 -- [-1014.862] (-1013.811) (-1019.889) (-1013.077) * (-1018.008) (-1012.926) [-1013.138] (-1012.597) -- 0:00:43
      324000 -- (-1013.431) (-1012.383) (-1018.772) [-1012.874] * (-1014.318) (-1012.776) (-1014.238) [-1014.135] -- 0:00:45
      324500 -- [-1013.283] (-1014.155) (-1015.308) (-1017.453) * (-1014.950) [-1012.781] (-1015.597) (-1016.849) -- 0:00:45
      325000 -- (-1013.416) [-1017.556] (-1016.447) (-1015.624) * (-1014.416) [-1013.140] (-1017.902) (-1014.033) -- 0:00:45

      Average standard deviation of split frequencies: 0.014139

      325500 -- (-1015.857) [-1012.759] (-1012.928) (-1015.363) * (-1021.366) [-1014.301] (-1013.356) (-1014.269) -- 0:00:45
      326000 -- [-1015.515] (-1013.910) (-1013.075) (-1015.895) * (-1015.304) (-1014.687) [-1013.063] (-1015.406) -- 0:00:45
      326500 -- (-1013.789) (-1014.393) (-1012.869) [-1016.559] * (-1017.779) (-1015.029) [-1014.579] (-1016.813) -- 0:00:45
      327000 -- (-1018.931) (-1016.285) [-1015.883] (-1015.059) * (-1013.370) (-1015.607) (-1013.021) [-1013.353] -- 0:00:45
      327500 -- (-1017.991) [-1014.456] (-1016.672) (-1015.781) * (-1013.437) (-1013.641) [-1013.671] (-1013.464) -- 0:00:45
      328000 -- [-1020.770] (-1014.977) (-1018.171) (-1019.060) * [-1012.292] (-1012.851) (-1013.812) (-1013.372) -- 0:00:45
      328500 -- (-1015.488) (-1014.137) (-1014.536) [-1014.966] * [-1018.462] (-1013.345) (-1018.147) (-1019.275) -- 0:00:44
      329000 -- [-1013.684] (-1015.801) (-1017.519) (-1016.218) * [-1014.256] (-1014.599) (-1018.999) (-1013.992) -- 0:00:44
      329500 -- (-1013.415) [-1014.633] (-1016.268) (-1014.565) * (-1013.673) [-1013.303] (-1014.765) (-1018.909) -- 0:00:44
      330000 -- (-1014.295) (-1013.408) [-1014.891] (-1015.750) * (-1014.478) (-1013.054) [-1014.561] (-1019.885) -- 0:00:44

      Average standard deviation of split frequencies: 0.014573

      330500 -- [-1018.778] (-1017.612) (-1015.023) (-1013.667) * (-1013.525) (-1014.665) [-1013.190] (-1019.125) -- 0:00:44
      331000 -- (-1017.462) (-1012.814) [-1013.064] (-1015.217) * [-1012.625] (-1012.695) (-1013.383) (-1018.810) -- 0:00:44
      331500 -- (-1012.729) (-1013.187) [-1015.738] (-1016.419) * (-1012.535) [-1015.478] (-1018.341) (-1017.044) -- 0:00:44
      332000 -- (-1012.864) (-1015.751) [-1016.981] (-1022.340) * (-1012.434) (-1016.336) (-1019.721) [-1014.637] -- 0:00:44
      332500 -- [-1014.840] (-1013.829) (-1013.265) (-1014.935) * (-1014.555) [-1016.473] (-1015.303) (-1015.593) -- 0:00:44
      333000 -- [-1017.228] (-1015.963) (-1017.552) (-1015.659) * [-1014.180] (-1016.263) (-1012.692) (-1017.462) -- 0:00:44
      333500 -- [-1015.243] (-1015.826) (-1015.908) (-1015.470) * (-1016.027) (-1017.637) (-1013.807) [-1013.198] -- 0:00:43
      334000 -- (-1016.886) (-1014.860) [-1019.140] (-1014.500) * (-1017.173) (-1014.635) [-1013.310] (-1018.494) -- 0:00:43
      334500 -- [-1016.384] (-1012.589) (-1016.754) (-1014.173) * [-1017.805] (-1015.874) (-1013.236) (-1019.973) -- 0:00:43
      335000 -- (-1017.716) (-1015.170) [-1014.606] (-1013.915) * (-1013.786) (-1016.120) (-1020.803) [-1015.753] -- 0:00:43

      Average standard deviation of split frequencies: 0.014653

      335500 -- (-1013.577) [-1015.415] (-1014.909) (-1014.968) * (-1014.790) [-1015.706] (-1019.977) (-1014.490) -- 0:00:43
      336000 -- (-1013.338) (-1015.699) (-1013.189) [-1013.504] * (-1017.599) (-1016.616) [-1015.372] (-1014.669) -- 0:00:45
      336500 -- (-1017.694) [-1013.604] (-1014.333) (-1016.404) * (-1014.266) (-1016.480) [-1013.251] (-1014.307) -- 0:00:45
      337000 -- (-1017.618) (-1013.211) (-1012.983) [-1015.861] * (-1012.965) (-1012.895) [-1013.277] (-1016.081) -- 0:00:45
      337500 -- (-1019.120) (-1013.148) [-1014.237] (-1017.101) * (-1013.325) [-1016.297] (-1014.562) (-1015.552) -- 0:00:45
      338000 -- (-1018.925) [-1015.004] (-1012.715) (-1015.337) * (-1014.985) [-1015.720] (-1013.827) (-1014.553) -- 0:00:45
      338500 -- (-1019.499) (-1013.803) (-1012.695) [-1014.987] * (-1015.373) [-1015.337] (-1014.436) (-1016.041) -- 0:00:44
      339000 -- [-1013.873] (-1013.226) (-1012.852) (-1014.758) * (-1017.108) (-1016.336) (-1014.453) [-1016.128] -- 0:00:44
      339500 -- (-1012.467) (-1014.122) (-1014.283) [-1013.963] * (-1019.125) (-1020.668) [-1014.082] (-1015.282) -- 0:00:44
      340000 -- (-1015.222) [-1013.276] (-1013.916) (-1014.070) * (-1015.003) (-1021.578) [-1016.677] (-1016.306) -- 0:00:44

      Average standard deviation of split frequencies: 0.013991

      340500 -- [-1013.585] (-1013.859) (-1015.111) (-1014.831) * (-1014.321) (-1017.534) (-1015.911) [-1017.646] -- 0:00:44
      341000 -- [-1014.888] (-1015.514) (-1013.621) (-1013.647) * (-1013.850) (-1015.665) [-1012.911] (-1014.324) -- 0:00:44
      341500 -- (-1018.074) (-1014.155) [-1015.487] (-1012.950) * (-1013.147) (-1013.095) [-1018.545] (-1018.608) -- 0:00:44
      342000 -- (-1016.689) [-1015.780] (-1019.801) (-1022.935) * (-1015.196) [-1017.480] (-1016.281) (-1014.337) -- 0:00:44
      342500 -- (-1014.128) (-1014.189) [-1014.184] (-1013.465) * [-1013.125] (-1018.834) (-1012.762) (-1013.009) -- 0:00:44
      343000 -- (-1016.201) (-1016.346) (-1013.870) [-1015.488] * (-1012.845) [-1015.541] (-1014.519) (-1013.113) -- 0:00:44
      343500 -- (-1017.225) [-1015.522] (-1014.912) (-1013.326) * (-1013.802) (-1019.657) (-1013.983) [-1014.311] -- 0:00:43
      344000 -- (-1014.262) [-1014.094] (-1015.384) (-1013.655) * (-1015.895) (-1013.481) [-1015.867] (-1016.295) -- 0:00:43
      344500 -- [-1017.696] (-1013.871) (-1013.506) (-1013.516) * [-1017.506] (-1014.754) (-1015.750) (-1015.741) -- 0:00:43
      345000 -- (-1013.366) [-1013.804] (-1013.269) (-1019.235) * [-1015.599] (-1014.243) (-1014.551) (-1016.122) -- 0:00:43

      Average standard deviation of split frequencies: 0.013624

      345500 -- (-1012.860) [-1012.750] (-1013.269) (-1013.727) * (-1013.648) [-1015.746] (-1013.085) (-1016.096) -- 0:00:43
      346000 -- (-1013.723) (-1018.091) (-1013.258) [-1015.803] * (-1013.359) (-1015.280) (-1016.446) [-1014.028] -- 0:00:43
      346500 -- (-1016.307) (-1016.696) [-1012.753] (-1015.215) * (-1014.988) (-1017.149) [-1019.764] (-1013.319) -- 0:00:43
      347000 -- (-1016.665) (-1016.935) (-1013.180) [-1012.608] * (-1016.480) (-1019.277) (-1015.049) [-1016.044] -- 0:00:43
      347500 -- (-1015.247) [-1014.987] (-1016.322) (-1012.967) * (-1023.600) (-1013.434) (-1014.081) [-1015.351] -- 0:00:43
      348000 -- [-1014.855] (-1015.550) (-1015.388) (-1014.318) * (-1017.490) [-1013.328] (-1013.356) (-1015.202) -- 0:00:43
      348500 -- (-1015.506) [-1016.216] (-1014.913) (-1015.724) * (-1016.461) [-1013.973] (-1013.842) (-1016.735) -- 0:00:42
      349000 -- (-1019.258) (-1015.891) (-1017.599) [-1017.037] * [-1013.801] (-1021.327) (-1013.770) (-1014.758) -- 0:00:42
      349500 -- (-1012.721) (-1016.449) (-1015.847) [-1013.771] * (-1013.278) (-1013.789) [-1013.204] (-1013.402) -- 0:00:44
      350000 -- (-1013.671) (-1015.283) [-1015.634] (-1014.288) * [-1012.508] (-1015.362) (-1015.093) (-1013.385) -- 0:00:44

      Average standard deviation of split frequencies: 0.013891

      350500 -- (-1015.889) [-1014.844] (-1013.547) (-1017.525) * (-1013.493) [-1012.475] (-1015.901) (-1013.931) -- 0:00:44
      351000 -- [-1015.002] (-1013.978) (-1015.404) (-1016.064) * (-1018.754) (-1015.396) [-1017.633] (-1013.813) -- 0:00:44
      351500 -- [-1014.022] (-1013.284) (-1015.964) (-1013.415) * (-1012.510) [-1016.997] (-1013.871) (-1014.973) -- 0:00:44
      352000 -- (-1014.748) (-1012.628) [-1015.396] (-1013.799) * (-1012.374) (-1015.238) [-1017.946] (-1013.448) -- 0:00:44
      352500 -- (-1015.952) (-1017.054) (-1017.076) [-1016.873] * (-1013.769) (-1014.320) [-1012.466] (-1014.393) -- 0:00:44
      353000 -- (-1014.255) (-1013.745) [-1014.144] (-1015.597) * [-1014.321] (-1013.975) (-1014.456) (-1016.463) -- 0:00:43
      353500 -- (-1013.962) [-1015.614] (-1018.119) (-1014.965) * [-1016.518] (-1012.958) (-1014.547) (-1015.550) -- 0:00:43
      354000 -- (-1014.723) [-1018.293] (-1017.667) (-1016.785) * [-1015.584] (-1013.921) (-1016.069) (-1019.179) -- 0:00:43
      354500 -- [-1014.077] (-1015.345) (-1014.145) (-1014.194) * (-1019.704) [-1015.370] (-1016.403) (-1016.831) -- 0:00:43
      355000 -- (-1012.767) [-1013.717] (-1013.927) (-1019.054) * (-1014.369) (-1012.880) [-1014.454] (-1013.201) -- 0:00:43

      Average standard deviation of split frequencies: 0.013683

      355500 -- (-1017.195) [-1015.433] (-1016.592) (-1016.782) * (-1013.520) (-1012.677) [-1017.014] (-1016.080) -- 0:00:43
      356000 -- (-1013.302) (-1016.140) (-1012.834) [-1017.217] * [-1018.563] (-1013.219) (-1013.861) (-1012.736) -- 0:00:43
      356500 -- (-1013.043) (-1014.272) (-1012.384) [-1013.296] * (-1012.870) [-1014.575] (-1014.800) (-1012.962) -- 0:00:43
      357000 -- (-1012.808) [-1013.903] (-1012.527) (-1013.189) * (-1012.698) [-1012.844] (-1014.474) (-1013.735) -- 0:00:43
      357500 -- (-1012.493) (-1015.355) [-1012.485] (-1013.676) * (-1013.734) [-1014.727] (-1013.482) (-1014.064) -- 0:00:43
      358000 -- (-1016.524) (-1016.345) (-1017.378) [-1013.350] * (-1018.241) [-1015.019] (-1014.038) (-1015.184) -- 0:00:43
      358500 -- (-1013.527) (-1022.589) [-1017.081] (-1014.747) * (-1016.052) [-1014.558] (-1014.789) (-1019.110) -- 0:00:42
      359000 -- [-1015.243] (-1023.840) (-1014.746) (-1013.425) * (-1016.444) (-1013.911) (-1013.746) [-1014.146] -- 0:00:42
      359500 -- [-1015.166] (-1015.712) (-1014.180) (-1013.708) * (-1015.317) [-1015.879] (-1015.318) (-1014.088) -- 0:00:42
      360000 -- (-1014.422) (-1022.731) (-1015.724) [-1014.401] * [-1013.256] (-1013.349) (-1014.210) (-1015.764) -- 0:00:42

      Average standard deviation of split frequencies: 0.011909

      360500 -- [-1014.139] (-1017.662) (-1014.690) (-1015.706) * [-1014.081] (-1014.629) (-1012.679) (-1017.122) -- 0:00:42
      361000 -- (-1014.405) [-1015.306] (-1014.007) (-1018.114) * (-1016.148) (-1013.366) (-1014.579) [-1012.707] -- 0:00:42
      361500 -- (-1013.052) (-1016.866) [-1015.807] (-1015.128) * (-1013.941) (-1014.806) [-1014.793] (-1015.514) -- 0:00:42
      362000 -- (-1013.619) (-1015.466) (-1014.450) [-1014.290] * (-1017.566) (-1013.582) [-1016.223] (-1015.482) -- 0:00:44
      362500 -- [-1013.936] (-1014.108) (-1015.189) (-1014.189) * (-1016.614) (-1014.240) (-1016.157) [-1015.435] -- 0:00:43
      363000 -- (-1015.023) (-1014.368) [-1014.440] (-1013.206) * (-1014.196) (-1014.542) [-1016.723] (-1014.512) -- 0:00:43
      363500 -- (-1017.458) (-1018.707) (-1016.075) [-1013.903] * (-1015.778) (-1014.328) (-1018.809) [-1015.208] -- 0:00:43
      364000 -- [-1014.702] (-1012.706) (-1014.396) (-1015.221) * (-1014.577) [-1013.979] (-1020.379) (-1014.053) -- 0:00:43
      364500 -- (-1016.312) (-1013.118) (-1017.319) [-1013.857] * (-1014.267) (-1014.320) [-1014.986] (-1013.973) -- 0:00:43
      365000 -- [-1014.611] (-1012.799) (-1013.469) (-1012.411) * (-1014.341) (-1017.245) [-1016.362] (-1015.943) -- 0:00:43

      Average standard deviation of split frequencies: 0.012522

      365500 -- (-1017.329) (-1016.100) (-1013.289) [-1013.127] * (-1015.094) (-1013.460) (-1012.886) [-1013.866] -- 0:00:43
      366000 -- (-1015.207) (-1014.300) [-1012.948] (-1016.675) * (-1015.619) (-1012.949) (-1019.786) [-1014.476] -- 0:00:43
      366500 -- [-1018.304] (-1015.156) (-1014.833) (-1017.948) * (-1016.152) [-1013.325] (-1020.021) (-1014.359) -- 0:00:43
      367000 -- (-1014.815) [-1014.163] (-1015.111) (-1018.361) * (-1016.892) (-1015.928) (-1014.735) [-1015.010] -- 0:00:43
      367500 -- (-1017.028) (-1014.290) (-1017.562) [-1012.487] * [-1013.671] (-1014.942) (-1013.152) (-1017.563) -- 0:00:43
      368000 -- [-1013.095] (-1014.130) (-1015.516) (-1012.490) * [-1014.280] (-1017.751) (-1012.921) (-1017.008) -- 0:00:42
      368500 -- (-1013.576) (-1016.159) [-1013.872] (-1012.729) * (-1016.955) (-1014.044) [-1013.063] (-1017.642) -- 0:00:42
      369000 -- (-1014.475) (-1014.465) [-1016.382] (-1014.206) * [-1013.726] (-1016.366) (-1013.098) (-1015.058) -- 0:00:42
      369500 -- [-1016.259] (-1015.616) (-1013.514) (-1015.633) * (-1016.451) (-1015.555) [-1012.880] (-1014.866) -- 0:00:42
      370000 -- (-1013.957) [-1015.171] (-1012.704) (-1012.841) * [-1015.440] (-1013.807) (-1015.258) (-1012.925) -- 0:00:42

      Average standard deviation of split frequencies: 0.013655

      370500 -- (-1015.216) [-1015.468] (-1014.325) (-1014.168) * [-1014.041] (-1013.607) (-1016.383) (-1016.196) -- 0:00:42
      371000 -- [-1015.363] (-1014.895) (-1013.550) (-1015.906) * (-1013.762) [-1013.752] (-1015.523) (-1012.799) -- 0:00:42
      371500 -- (-1015.227) [-1014.989] (-1013.934) (-1013.359) * (-1018.330) [-1014.379] (-1012.959) (-1012.715) -- 0:00:42
      372000 -- (-1014.239) (-1015.915) [-1014.202] (-1014.048) * (-1013.345) (-1016.397) [-1012.959] (-1018.147) -- 0:00:42
      372500 -- (-1015.101) (-1018.538) [-1013.221] (-1012.538) * (-1013.986) [-1015.527] (-1016.281) (-1013.996) -- 0:00:42
      373000 -- (-1014.337) (-1015.232) (-1017.731) [-1012.559] * (-1013.201) [-1017.451] (-1017.798) (-1018.378) -- 0:00:42
      373500 -- (-1014.511) (-1016.690) (-1017.685) [-1015.006] * [-1014.483] (-1015.477) (-1012.307) (-1017.142) -- 0:00:41
      374000 -- [-1012.791] (-1014.461) (-1014.737) (-1016.332) * (-1014.261) (-1015.229) [-1013.220] (-1015.825) -- 0:00:41
      374500 -- [-1013.449] (-1014.073) (-1021.403) (-1012.758) * (-1013.622) (-1015.371) (-1018.193) [-1016.759] -- 0:00:41
      375000 -- [-1013.616] (-1015.094) (-1017.060) (-1013.082) * (-1013.557) (-1013.838) (-1019.486) [-1014.079] -- 0:00:41

      Average standard deviation of split frequencies: 0.013512

      375500 -- (-1016.512) (-1015.929) (-1015.355) [-1013.932] * (-1012.920) [-1015.546] (-1014.844) (-1016.862) -- 0:00:41
      376000 -- (-1014.499) [-1020.681] (-1015.463) (-1013.145) * (-1016.234) [-1015.379] (-1016.297) (-1014.518) -- 0:00:41
      376500 -- (-1022.677) [-1013.063] (-1015.735) (-1017.109) * (-1015.253) [-1014.276] (-1016.177) (-1013.793) -- 0:00:43
      377000 -- (-1016.147) (-1012.417) [-1013.571] (-1017.377) * [-1014.322] (-1014.833) (-1013.110) (-1018.874) -- 0:00:42
      377500 -- (-1014.430) (-1017.782) (-1017.143) [-1012.630] * (-1013.541) (-1017.189) (-1015.759) [-1013.455] -- 0:00:42
      378000 -- (-1016.413) (-1016.494) (-1021.350) [-1014.179] * (-1017.056) (-1013.560) (-1014.924) [-1015.227] -- 0:00:42
      378500 -- (-1013.594) (-1012.892) [-1015.593] (-1014.259) * [-1012.664] (-1013.957) (-1014.013) (-1016.010) -- 0:00:42
      379000 -- (-1015.131) (-1013.590) [-1014.790] (-1015.679) * (-1014.153) [-1015.041] (-1014.100) (-1017.730) -- 0:00:42
      379500 -- (-1019.011) [-1014.056] (-1012.594) (-1016.034) * [-1018.278] (-1019.116) (-1018.663) (-1016.467) -- 0:00:42
      380000 -- (-1018.510) (-1014.141) [-1013.117] (-1016.597) * (-1014.996) (-1016.832) (-1015.188) [-1016.365] -- 0:00:42

      Average standard deviation of split frequencies: 0.012452

      380500 -- (-1012.785) (-1014.088) [-1013.549] (-1012.892) * (-1015.723) (-1015.077) [-1014.672] (-1018.019) -- 0:00:42
      381000 -- (-1013.557) [-1012.902] (-1015.923) (-1013.457) * [-1014.471] (-1014.580) (-1014.942) (-1016.297) -- 0:00:42
      381500 -- (-1013.589) (-1013.011) [-1014.619] (-1015.660) * (-1014.862) [-1013.796] (-1015.868) (-1013.938) -- 0:00:42
      382000 -- (-1014.395) (-1015.478) (-1017.652) [-1014.832] * [-1016.909] (-1013.942) (-1017.945) (-1015.142) -- 0:00:42
      382500 -- (-1013.295) (-1016.278) (-1016.312) [-1017.415] * (-1014.362) (-1013.585) (-1013.701) [-1014.713] -- 0:00:41
      383000 -- (-1018.363) (-1016.308) [-1015.338] (-1016.105) * [-1014.551] (-1014.982) (-1016.211) (-1012.641) -- 0:00:41
      383500 -- (-1012.669) [-1014.418] (-1014.526) (-1019.685) * [-1018.095] (-1013.060) (-1012.969) (-1014.081) -- 0:00:41
      384000 -- [-1012.558] (-1014.896) (-1013.365) (-1014.216) * (-1016.197) [-1012.637] (-1014.682) (-1014.429) -- 0:00:41
      384500 -- (-1013.941) (-1015.363) [-1012.620] (-1016.817) * (-1018.092) (-1013.074) (-1017.259) [-1016.569] -- 0:00:41
      385000 -- [-1014.043] (-1014.905) (-1014.869) (-1016.948) * [-1015.598] (-1013.339) (-1012.809) (-1014.318) -- 0:00:41

      Average standard deviation of split frequencies: 0.012687

      385500 -- (-1013.997) (-1016.748) (-1013.465) [-1014.736] * (-1014.009) (-1015.447) (-1013.432) [-1014.979] -- 0:00:41
      386000 -- [-1013.763] (-1019.548) (-1015.741) (-1016.142) * [-1014.284] (-1015.950) (-1013.468) (-1014.712) -- 0:00:41
      386500 -- (-1013.105) [-1017.736] (-1013.829) (-1016.384) * (-1012.989) (-1015.818) (-1014.649) [-1013.597] -- 0:00:41
      387000 -- (-1015.392) (-1014.744) [-1014.429] (-1013.015) * (-1013.094) [-1013.639] (-1013.399) (-1014.070) -- 0:00:41
      387500 -- (-1013.624) [-1014.097] (-1013.888) (-1013.573) * (-1012.941) (-1014.433) [-1014.154] (-1013.061) -- 0:00:41
      388000 -- (-1012.430) (-1014.745) [-1015.450] (-1015.152) * (-1014.967) (-1013.664) [-1015.919] (-1013.421) -- 0:00:41
      388500 -- (-1013.117) (-1013.892) [-1015.349] (-1014.934) * (-1013.204) (-1013.219) [-1013.060] (-1014.304) -- 0:00:40
      389000 -- (-1015.867) (-1013.122) (-1014.213) [-1015.496] * (-1012.789) (-1014.509) [-1012.476] (-1014.912) -- 0:00:40
      389500 -- (-1014.649) (-1012.725) [-1016.137] (-1018.859) * (-1013.770) (-1013.132) (-1012.469) [-1013.603] -- 0:00:40
      390000 -- [-1014.264] (-1015.934) (-1015.542) (-1012.420) * [-1013.119] (-1014.817) (-1012.716) (-1017.008) -- 0:00:40

      Average standard deviation of split frequencies: 0.013628

      390500 -- (-1016.377) (-1016.466) (-1014.128) [-1012.675] * (-1015.396) (-1013.031) [-1014.043] (-1016.404) -- 0:00:40
      391000 -- (-1020.734) [-1014.871] (-1014.369) (-1013.385) * (-1013.991) [-1013.475] (-1014.998) (-1015.367) -- 0:00:40
      391500 -- (-1018.793) [-1018.154] (-1015.285) (-1014.887) * (-1013.593) (-1016.612) [-1013.672] (-1014.395) -- 0:00:40
      392000 -- (-1020.653) (-1013.631) (-1013.896) [-1013.015] * [-1012.728] (-1014.728) (-1015.520) (-1017.482) -- 0:00:41
      392500 -- (-1014.024) [-1014.741] (-1015.652) (-1014.727) * (-1013.826) [-1013.290] (-1016.624) (-1016.193) -- 0:00:41
      393000 -- (-1016.041) (-1013.826) (-1013.554) [-1015.642] * [-1015.110] (-1016.857) (-1016.875) (-1014.985) -- 0:00:41
      393500 -- (-1019.211) (-1014.546) [-1015.071] (-1012.614) * (-1015.477) (-1013.574) (-1012.664) [-1016.568] -- 0:00:41
      394000 -- (-1020.570) [-1013.820] (-1016.413) (-1013.422) * (-1020.106) [-1012.780] (-1014.944) (-1013.439) -- 0:00:41
      394500 -- (-1020.979) (-1015.553) (-1013.654) [-1014.691] * [-1015.089] (-1015.469) (-1013.989) (-1014.286) -- 0:00:41
      395000 -- (-1013.736) (-1019.177) [-1013.852] (-1012.659) * (-1017.020) [-1014.868] (-1014.596) (-1013.927) -- 0:00:41

      Average standard deviation of split frequencies: 0.012324

      395500 -- [-1013.486] (-1020.118) (-1014.494) (-1013.816) * (-1015.203) [-1013.388] (-1013.043) (-1013.153) -- 0:00:41
      396000 -- (-1012.369) [-1017.384] (-1018.940) (-1013.164) * [-1014.040] (-1014.055) (-1012.945) (-1013.153) -- 0:00:41
      396500 -- (-1016.131) (-1020.677) (-1014.863) [-1012.780] * (-1015.506) [-1014.370] (-1016.465) (-1016.481) -- 0:00:41
      397000 -- (-1015.404) (-1014.188) [-1017.362] (-1012.521) * (-1016.433) (-1016.222) [-1013.088] (-1016.387) -- 0:00:41
      397500 -- (-1015.402) (-1014.355) [-1017.863] (-1015.237) * (-1013.939) (-1013.973) (-1014.466) [-1014.661] -- 0:00:40
      398000 -- (-1016.475) (-1014.420) (-1015.560) [-1013.596] * [-1013.834] (-1013.702) (-1013.636) (-1013.041) -- 0:00:40
      398500 -- (-1014.222) (-1014.272) (-1014.254) [-1015.839] * (-1015.863) (-1015.499) (-1013.897) [-1015.778] -- 0:00:40
      399000 -- [-1014.294] (-1018.207) (-1014.780) (-1013.583) * [-1013.268] (-1023.211) (-1017.057) (-1017.111) -- 0:00:40
      399500 -- [-1013.810] (-1013.461) (-1014.361) (-1014.212) * (-1014.856) (-1018.996) (-1014.285) [-1015.215] -- 0:00:40
      400000 -- (-1013.189) (-1012.327) (-1014.771) [-1012.858] * (-1015.141) (-1016.750) (-1016.564) [-1016.737] -- 0:00:40

      Average standard deviation of split frequencies: 0.011627

      400500 -- [-1013.987] (-1012.409) (-1014.327) (-1012.767) * (-1014.710) (-1013.639) (-1013.614) [-1018.629] -- 0:00:40
      401000 -- (-1014.378) (-1013.227) (-1014.444) [-1017.499] * [-1014.819] (-1015.799) (-1015.557) (-1017.138) -- 0:00:40
      401500 -- [-1013.244] (-1015.276) (-1013.966) (-1019.470) * (-1014.614) (-1015.734) (-1018.236) [-1017.740] -- 0:00:40
      402000 -- [-1012.523] (-1014.550) (-1014.075) (-1019.587) * (-1016.114) [-1012.880] (-1016.491) (-1015.186) -- 0:00:40
      402500 -- [-1015.788] (-1014.324) (-1014.067) (-1015.863) * [-1013.301] (-1014.585) (-1016.548) (-1014.641) -- 0:00:40
      403000 -- (-1014.386) (-1013.142) (-1016.533) [-1015.053] * [-1013.353] (-1015.287) (-1016.063) (-1015.777) -- 0:00:39
      403500 -- [-1014.637] (-1014.321) (-1018.133) (-1014.982) * (-1017.484) [-1014.788] (-1013.902) (-1019.782) -- 0:00:39
      404000 -- (-1015.409) (-1015.038) (-1015.972) [-1015.711] * (-1017.946) [-1012.459] (-1014.169) (-1014.061) -- 0:00:39
      404500 -- (-1014.736) (-1016.564) [-1016.617] (-1014.407) * [-1014.279] (-1016.783) (-1013.196) (-1014.541) -- 0:00:39
      405000 -- (-1018.543) (-1013.489) (-1013.215) [-1013.900] * [-1015.230] (-1018.804) (-1012.636) (-1015.954) -- 0:00:39

      Average standard deviation of split frequencies: 0.010860

      405500 -- [-1015.081] (-1014.059) (-1012.532) (-1013.141) * [-1015.466] (-1014.095) (-1016.737) (-1014.982) -- 0:00:39
      406000 -- (-1014.065) [-1013.095] (-1015.411) (-1015.537) * [-1017.457] (-1015.445) (-1016.164) (-1013.851) -- 0:00:39
      406500 -- (-1019.150) [-1013.168] (-1018.945) (-1013.989) * [-1016.758] (-1015.775) (-1015.365) (-1013.717) -- 0:00:39
      407000 -- [-1013.913] (-1014.482) (-1016.009) (-1013.222) * (-1016.890) (-1014.456) (-1014.681) [-1013.792] -- 0:00:39
      407500 -- (-1013.684) (-1020.484) (-1016.087) [-1013.868] * [-1012.637] (-1014.941) (-1015.145) (-1015.112) -- 0:00:39
      408000 -- (-1013.673) (-1015.056) [-1016.011] (-1013.562) * (-1012.660) (-1016.184) [-1014.133] (-1015.176) -- 0:00:40
      408500 -- [-1013.995] (-1016.502) (-1014.600) (-1013.719) * (-1013.776) (-1018.275) [-1014.076] (-1015.507) -- 0:00:40
      409000 -- (-1014.030) (-1018.729) (-1014.124) [-1012.888] * (-1014.056) (-1013.158) (-1015.216) [-1013.678] -- 0:00:40
      409500 -- (-1017.840) (-1013.243) [-1014.039] (-1018.827) * (-1013.835) (-1012.456) (-1013.819) [-1014.247] -- 0:00:40
      410000 -- (-1013.821) [-1015.470] (-1017.414) (-1019.736) * (-1013.878) (-1016.738) [-1016.087] (-1014.432) -- 0:00:40

      Average standard deviation of split frequencies: 0.010601

      410500 -- (-1015.270) (-1013.822) [-1016.605] (-1015.426) * (-1018.942) (-1017.722) (-1012.469) [-1013.062] -- 0:00:40
      411000 -- (-1015.362) [-1015.889] (-1016.321) (-1013.653) * (-1017.411) [-1015.104] (-1012.469) (-1013.461) -- 0:00:40
      411500 -- [-1013.853] (-1015.568) (-1014.100) (-1014.170) * [-1013.121] (-1015.583) (-1012.395) (-1013.246) -- 0:00:40
      412000 -- (-1012.898) (-1014.470) (-1014.449) [-1013.189] * (-1013.890) [-1015.541] (-1012.862) (-1013.499) -- 0:00:39
      412500 -- [-1013.143] (-1013.995) (-1017.786) (-1013.105) * (-1014.217) (-1019.121) (-1012.892) [-1015.589] -- 0:00:39
      413000 -- (-1015.681) (-1014.905) (-1014.802) [-1014.909] * (-1017.409) (-1021.231) (-1014.793) [-1015.631] -- 0:00:39
      413500 -- [-1014.324] (-1014.198) (-1012.950) (-1015.856) * (-1017.342) (-1020.024) (-1013.678) [-1013.017] -- 0:00:39
      414000 -- (-1014.042) (-1019.989) [-1013.921] (-1016.010) * (-1012.618) [-1013.734] (-1013.492) (-1013.077) -- 0:00:39
      414500 -- [-1012.905] (-1014.490) (-1016.253) (-1015.692) * (-1012.905) (-1014.219) [-1015.599] (-1014.358) -- 0:00:39
      415000 -- (-1013.786) [-1013.846] (-1013.662) (-1014.070) * (-1014.105) [-1014.624] (-1017.451) (-1014.898) -- 0:00:39

      Average standard deviation of split frequencies: 0.010265

      415500 -- (-1012.956) (-1013.258) (-1014.618) [-1014.062] * (-1015.203) (-1013.339) [-1015.934] (-1017.184) -- 0:00:39
      416000 -- (-1016.846) (-1014.129) [-1013.996] (-1012.822) * (-1015.219) (-1017.563) [-1013.779] (-1015.242) -- 0:00:39
      416500 -- (-1014.509) (-1014.205) (-1012.999) [-1012.756] * (-1014.484) (-1014.163) [-1016.008] (-1012.923) -- 0:00:39
      417000 -- (-1013.879) (-1014.739) (-1014.480) [-1014.446] * (-1014.428) [-1017.985] (-1016.045) (-1013.427) -- 0:00:39
      417500 -- (-1016.752) [-1014.049] (-1017.210) (-1019.605) * (-1014.491) (-1014.658) [-1015.000] (-1015.019) -- 0:00:39
      418000 -- [-1014.806] (-1012.954) (-1016.563) (-1016.662) * [-1013.899] (-1015.999) (-1018.293) (-1014.253) -- 0:00:38
      418500 -- [-1018.314] (-1013.180) (-1014.436) (-1018.933) * (-1016.215) [-1014.639] (-1015.778) (-1013.679) -- 0:00:38
      419000 -- [-1013.609] (-1012.955) (-1017.463) (-1015.090) * (-1014.122) (-1013.779) [-1013.028] (-1014.877) -- 0:00:38
      419500 -- [-1013.632] (-1013.809) (-1015.680) (-1012.771) * (-1013.641) (-1013.304) (-1017.346) [-1016.269] -- 0:00:38
      420000 -- (-1016.304) (-1019.838) [-1013.763] (-1012.362) * (-1015.757) (-1013.112) (-1018.994) [-1015.842] -- 0:00:38

      Average standard deviation of split frequencies: 0.011536

      420500 -- (-1014.149) (-1013.437) (-1014.090) [-1014.946] * (-1015.665) (-1014.828) (-1015.833) [-1014.009] -- 0:00:38
      421000 -- (-1015.195) [-1015.054] (-1021.558) (-1015.385) * (-1012.570) (-1015.713) [-1016.332] (-1015.745) -- 0:00:38
      421500 -- (-1014.598) (-1013.948) [-1012.927] (-1016.413) * (-1013.325) (-1015.440) [-1015.656] (-1014.509) -- 0:00:38
      422000 -- [-1017.016] (-1017.508) (-1014.261) (-1016.425) * (-1013.584) (-1018.594) [-1014.823] (-1014.545) -- 0:00:38
      422500 -- (-1015.354) (-1018.381) [-1013.128] (-1015.384) * (-1016.310) (-1013.169) (-1016.854) [-1016.226] -- 0:00:38
      423000 -- (-1013.303) (-1015.774) (-1014.113) [-1015.793] * (-1012.791) (-1012.352) (-1015.588) [-1013.034] -- 0:00:39
      423500 -- (-1013.456) (-1014.501) [-1013.107] (-1017.254) * [-1013.577] (-1014.882) (-1016.136) (-1016.941) -- 0:00:39
      424000 -- (-1017.741) [-1014.561] (-1013.966) (-1018.184) * (-1016.101) [-1013.083] (-1014.885) (-1014.423) -- 0:00:39
      424500 -- (-1015.298) (-1014.376) (-1013.954) [-1014.367] * (-1019.061) [-1014.408] (-1016.545) (-1013.577) -- 0:00:39
      425000 -- (-1015.567) (-1013.255) [-1015.746] (-1016.301) * (-1017.414) (-1013.588) [-1015.796] (-1014.390) -- 0:00:39

      Average standard deviation of split frequencies: 0.011456

      425500 -- (-1014.802) [-1014.186] (-1014.244) (-1013.816) * (-1013.396) (-1013.291) (-1014.788) [-1014.106] -- 0:00:39
      426000 -- (-1017.697) (-1013.399) [-1014.538] (-1015.470) * (-1016.406) (-1015.363) [-1016.763] (-1014.019) -- 0:00:39
      426500 -- (-1016.242) (-1016.177) (-1014.443) [-1013.443] * (-1014.725) (-1016.289) (-1017.362) [-1013.356] -- 0:00:38
      427000 -- (-1015.622) (-1013.370) (-1016.385) [-1013.520] * (-1013.788) [-1017.289] (-1020.338) (-1013.127) -- 0:00:38
      427500 -- (-1015.557) (-1012.567) (-1017.380) [-1013.573] * (-1014.833) [-1015.370] (-1015.292) (-1012.945) -- 0:00:38
      428000 -- (-1016.398) (-1016.300) [-1014.044] (-1014.708) * (-1015.269) (-1018.672) [-1013.238] (-1019.032) -- 0:00:38
      428500 -- (-1017.500) [-1014.114] (-1017.978) (-1018.462) * (-1013.169) (-1018.708) [-1013.791] (-1015.122) -- 0:00:38
      429000 -- (-1015.548) (-1012.806) [-1015.340] (-1014.179) * (-1013.688) [-1014.889] (-1014.238) (-1014.027) -- 0:00:38
      429500 -- [-1017.343] (-1012.756) (-1015.375) (-1017.710) * (-1016.662) (-1016.390) (-1017.847) [-1014.020] -- 0:00:38
      430000 -- [-1016.560] (-1014.840) (-1013.721) (-1014.720) * (-1015.743) [-1015.318] (-1019.049) (-1016.144) -- 0:00:38

      Average standard deviation of split frequencies: 0.013013

      430500 -- (-1014.386) (-1013.406) [-1017.699] (-1014.403) * (-1019.521) [-1015.066] (-1019.015) (-1018.889) -- 0:00:38
      431000 -- (-1017.443) [-1013.317] (-1014.913) (-1018.092) * (-1012.641) (-1017.430) [-1013.665] (-1013.223) -- 0:00:38
      431500 -- (-1013.986) (-1013.546) [-1014.722] (-1013.551) * (-1015.934) (-1017.738) [-1017.282] (-1013.635) -- 0:00:38
      432000 -- [-1012.408] (-1020.763) (-1013.846) (-1014.715) * (-1016.583) (-1017.952) (-1016.611) [-1016.608] -- 0:00:38
      432500 -- (-1013.080) (-1018.829) [-1013.738] (-1015.690) * (-1018.089) (-1015.002) (-1012.617) [-1015.855] -- 0:00:38
      433000 -- [-1013.116] (-1017.809) (-1013.257) (-1014.920) * (-1017.298) (-1013.480) [-1017.130] (-1014.881) -- 0:00:37
      433500 -- (-1013.809) (-1015.825) (-1012.291) [-1012.670] * (-1017.086) [-1013.825] (-1019.152) (-1015.875) -- 0:00:37
      434000 -- (-1017.202) [-1017.473] (-1013.616) (-1013.563) * (-1014.107) (-1016.273) (-1013.939) [-1016.235] -- 0:00:37
      434500 -- (-1013.923) (-1013.781) (-1013.424) [-1015.200] * (-1014.793) (-1015.628) (-1012.758) [-1017.140] -- 0:00:37
      435000 -- (-1014.504) (-1017.152) [-1013.480] (-1015.407) * (-1013.515) (-1015.271) [-1015.368] (-1013.579) -- 0:00:37

      Average standard deviation of split frequencies: 0.012674

      435500 -- (-1014.217) (-1015.453) [-1014.365] (-1016.686) * (-1014.960) [-1014.439] (-1014.087) (-1015.870) -- 0:00:37
      436000 -- (-1013.998) (-1013.857) [-1014.319] (-1015.666) * (-1014.883) [-1013.007] (-1016.285) (-1016.037) -- 0:00:37
      436500 -- (-1017.545) (-1014.610) [-1013.819] (-1013.616) * (-1014.909) (-1013.365) [-1014.160] (-1013.657) -- 0:00:37
      437000 -- (-1017.779) (-1014.708) (-1017.245) [-1014.933] * (-1018.174) [-1012.770] (-1013.520) (-1013.122) -- 0:00:37
      437500 -- [-1016.764] (-1014.540) (-1013.109) (-1013.299) * (-1016.425) [-1013.256] (-1013.641) (-1013.967) -- 0:00:37
      438000 -- (-1018.185) [-1013.372] (-1012.528) (-1015.148) * [-1017.374] (-1017.088) (-1013.748) (-1012.685) -- 0:00:38
      438500 -- (-1018.186) (-1016.142) [-1015.058] (-1015.228) * (-1014.656) (-1017.397) (-1014.528) [-1014.753] -- 0:00:38
      439000 -- [-1015.183] (-1015.764) (-1013.584) (-1016.042) * [-1016.189] (-1018.339) (-1015.957) (-1017.625) -- 0:00:38
      439500 -- (-1013.325) (-1016.723) (-1013.540) [-1017.259] * (-1016.420) [-1013.989] (-1015.643) (-1015.112) -- 0:00:38
      440000 -- [-1013.482] (-1017.089) (-1015.495) (-1017.566) * [-1013.123] (-1012.655) (-1013.670) (-1013.787) -- 0:00:38

      Average standard deviation of split frequencies: 0.012362

      440500 -- (-1013.455) (-1013.006) [-1016.596] (-1013.279) * (-1016.133) (-1014.271) [-1013.776] (-1012.939) -- 0:00:38
      441000 -- [-1013.180] (-1016.424) (-1014.868) (-1013.591) * (-1013.669) (-1013.931) [-1013.845] (-1014.406) -- 0:00:38
      441500 -- (-1014.560) (-1014.353) (-1014.661) [-1014.993] * (-1015.154) (-1013.054) [-1013.894] (-1013.248) -- 0:00:37
      442000 -- (-1016.370) (-1013.870) (-1015.196) [-1014.474] * (-1013.087) (-1012.461) [-1015.370] (-1014.546) -- 0:00:37
      442500 -- [-1016.917] (-1012.785) (-1014.406) (-1014.501) * (-1015.280) [-1014.885] (-1014.656) (-1014.761) -- 0:00:37
      443000 -- [-1017.670] (-1014.245) (-1014.455) (-1012.974) * [-1019.301] (-1015.479) (-1016.120) (-1015.593) -- 0:00:37
      443500 -- (-1014.248) (-1013.696) [-1019.142] (-1013.220) * (-1015.045) [-1013.343] (-1015.083) (-1015.567) -- 0:00:37
      444000 -- [-1015.997] (-1013.852) (-1019.038) (-1013.746) * (-1015.486) [-1015.091] (-1014.567) (-1013.850) -- 0:00:37
      444500 -- (-1014.734) (-1015.990) (-1013.943) [-1013.325] * [-1013.312] (-1017.506) (-1015.265) (-1013.551) -- 0:00:37
      445000 -- (-1014.361) (-1016.656) [-1013.714] (-1015.742) * (-1014.867) [-1013.072] (-1013.603) (-1017.524) -- 0:00:37

      Average standard deviation of split frequencies: 0.012507

      445500 -- (-1014.559) (-1013.530) [-1014.080] (-1013.983) * [-1016.068] (-1014.249) (-1014.077) (-1013.679) -- 0:00:37
      446000 -- (-1014.001) (-1014.795) (-1013.854) [-1015.785] * (-1014.174) [-1013.324] (-1013.439) (-1014.455) -- 0:00:37
      446500 -- (-1014.337) (-1014.654) [-1013.467] (-1014.958) * (-1015.544) [-1013.410] (-1013.121) (-1015.356) -- 0:00:37
      447000 -- [-1014.365] (-1014.422) (-1016.023) (-1013.469) * (-1014.763) (-1014.601) [-1015.213] (-1013.638) -- 0:00:37
      447500 -- [-1013.225] (-1017.291) (-1014.437) (-1014.044) * [-1013.038] (-1013.731) (-1014.256) (-1013.371) -- 0:00:37
      448000 -- (-1016.866) [-1016.004] (-1014.190) (-1015.797) * (-1013.585) (-1012.927) (-1015.315) [-1013.451] -- 0:00:36
      448500 -- (-1014.167) (-1014.661) [-1014.124] (-1019.213) * (-1015.414) (-1015.014) [-1017.081] (-1013.903) -- 0:00:36
      449000 -- (-1013.392) (-1018.641) [-1016.457] (-1012.908) * [-1015.796] (-1019.430) (-1017.213) (-1013.126) -- 0:00:36
      449500 -- (-1016.409) (-1015.396) (-1015.168) [-1015.894] * (-1015.025) (-1016.404) (-1017.464) [-1013.490] -- 0:00:36
      450000 -- (-1016.325) (-1013.444) (-1015.572) [-1014.331] * [-1016.135] (-1014.144) (-1016.518) (-1015.247) -- 0:00:36

      Average standard deviation of split frequencies: 0.012145

      450500 -- [-1014.569] (-1014.367) (-1015.702) (-1019.588) * [-1018.947] (-1016.500) (-1017.160) (-1014.152) -- 0:00:36
      451000 -- (-1014.242) (-1015.170) [-1016.119] (-1021.364) * (-1014.475) (-1014.928) [-1014.801] (-1015.562) -- 0:00:36
      451500 -- (-1012.907) (-1014.771) (-1013.761) [-1012.862] * (-1013.420) [-1013.983] (-1013.174) (-1014.127) -- 0:00:36
      452000 -- (-1014.710) (-1013.579) [-1014.506] (-1015.098) * (-1013.606) (-1014.532) (-1014.744) [-1014.453] -- 0:00:36
      452500 -- (-1015.472) (-1017.314) [-1015.610] (-1016.895) * [-1013.606] (-1014.483) (-1012.945) (-1015.303) -- 0:00:36
      453000 -- (-1014.594) (-1019.206) [-1014.787] (-1019.728) * (-1012.697) (-1014.244) [-1013.505] (-1013.809) -- 0:00:36
      453500 -- [-1016.459] (-1014.754) (-1015.015) (-1015.262) * (-1013.788) [-1013.623] (-1014.420) (-1013.018) -- 0:00:36
      454000 -- (-1016.519) [-1013.692] (-1015.979) (-1013.967) * [-1015.178] (-1013.880) (-1016.829) (-1013.660) -- 0:00:37
      454500 -- (-1019.343) (-1016.105) [-1022.535] (-1014.106) * (-1014.629) [-1013.737] (-1016.553) (-1012.705) -- 0:00:37
      455000 -- (-1014.297) [-1013.711] (-1013.502) (-1013.931) * (-1013.322) [-1013.625] (-1014.708) (-1013.596) -- 0:00:37

      Average standard deviation of split frequencies: 0.011797

      455500 -- [-1015.013] (-1013.605) (-1012.610) (-1013.091) * [-1014.537] (-1012.744) (-1014.507) (-1015.846) -- 0:00:37
      456000 -- (-1016.012) (-1013.399) [-1012.749] (-1014.792) * (-1016.540) (-1015.051) (-1015.294) [-1014.046] -- 0:00:36
      456500 -- (-1014.549) (-1016.266) (-1012.749) [-1014.193] * (-1014.325) (-1016.080) [-1013.852] (-1014.168) -- 0:00:36
      457000 -- [-1013.415] (-1014.777) (-1016.753) (-1016.038) * (-1018.485) [-1016.433] (-1013.000) (-1013.506) -- 0:00:36
      457500 -- (-1014.481) [-1012.976] (-1016.452) (-1020.180) * (-1018.342) (-1016.472) (-1016.016) [-1012.246] -- 0:00:36
      458000 -- [-1013.605] (-1013.339) (-1014.701) (-1017.525) * (-1013.146) [-1013.587] (-1014.641) (-1014.743) -- 0:00:36
      458500 -- [-1013.589] (-1013.456) (-1017.501) (-1017.778) * (-1013.202) (-1017.577) [-1015.777] (-1013.936) -- 0:00:36
      459000 -- (-1013.279) [-1012.901] (-1015.362) (-1014.696) * (-1013.310) (-1017.919) (-1012.496) [-1013.614] -- 0:00:36
      459500 -- (-1012.883) (-1014.321) [-1013.462] (-1013.102) * (-1013.128) (-1017.310) (-1015.715) [-1015.371] -- 0:00:36
      460000 -- [-1014.881] (-1014.119) (-1014.545) (-1014.859) * [-1014.523] (-1016.647) (-1014.452) (-1013.712) -- 0:00:36

      Average standard deviation of split frequencies: 0.011858

      460500 -- [-1013.418] (-1015.479) (-1015.340) (-1014.575) * [-1015.490] (-1019.050) (-1014.836) (-1014.961) -- 0:00:36
      461000 -- (-1014.113) (-1018.635) [-1013.824] (-1017.378) * (-1015.703) [-1017.673] (-1016.020) (-1017.539) -- 0:00:36
      461500 -- (-1015.243) (-1019.460) (-1016.988) [-1013.846] * (-1013.310) (-1015.882) (-1012.660) [-1014.343] -- 0:00:36
      462000 -- [-1013.064] (-1014.583) (-1017.178) (-1013.618) * [-1014.942] (-1017.915) (-1013.131) (-1013.111) -- 0:00:36
      462500 -- [-1013.838] (-1018.508) (-1014.233) (-1013.619) * (-1012.885) (-1017.700) (-1012.881) [-1013.768] -- 0:00:36
      463000 -- (-1015.018) [-1012.877] (-1014.640) (-1017.179) * (-1016.566) (-1014.900) (-1013.786) [-1012.922] -- 0:00:35
      463500 -- [-1012.745] (-1012.701) (-1016.024) (-1015.458) * (-1015.239) (-1013.361) [-1016.115] (-1013.021) -- 0:00:35
      464000 -- (-1017.417) (-1012.901) [-1013.217] (-1015.838) * [-1013.217] (-1013.747) (-1014.186) (-1014.701) -- 0:00:35
      464500 -- [-1017.788] (-1012.727) (-1017.054) (-1013.444) * (-1013.285) (-1014.813) (-1012.286) [-1015.080] -- 0:00:35
      465000 -- (-1016.467) (-1012.757) (-1019.171) [-1016.494] * (-1019.114) (-1013.883) [-1014.686] (-1014.365) -- 0:00:35

      Average standard deviation of split frequencies: 0.011425

      465500 -- (-1014.622) [-1014.565] (-1012.643) (-1015.512) * (-1016.774) [-1015.456] (-1015.407) (-1013.846) -- 0:00:35
      466000 -- (-1013.343) (-1013.434) (-1015.044) [-1014.997] * (-1016.519) (-1015.667) [-1014.231] (-1016.751) -- 0:00:35
      466500 -- (-1015.175) [-1012.782] (-1013.699) (-1016.995) * (-1016.118) (-1014.190) [-1013.546] (-1016.838) -- 0:00:35
      467000 -- (-1013.145) [-1015.337] (-1013.491) (-1015.971) * (-1015.995) (-1015.930) (-1018.365) [-1018.414] -- 0:00:35
      467500 -- [-1015.705] (-1013.018) (-1013.875) (-1016.713) * [-1014.428] (-1013.372) (-1014.139) (-1013.163) -- 0:00:35
      468000 -- (-1019.773) (-1012.832) (-1013.559) [-1012.758] * (-1016.889) [-1014.210] (-1013.685) (-1015.085) -- 0:00:35
      468500 -- (-1016.336) [-1014.753] (-1018.996) (-1014.654) * [-1016.288] (-1013.243) (-1014.191) (-1012.421) -- 0:00:35
      469000 -- (-1015.875) (-1015.430) [-1015.270] (-1016.423) * [-1015.306] (-1012.942) (-1015.856) (-1013.113) -- 0:00:35
      469500 -- (-1013.724) [-1014.965] (-1020.858) (-1013.062) * (-1013.295) (-1013.661) [-1015.054] (-1013.663) -- 0:00:35
      470000 -- (-1014.616) [-1015.312] (-1018.105) (-1015.178) * [-1013.787] (-1015.423) (-1015.900) (-1015.987) -- 0:00:34

      Average standard deviation of split frequencies: 0.010958

      470500 -- (-1014.641) (-1017.638) (-1017.225) [-1015.859] * [-1015.446] (-1015.669) (-1012.886) (-1014.961) -- 0:00:36
      471000 -- (-1015.849) [-1014.417] (-1014.096) (-1014.226) * [-1015.190] (-1014.701) (-1014.509) (-1014.320) -- 0:00:35
      471500 -- [-1013.723] (-1015.783) (-1017.137) (-1015.151) * (-1012.926) (-1014.138) [-1017.107] (-1014.629) -- 0:00:35
      472000 -- (-1012.862) (-1025.260) (-1014.841) [-1013.227] * (-1017.010) (-1016.449) (-1013.983) [-1012.691] -- 0:00:35
      472500 -- (-1014.069) (-1017.240) (-1016.551) [-1012.367] * [-1013.805] (-1014.446) (-1015.034) (-1012.719) -- 0:00:35
      473000 -- (-1013.389) (-1016.862) (-1013.510) [-1012.635] * [-1019.423] (-1014.874) (-1012.828) (-1016.839) -- 0:00:35
      473500 -- (-1013.346) [-1012.718] (-1014.052) (-1012.424) * (-1015.137) (-1015.098) (-1013.807) [-1015.040] -- 0:00:35
      474000 -- (-1013.239) (-1012.506) (-1013.066) [-1013.192] * [-1014.721] (-1017.274) (-1014.410) (-1014.556) -- 0:00:35
      474500 -- (-1013.965) [-1014.282] (-1013.781) (-1014.766) * [-1013.520] (-1014.822) (-1015.522) (-1015.941) -- 0:00:35
      475000 -- (-1013.188) [-1013.660] (-1015.578) (-1015.815) * (-1012.223) (-1014.603) (-1013.712) [-1014.006] -- 0:00:35

      Average standard deviation of split frequencies: 0.011651

      475500 -- (-1015.394) (-1016.642) (-1014.595) [-1014.888] * [-1013.051] (-1013.060) (-1013.105) (-1015.802) -- 0:00:35
      476000 -- (-1013.575) (-1017.264) (-1013.837) [-1016.906] * (-1013.645) [-1013.919] (-1015.959) (-1014.767) -- 0:00:35
      476500 -- (-1013.993) (-1012.638) [-1013.334] (-1016.104) * (-1012.833) (-1013.884) [-1017.814] (-1014.754) -- 0:00:35
      477000 -- [-1018.084] (-1016.877) (-1019.013) (-1013.817) * [-1013.686] (-1014.660) (-1014.070) (-1016.745) -- 0:00:35
      477500 -- [-1014.532] (-1020.546) (-1015.999) (-1014.945) * (-1014.465) [-1013.855] (-1015.445) (-1020.149) -- 0:00:35
      478000 -- [-1013.047] (-1018.413) (-1019.097) (-1015.740) * (-1014.918) [-1016.313] (-1014.370) (-1015.543) -- 0:00:34
      478500 -- (-1013.590) (-1015.059) (-1015.152) [-1015.358] * (-1015.438) (-1017.912) [-1013.110] (-1015.750) -- 0:00:34
      479000 -- (-1012.413) [-1017.266] (-1015.673) (-1016.042) * (-1016.897) (-1013.949) (-1012.449) [-1014.055] -- 0:00:34
      479500 -- (-1014.186) (-1019.706) (-1014.582) [-1016.164] * (-1016.303) (-1012.984) [-1013.870] (-1013.329) -- 0:00:34
      480000 -- (-1014.525) (-1020.844) (-1012.445) [-1014.323] * (-1014.294) (-1013.532) [-1014.046] (-1014.659) -- 0:00:34

      Average standard deviation of split frequencies: 0.012014

      480500 -- (-1014.791) (-1013.686) [-1014.432] (-1014.743) * (-1014.972) [-1013.261] (-1016.813) (-1018.069) -- 0:00:34
      481000 -- [-1013.423] (-1013.502) (-1016.917) (-1023.234) * (-1015.718) [-1013.352] (-1015.688) (-1019.429) -- 0:00:34
      481500 -- (-1019.805) [-1015.595] (-1016.999) (-1014.963) * (-1018.269) (-1013.459) (-1013.904) [-1018.944] -- 0:00:34
      482000 -- (-1013.321) [-1013.062] (-1019.780) (-1014.294) * [-1013.858] (-1016.504) (-1016.498) (-1016.261) -- 0:00:34
      482500 -- (-1013.621) (-1013.719) (-1013.496) [-1017.974] * (-1015.392) [-1012.742] (-1017.878) (-1019.259) -- 0:00:34
      483000 -- (-1013.942) [-1014.332] (-1013.769) (-1016.228) * [-1016.763] (-1012.329) (-1013.932) (-1016.513) -- 0:00:34
      483500 -- (-1016.066) (-1014.333) [-1013.914] (-1014.349) * [-1013.999] (-1013.410) (-1012.937) (-1015.962) -- 0:00:34
      484000 -- (-1017.340) (-1014.816) (-1013.957) [-1014.493] * (-1014.837) (-1014.422) [-1013.768] (-1013.295) -- 0:00:34
      484500 -- (-1014.749) (-1013.915) [-1014.231] (-1013.766) * (-1013.520) [-1015.414] (-1013.362) (-1012.605) -- 0:00:34
      485000 -- (-1013.156) [-1013.283] (-1013.585) (-1019.516) * (-1015.337) (-1016.162) [-1013.738] (-1015.059) -- 0:00:33

      Average standard deviation of split frequencies: 0.011411

      485500 -- (-1015.116) (-1014.452) (-1014.671) [-1016.496] * (-1012.904) (-1016.387) [-1013.081] (-1013.022) -- 0:00:33
      486000 -- (-1013.971) [-1014.144] (-1014.982) (-1017.770) * [-1014.776] (-1016.257) (-1016.030) (-1012.793) -- 0:00:33
      486500 -- (-1013.210) (-1016.004) (-1016.377) [-1015.282] * (-1014.792) (-1016.282) [-1014.186] (-1013.484) -- 0:00:34
      487000 -- (-1018.947) (-1013.585) (-1014.710) [-1014.203] * (-1017.052) [-1015.947] (-1016.535) (-1013.708) -- 0:00:34
      487500 -- (-1018.293) (-1015.316) [-1013.212] (-1012.909) * [-1015.026] (-1012.696) (-1014.950) (-1016.441) -- 0:00:34
      488000 -- [-1017.827] (-1015.588) (-1014.202) (-1015.255) * (-1018.101) [-1012.741] (-1015.191) (-1016.502) -- 0:00:34
      488500 -- (-1014.048) [-1014.302] (-1018.704) (-1015.538) * (-1014.634) [-1012.675] (-1013.598) (-1015.218) -- 0:00:34
      489000 -- (-1014.482) (-1015.640) [-1017.312] (-1014.574) * (-1012.702) [-1017.604] (-1015.325) (-1015.416) -- 0:00:34
      489500 -- (-1014.284) [-1015.012] (-1015.822) (-1015.074) * (-1017.520) [-1014.798] (-1014.366) (-1015.349) -- 0:00:34
      490000 -- (-1017.745) (-1015.062) (-1019.890) [-1013.074] * (-1017.798) (-1017.102) [-1016.341] (-1015.754) -- 0:00:34

      Average standard deviation of split frequencies: 0.010851

      490500 -- [-1013.822] (-1014.430) (-1016.842) (-1013.787) * (-1021.837) [-1017.163] (-1018.794) (-1018.040) -- 0:00:34
      491000 -- (-1014.048) (-1014.665) (-1015.927) [-1017.435] * (-1020.647) [-1013.711] (-1014.356) (-1015.839) -- 0:00:34
      491500 -- (-1016.442) (-1013.731) (-1016.854) [-1014.531] * (-1018.268) [-1016.013] (-1012.454) (-1013.651) -- 0:00:34
      492000 -- (-1013.815) (-1015.193) [-1015.805] (-1015.155) * [-1012.963] (-1018.273) (-1013.291) (-1012.930) -- 0:00:34
      492500 -- (-1013.322) [-1013.829] (-1014.762) (-1014.757) * (-1012.438) (-1016.910) [-1014.240] (-1013.712) -- 0:00:34
      493000 -- [-1015.460] (-1013.204) (-1015.264) (-1018.941) * (-1014.563) [-1014.284] (-1016.206) (-1013.310) -- 0:00:33
      493500 -- (-1015.016) (-1015.190) [-1013.879] (-1014.956) * [-1014.864] (-1021.054) (-1014.826) (-1014.532) -- 0:00:33
      494000 -- (-1014.454) (-1014.209) (-1013.382) [-1013.359] * (-1015.869) (-1015.772) [-1013.909] (-1014.925) -- 0:00:33
      494500 -- (-1013.976) [-1015.314] (-1015.326) (-1013.445) * (-1013.287) [-1015.043] (-1013.666) (-1014.080) -- 0:00:33
      495000 -- [-1016.667] (-1013.216) (-1013.541) (-1013.303) * (-1013.061) [-1013.646] (-1012.498) (-1014.872) -- 0:00:33

      Average standard deviation of split frequencies: 0.010510

      495500 -- (-1018.056) (-1014.270) (-1019.863) [-1012.886] * (-1016.738) [-1015.597] (-1015.618) (-1015.922) -- 0:00:33
      496000 -- (-1013.924) [-1013.881] (-1017.355) (-1013.895) * (-1014.584) (-1017.426) (-1015.050) [-1018.186] -- 0:00:33
      496500 -- (-1017.336) [-1015.784] (-1014.184) (-1013.427) * [-1014.952] (-1013.247) (-1018.703) (-1017.118) -- 0:00:33
      497000 -- (-1014.540) (-1015.382) [-1014.602] (-1013.041) * (-1016.882) (-1014.512) (-1013.816) [-1017.068] -- 0:00:33
      497500 -- (-1013.224) (-1014.072) [-1014.055] (-1013.653) * (-1013.673) [-1015.196] (-1012.631) (-1015.341) -- 0:00:33
      498000 -- (-1013.148) [-1014.064] (-1014.600) (-1014.971) * [-1013.382] (-1013.642) (-1013.761) (-1015.951) -- 0:00:33
      498500 -- (-1015.725) [-1017.341] (-1013.064) (-1019.361) * [-1015.893] (-1017.064) (-1013.516) (-1016.031) -- 0:00:33
      499000 -- [-1015.192] (-1014.088) (-1013.119) (-1013.745) * (-1014.234) (-1016.808) (-1015.663) [-1016.592] -- 0:00:33
      499500 -- (-1018.340) (-1014.631) [-1014.401] (-1016.983) * (-1015.531) [-1016.727] (-1013.247) (-1014.775) -- 0:00:33
      500000 -- [-1013.206] (-1014.886) (-1013.967) (-1017.399) * [-1013.769] (-1019.305) (-1017.089) (-1016.430) -- 0:00:33

      Average standard deviation of split frequencies: 0.009859

      500500 -- (-1013.460) (-1014.099) (-1014.653) [-1012.793] * (-1014.619) (-1015.592) [-1015.642] (-1012.563) -- 0:00:32
      501000 -- (-1016.740) [-1016.163] (-1013.974) (-1012.961) * (-1015.608) (-1014.256) [-1017.666] (-1014.283) -- 0:00:32
      501500 -- (-1013.730) [-1014.578] (-1013.966) (-1014.227) * (-1017.737) [-1013.942] (-1014.738) (-1013.131) -- 0:00:32
      502000 -- (-1017.145) (-1014.193) (-1013.851) [-1015.225] * (-1018.354) (-1014.754) (-1013.468) [-1013.566] -- 0:00:33
      502500 -- (-1017.356) (-1016.051) [-1013.437] (-1014.861) * (-1014.931) (-1014.836) [-1014.792] (-1023.908) -- 0:00:33
      503000 -- (-1016.412) (-1015.588) (-1014.688) [-1017.881] * (-1016.080) [-1016.123] (-1014.006) (-1019.289) -- 0:00:33
      503500 -- [-1014.240] (-1015.276) (-1015.766) (-1017.893) * (-1015.889) [-1016.479] (-1013.769) (-1016.791) -- 0:00:33
      504000 -- (-1014.244) (-1016.265) [-1017.367] (-1015.128) * (-1013.603) (-1013.262) [-1015.664] (-1014.467) -- 0:00:33
      504500 -- [-1014.521] (-1013.633) (-1013.662) (-1017.747) * (-1014.507) [-1012.773] (-1015.918) (-1012.598) -- 0:00:33
      505000 -- (-1013.796) (-1012.998) [-1018.227] (-1016.997) * (-1013.071) [-1013.284] (-1018.188) (-1012.968) -- 0:00:33

      Average standard deviation of split frequencies: 0.010193

      505500 -- (-1013.671) [-1017.327] (-1014.566) (-1015.213) * [-1014.038] (-1012.862) (-1014.972) (-1016.718) -- 0:00:33
      506000 -- [-1014.755] (-1015.324) (-1019.591) (-1017.894) * (-1013.639) [-1013.687] (-1013.586) (-1017.010) -- 0:00:33
      506500 -- [-1014.309] (-1017.730) (-1015.172) (-1015.697) * (-1012.691) (-1016.654) [-1013.509] (-1015.087) -- 0:00:33
      507000 -- (-1014.136) [-1013.667] (-1013.889) (-1013.461) * (-1014.351) [-1016.541] (-1016.656) (-1018.105) -- 0:00:33
      507500 -- (-1015.811) (-1014.755) [-1014.140] (-1014.016) * (-1013.548) (-1018.519) [-1014.077] (-1014.982) -- 0:00:32
      508000 -- (-1013.372) (-1013.193) (-1016.065) [-1015.878] * (-1014.517) (-1018.431) [-1015.590] (-1013.401) -- 0:00:32
      508500 -- (-1020.579) [-1013.386] (-1014.846) (-1016.232) * (-1014.550) (-1014.243) (-1017.969) [-1012.842] -- 0:00:32
      509000 -- [-1015.385] (-1012.882) (-1013.536) (-1017.260) * (-1015.056) (-1012.792) (-1014.273) [-1015.267] -- 0:00:32
      509500 -- (-1015.964) (-1014.344) (-1013.749) [-1014.768] * [-1014.799] (-1014.809) (-1017.916) (-1014.770) -- 0:00:32
      510000 -- (-1016.564) [-1015.397] (-1015.907) (-1014.569) * (-1014.541) (-1014.855) [-1013.982] (-1013.135) -- 0:00:32

      Average standard deviation of split frequencies: 0.011135

      510500 -- [-1014.219] (-1012.683) (-1014.541) (-1012.774) * (-1017.134) (-1013.917) [-1016.878] (-1014.682) -- 0:00:32
      511000 -- (-1013.363) [-1012.821] (-1018.137) (-1013.260) * [-1014.882] (-1015.997) (-1013.472) (-1014.902) -- 0:00:32
      511500 -- (-1016.269) (-1016.652) [-1017.440] (-1012.904) * (-1013.559) (-1014.306) [-1013.380] (-1014.146) -- 0:00:32
      512000 -- [-1014.119] (-1013.130) (-1014.946) (-1016.582) * (-1015.805) (-1014.759) (-1014.439) [-1012.393] -- 0:00:32
      512500 -- (-1017.966) (-1018.418) (-1013.129) [-1015.659] * (-1014.169) (-1014.008) [-1016.200] (-1018.807) -- 0:00:32
      513000 -- (-1014.469) (-1014.392) (-1024.458) [-1013.854] * (-1014.157) (-1014.966) (-1012.891) [-1017.107] -- 0:00:32
      513500 -- (-1013.192) (-1017.770) (-1018.458) [-1013.880] * (-1014.565) (-1014.768) (-1013.066) [-1013.250] -- 0:00:32
      514000 -- [-1013.003] (-1012.942) (-1016.174) (-1014.546) * [-1016.318] (-1016.800) (-1015.938) (-1012.559) -- 0:00:32
      514500 -- (-1015.618) (-1014.069) [-1013.781] (-1014.668) * (-1018.621) (-1016.996) (-1015.358) [-1012.554] -- 0:00:32
      515000 -- (-1013.307) (-1014.161) [-1012.583] (-1015.528) * (-1021.923) [-1015.642] (-1013.827) (-1014.372) -- 0:00:32

      Average standard deviation of split frequencies: 0.010563

      515500 -- [-1017.609] (-1013.552) (-1014.636) (-1013.537) * (-1014.109) (-1016.457) [-1012.844] (-1014.947) -- 0:00:31
      516000 -- (-1014.366) [-1013.544] (-1014.379) (-1015.068) * [-1015.609] (-1015.950) (-1015.593) (-1013.858) -- 0:00:31
      516500 -- (-1012.743) [-1014.203] (-1013.959) (-1016.373) * (-1019.942) [-1013.565] (-1015.632) (-1012.606) -- 0:00:31
      517000 -- [-1014.652] (-1015.697) (-1013.293) (-1015.488) * (-1016.182) [-1013.086] (-1015.643) (-1015.627) -- 0:00:31
      517500 -- (-1014.830) (-1016.241) [-1013.772] (-1015.065) * [-1018.118] (-1012.747) (-1016.427) (-1014.049) -- 0:00:31
      518000 -- (-1013.385) (-1020.522) [-1013.257] (-1015.771) * (-1013.778) (-1013.291) (-1015.697) [-1013.451] -- 0:00:31
      518500 -- (-1015.631) (-1015.082) (-1015.040) [-1013.737] * (-1014.267) (-1015.300) [-1015.798] (-1014.320) -- 0:00:31
      519000 -- (-1015.613) [-1013.732] (-1018.444) (-1023.053) * (-1014.827) [-1014.874] (-1012.991) (-1014.315) -- 0:00:32
      519500 -- (-1017.559) (-1017.038) (-1015.344) [-1013.861] * (-1017.228) (-1013.517) [-1013.590] (-1016.774) -- 0:00:32
      520000 -- (-1015.704) (-1015.678) (-1014.009) [-1014.536] * (-1013.723) (-1013.796) (-1016.254) [-1015.291] -- 0:00:32

      Average standard deviation of split frequencies: 0.010299

      520500 -- [-1012.930] (-1019.179) (-1013.510) (-1013.221) * (-1013.516) [-1013.723] (-1012.913) (-1016.122) -- 0:00:32
      521000 -- (-1020.447) [-1015.734] (-1015.404) (-1013.776) * (-1017.243) (-1013.342) [-1016.977] (-1014.565) -- 0:00:32
      521500 -- (-1017.668) (-1014.936) (-1017.990) [-1012.892] * [-1014.904] (-1017.212) (-1014.326) (-1014.039) -- 0:00:32
      522000 -- [-1014.412] (-1014.093) (-1019.020) (-1013.574) * (-1012.948) (-1014.001) (-1013.506) [-1013.062] -- 0:00:32
      522500 -- (-1014.799) [-1012.505] (-1014.313) (-1014.748) * (-1013.019) (-1014.211) [-1013.929] (-1014.259) -- 0:00:31
      523000 -- (-1015.235) (-1012.888) [-1013.280] (-1016.849) * (-1013.662) [-1013.390] (-1014.897) (-1013.715) -- 0:00:31
      523500 -- (-1015.420) (-1013.630) [-1013.590] (-1012.432) * (-1016.473) (-1013.602) [-1013.126] (-1013.641) -- 0:00:31
      524000 -- [-1014.246] (-1013.752) (-1015.047) (-1013.509) * (-1014.525) (-1015.741) [-1015.455] (-1013.718) -- 0:00:31
      524500 -- (-1012.418) (-1016.812) (-1016.423) [-1013.672] * (-1015.565) [-1014.500] (-1017.154) (-1014.299) -- 0:00:31
      525000 -- (-1015.489) (-1013.127) [-1014.885] (-1014.525) * (-1017.562) [-1012.992] (-1014.217) (-1014.667) -- 0:00:31

      Average standard deviation of split frequencies: 0.010586

      525500 -- [-1015.284] (-1013.543) (-1017.628) (-1016.193) * (-1015.942) [-1014.372] (-1017.694) (-1016.015) -- 0:00:31
      526000 -- (-1016.207) (-1015.126) [-1014.444] (-1012.973) * (-1012.769) (-1014.768) (-1018.670) [-1014.460] -- 0:00:31
      526500 -- [-1016.041] (-1014.772) (-1015.879) (-1015.967) * (-1015.571) [-1014.366] (-1015.043) (-1019.187) -- 0:00:31
      527000 -- (-1013.843) (-1014.831) (-1014.959) [-1018.184] * (-1016.420) (-1015.484) [-1014.166] (-1015.076) -- 0:00:31
      527500 -- (-1019.087) (-1015.882) [-1013.815] (-1017.786) * [-1015.669] (-1013.460) (-1017.577) (-1013.637) -- 0:00:31
      528000 -- (-1015.262) (-1013.276) (-1016.802) [-1018.452] * (-1017.291) [-1013.452] (-1018.926) (-1013.624) -- 0:00:31
      528500 -- (-1014.664) (-1017.738) (-1016.030) [-1015.007] * [-1014.907] (-1014.715) (-1014.004) (-1013.664) -- 0:00:31
      529000 -- (-1013.186) (-1020.542) [-1013.139] (-1013.711) * (-1016.893) (-1013.186) [-1012.903] (-1012.841) -- 0:00:31
      529500 -- (-1013.306) (-1015.506) (-1014.126) [-1013.028] * (-1014.226) (-1015.076) (-1014.510) [-1013.404] -- 0:00:31
      530000 -- [-1013.025] (-1014.083) (-1016.084) (-1014.494) * (-1013.603) [-1017.853] (-1018.277) (-1017.640) -- 0:00:31

      Average standard deviation of split frequencies: 0.011182

      530500 -- [-1014.664] (-1014.933) (-1016.463) (-1017.860) * (-1013.013) (-1013.861) (-1016.000) [-1015.151] -- 0:00:30
      531000 -- (-1013.828) [-1015.602] (-1014.157) (-1014.893) * (-1017.150) (-1014.566) (-1013.814) [-1014.473] -- 0:00:30
      531500 -- (-1015.048) (-1018.875) [-1014.629] (-1016.678) * (-1016.853) (-1014.535) (-1012.866) [-1014.810] -- 0:00:30
      532000 -- (-1014.284) (-1015.508) (-1017.084) [-1014.744] * (-1014.311) (-1013.541) (-1012.921) [-1015.496] -- 0:00:30
      532500 -- (-1015.186) [-1014.068] (-1016.806) (-1016.367) * (-1015.488) (-1014.410) (-1014.861) [-1013.588] -- 0:00:30
      533000 -- (-1014.466) (-1014.948) (-1013.713) [-1013.413] * (-1015.562) (-1014.614) (-1015.496) [-1013.407] -- 0:00:30
      533500 -- (-1014.616) (-1014.898) [-1014.739] (-1014.311) * [-1014.429] (-1015.294) (-1016.241) (-1014.904) -- 0:00:30
      534000 -- (-1012.828) (-1013.531) (-1013.014) [-1014.272] * (-1014.164) (-1013.907) (-1016.034) [-1013.025] -- 0:00:30
      534500 -- [-1015.199] (-1014.102) (-1014.515) (-1017.871) * [-1015.733] (-1013.674) (-1014.933) (-1013.106) -- 0:00:30
      535000 -- (-1013.528) (-1014.838) (-1012.621) [-1014.318] * [-1014.166] (-1014.565) (-1014.346) (-1013.702) -- 0:00:31

      Average standard deviation of split frequencies: 0.011104

      535500 -- (-1012.839) (-1014.097) [-1014.715] (-1012.750) * (-1014.637) (-1016.392) [-1016.567] (-1013.686) -- 0:00:31
      536000 -- (-1016.414) [-1013.711] (-1013.555) (-1015.381) * (-1014.921) [-1013.369] (-1015.680) (-1013.053) -- 0:00:31
      536500 -- (-1013.406) [-1014.139] (-1017.792) (-1014.446) * (-1013.111) [-1012.730] (-1014.749) (-1012.640) -- 0:00:31
      537000 -- [-1018.169] (-1016.117) (-1016.183) (-1012.832) * (-1013.003) [-1013.588] (-1014.836) (-1014.668) -- 0:00:31
      537500 -- (-1015.747) (-1017.142) (-1016.377) [-1014.641] * (-1014.448) (-